3S7FA

Structural basis of substrate methylation and inhibition of smyd2
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
429
structure length
429
Chain Sequence
b'GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Structural Basis of Substrate Methylation and Inhibition of SMYD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 152
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3s7fA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s7fA01
1MVHA 3AS8A 3RKVA 4G23A 5HQ8A 4UQZA 3CEQA 5CCLA 3S7DA 2C0MA 3DB5A 4GA2A 5ARGA 4N2QA 3MEKA 1Y8MA 2FF4A 4H7XA 3QWWA 3FFLA 5TEGA 3CK9A 3RQ4A 3QWPA 3ZFWA 4GZ6A 3M58A 2VSYA 3AS5A 3VTXA 4HOTA 2F69A 4NJ5A 3SW9A 3RO3A 4YVOA 4JA9A 4Y6CA 5JHNA 4YNPA 4N3AA 4APOA 5G04C 4Y6WA 5T0KA 4IN3B 4ME2A 3E4BA 3M59A 5JIYA 3F9YA 3TAXA 4YNDA 4JLGA 3KD7A 5BNWA 5CCMA 4WNEA 4J8DA 4XI0A 5EX3A 4BWRA 4FMUA 4C1QA 1IHGA 5AYWD 3GYZA 2XCBA 4BTAA 3OXGA 4NVQA 4AU7A 4JHRA 4AY5A 2KCVA 5FZQA 4O30A 3F9XA 4GCOA 1MUFA 1KT0A 2KCKA 3MO2A 3SWCA 3CVNA 3N71A 2R5SA 4GA1A 4B94A 1A17A 3MV2B 2W5YA 3AS4A 4YPEA 1ELRA 5FTPA 5FZRA 2LSVA 3IEGA 4I9EA 4CDRA 4J83A 5DBKA 3CVLA 2WQHA 4EQFA 1MT6A 5LCWJ 2J9QA 2KCLA 4BTBA 3KAEA 3DALA 2XGOA 5T0MA 4HORA 4UQXA 1ELWA 2VGXB 4RG6A 2VSNA 4UQYA 4N2SA 4BT9A 5JJ0A 1KLXA 3ZHEB 1XNFA 2HYZA 4O6FA 5A7DB 3CBOA 3WXXA 2VQ2A 3QWVA 4I9CA 5F6KC 5AYFA 5C1DA 2AVPA 5BW8C 2LNIA 4W9RA 2P58C 4N5CA 3RAYA 3UQ3A 3ASDA 5TTFA 5KJLA 1W3BA 4N3BA 5JJ7A 2UY1B 3CBPA 2KATA 1B89A 2VGXA 2LSUA 1QQEA 5T5GA 3ASHA 3KS2A 3K5KA 1IYGA 3RJVA 3M56A 3K9IA 2I6HA 3PDNA 1MVXA 4GZ3A 5LSXA 3RU0A 3Q15A 5LSZA 2E2EA 3S7FA 4CGVA 4JL0A 5JJTA 2IFUA 4NRHB 4MI5A 2QPWA 4I1AA 5G04J 4JDSA 5JINA 4A1SA 3CK8A 2Q7FA 1E96B 4AM9A 2XCCA 2UY1A 5D0QD 3R9AB 3ZN3A 2MHKA 3S8PA 3ULQA 4GYWA 3ZPJA 4RG9A 3U4TA 3M54A 3RIBA 1XQHA 3QKYA 4GCNA 4IJDA 2VYIA 2QFCA 4YNMA 1QZ2A 4N3CA 3KMAA 2HO1A 2GW1A 4J7IA 4HOUA 2XPIA 3MO0A 4LDGA 4J8FA 1NA3A 4WNGA 4I2WA 3RO2A 5HI7A 1H3IA 3M53A 3CVPA 5DIZA 5KJKA 3CV0A 3MKRA 5F6LA 1HH8A 1FCHA 2XGSA 3PE4A 3ZGQA 1NA0A 4U04A 3F9WA 3ESKA 3FWVA 5BT1A 2JV0A 3M57A 1ZBPA 2O8JA 5KJMA 4YVQC 4U0UA 3S7BA 4J8OA 4GYYA 4G24A 3OXLA 5EX0A 3VUZA 4GZ5A 5EG2A 4J0UA 3SZ7A 4LEUA 2PZIA 2NC9A 3QOUA 1ZU2A 2KC7A 4J8EA 4YPAA 2C2LA 4RZ0A 2DBAA 3ASFA 5JJ6A 4U0ZA 2YQ8A 4AIFA 5ARFA 4UI9K 4F3VA 2W5ZA 4KXKB 1N6CA 4I17A 1ZKKA 3TG4A 3MA5A 2BUGA 3TGOA 4WNFA 5CPRB 3F9ZA 5EKQD 3CKBA 2XGMA 3U3WA 1O9SA 2BQZA 3LCAA 3ZHEA 3ASGA 1N3JA 2L6JA 4XIFA 3PE3A 4G26A 2UWJG 2PL2A 3TG5A 4BT8A 4WNDA 5M72A 3BEEA 1P5QA 1PEGA 2G46A 3GZ2A 2PQNA 3QDNA 3RJWA 3KMTA 2FI7A 3JYSA 3GW4A 4CGWA 4HOSA 3HYMB 5D0OD 3GZ1A 5KJNA 4I51A 4G2VA 2YHCA 3EDTB 4U07A 3SF4A 3MV3B 3FPDA 4GPKA 3LYAA 5F59A 4AY6A 4QEPA 3Q49B 4ABNA 2FEZA 3O48A 3UUXA 5A6CA 1WM5A 4I2ZA 1YA0A 3OXFA 3CBMA 2XEVA 2OOEA 3BO5A 3OOIA 2FBNA 2R3AA 5FJYA 4XI9A 3MO5A 1N6AA 4KBQA 1PC2A 4WUYA 3EP0A 4H12A 4E47A 4U0SA 3M5AA 4GA0A 2VGYA 4IJ8A 3CVQA 3UPVA 2ONDA 4Z4PA 5G05C 3VTYA 5G05J 3CK7A 4BUPA 1HXIA 1OUVA 3HNAA 4MI0A 4KYOB 1TJCA 3NF1A 4G25A 4UI9C 4QEOA 4H7YA 3LY9A 1HZ4A 1WAO1 2C0LA 4UI9J 5LCWC 3M55A 3Q4AB 4NQ0A 3CKCA 3VV0A 5TH7A 2JLBA 1ML9A 5FT9A 2RFIA 2V5FA 3FP3A 3OPEA 2WPVA 2IF4A 2FO7A 4GYOA 5F5EA 3LPZA 4YPUA 3KMJA 3S7JA 1NZNA 3IHXA 3LY7A 4N39A 3Q5MA 2Y4TA 2IGQA 2Y4UA 3LKUA 4J7FA 4JA7A 2PQRA 4G1TA 1KT1A 4HOQA 5CHEE 3LY8A 3Q47B 2HR2A 3URZA 4QENA 5FZSA 3OS5A
chains in the Genus database with same CATH superfamily
3RKVA 1K8KG 2J08A 4G23A 4N5QA 5HQ8A 4EECA 4LNBA 3FEYA 4GMLA 3UXGA 5ARGA 2FF4A 1NI1A 4A3VA 2J4BA 3FFLA 3QWPA 4GZ6A 3M58A 1OCZE 3VTXA 3DEOA 4ILHB 2CHXA 2V5QC 3TWTA 1SW6A 4YNPA 5T0KA 3E4BA 3L54A 5ENPD 3RAUA 5JIYA 1RZ4A 2LAIA 3V79K 5BNWA 3VLFA 4XI0A 4Q69A 1NL4A 4FMUA 3CHQA 1IHGA 1KPSB 3GYZA 1E90A 4BTAA 4JXTA 3RRUA 2M63A 5FQ7A 4O30A 2AXUA 4JW1A 3AAAC 3TWSA 3SNXA 3D9IA 3PZ2A 3V30A 4ZHBA 3CVNA 3N71A 3Q78A 4GA1A 2WMNA 2L0IA 2BF0X 4UWFA 3NBNB 3UT7A 3CSTA 3IEGA 4F1SA 2EIJE 2P9NG 5J08A 3C3OA 2WQHA 3DXMG 1MT6A 3F6QA 3SBTB 5LCWJ 3DALA 3TWWA 4PUCA 1DCEA 4BX9A 1GW6A 4AEZC 2XQ0A 4RVBA 3FTWA 3FTZA 3PREA 1ZB1A 4AP2A 4UQYA 2H6GA 2ZISA 1XNFA 1TN6A 3BU8A 2PNNA 4ANVA 5A7DB 3QWVA 4FP7A 3ZU7B 2FULA 4Q94A 3ZIMA 5BW8C 3CVVA 4W9RA 4N5CA 2EILE 3ONKA 2WXNA 3R9MA 3FTUA 5E76A 4PH4B 3ABKE 5AQAA 5TTFA 1UG3A 2X6KA 4EHMA 5KJLA 4N3BA 1B89A 3DRAA 1O1SA 2F0YA 5AENA 3NB2A 4APFA 3PVLA 3U64A 4FJYA 1V55E 1MVXA 1IXVA 5EYLA 3RU0A 5AAOA 2EIKE 3S7FA 4CGVA 5G04J 5KNHD 4JEHA 3UIOC 4JDSA 3UM0A 5LOZA 3CK8A 4AM9A 2XRZA 1TEZA 1BD8A 3I5PA 2MHKA 4J8YA 3S8PA 3UM1A 4DLQA 3U9WA 3HXDA 3SY2A 3U4TA 1TN7A 4RQIA 4LRZA 4C0EA 4TUUA 2XZDG 3B13A 5FQ8A 4TXQA 2OCCE 3L9TA 4N3CA 3DPYA 3DBSA 4CCAA 1TN8A 4J7IA 1DNPA 2H6IA 4J8FA 2BKKB 3FTXA 4FJZA 5HI7A 1H0AA 3M53A 1NP7A 3UIPC 2GRRB 4HB5A 2P9LG 4G8KA 3FH7A 5F6LA 2XGSA 1NA0A 3D9NA 1INZA 4U04A 2GRQB 3CQCB 4J8OA 3Q79A 4ACLA 2ZIRA 5EG2A 3SZ7A 5EN5D 2PZIA 3QOUA 4YDYA 4JHKA 2KC7A 4J8EA 4RZ0A 3CHSA 2DBAA 4MS6A 4U0ZA 4AIFA 4GZCA 3BG0B 4NIKA 5LFAA 4F3VA 4KXKB 1N6CA 3TG4A 3LJNA 1YCSB 4K03A 2BUGA 4WNFA 4LG6A 2X3MA 4JPSA 3CKBA 2XGMA 3DSVA 2BQZA 3LCAA 4BEPA 4DX6D 3ASGA 5HRYA 5KBAA 1N3JA 2L6JA 3CVYA 3PE3A 3EU5A 1MX4A 3PZDA 3VLEA 2UWJG 3MKQB 4XZ4A 5JMND 3LS8A 2XEHA 4WNDA 2G46A 2AW6A 1OWMA 1IQRA 3GZ2A 3RJWA 2FI7A 4P29A 5FQ6A 3UM2A 3JYSA 4HOSA 2A5EA 3G2VA 5B3SE 5D0OD 5KJNA 3VLDA 1H2VC 1DC2A 4PS7A 1HE8A 4JHJA 1XGWA 3LYAA 3ABME 3R7RA 5ENQD 2V4LA 1K3ZD 1OCCE 3OOIA 1FVHA 2FBNA 2DYSE 3TL5A 1H6OA 4XI9A 3HXFA 3AJIA 1N6AA 2WVIA 3ZKJA 4H12A 2WM9A 5HS0A 2Y0BG 4OAUC 4L23A 5KNGA 2ONDA 4Z4PA 2P2CP 2CFZA 2HM8A 4O60A 3VTYA 1HXIA 1OUVA 3U66A 2QYUA 3NF1A 4K0RA 4KVMA 4H7YA 1HZ4A 5LCWC 5CMYA 5C2YA 2RD0A 4JVSA 4EZKA 4F7AA 2JLBA 3FU5A 5FT9A 1ML9A 3OPEA 2WPVA 5F5EA 3LPZA 4J8SA 1KZOA 3TXMA 2WMOA 3FDHA 3OTNA 1N11A 4JB8P 4N39A 2IQCA 1S63A 3KEAA 3LKUA 1Q2ZA 2ZGGA 4K5AB 1KT1A 4HOQA 5CHEE 3JQ0A 5CRVA 4AVXA 3Q47B 5FZSA 3TWRA 3OS5A 2WXJA 4M7CA 3S7DA 5CMWA 2BTDA 2C0MA 5AQ7A 4H7XA 4C48B 3ZXPA 2ZXWE 3EIQC 3QWWA 3CK9A 4HFGA 5AN8A 4HOTA 3CHMA 4NJ5A 3RO3A 4CYMD 5H7PA 3APFA 3UKUG 4X8QA 2GGFA 4N3AA 5G04C 4IN3B 2GRMA 4ME2A 4LNGA 4YDWA 2ILRA 3TAXA 4JLGA 3UM3A 4WNEA 4J8DA 5EX3A 5CEDB 1TNUA 3DSWA 3AG2E 3UX4A 3FUMA 3G2SA 3HXCA 1MYOA 3F9XA 4EBAG 4FLBA 2XPZA 2KCKA 4FU3A 3SWCA 4GU5A 1N94A 4XKCA 1Z6TA 2R5SA 3CGHA 2W5YA 3BG1B 2MOWA 3AS4A 4HI9A 5FTPA 4NACA 2LSVA 2IO2C 4I9EA 1BI8B 5DBKA 4EQFA 2B0OE 2CHZA 2I9CA 2KCLA 4BTBA 4FADA 2LXLA 3W9FA 1QBQA 2ETBA 5BPPA 4AV7A 4BSZB 3ASOE 3C5RA 4UQXA 4A1GA 3ZVVA 4V3IA 3J5QB 2P9KG 4N2SA 4Z68A 5JJ0A 1KLXA 3C3QA 4TXPA 1HG5A 2RG8A 3I4RB 3ABLE 3ASNE 2A5UA 4WWPA 4XE0A 3L08A 3ZYQA 2LNIA 2ZGDA 4CEMA 3RAYA 3UQ3A 3ASDA 3MGBA 3Q9UC 2OVBA 2XPYA 4ATZD 1E7VA 3CBPA 2KATA 4LNUD 2VGXA 2LSUA 3JUIA 1Z5SC 2V4HC 3KS2A 4DJAA 1IYGA 3FTVA 3RK6A 3M56A 2I6HA 3PDNA 5LSZA 1BU9A 1E8YA 4JL0A 5JJTA 2WXHA 5ENTD 3ZYKA 2QPWA 4I1AA 3HHMA 1N95A 3JCKC 4A1SA 4GAAA 2R02A 3FUDA 2Q7FA 1E96B 1AP7A 2UY1A 3ZN3A 3QAQA 1SA5A 1LTXA 4TRQA 3ULQA 2NYJA 4QFVA 1JUQA 3FULA 3ISMC 3P1UA 4GYWA 2B6CA 4DX2A 1K1AA 3AG1E 1N52A 2GRNB 1BPOA 1UOHA 2X6JA 1Z3XA 3L82A 5B1BE 2VYIA 5G55A 1H2UA 4YNMA 1SA4A 1QZ2A 3C98A 4BY6A 1E8WA 1KZPA 3D9MA 4CDNA 2XPIA 4LDGA 4D10C 3QK0A 3JQ1A 3QJZA 4I2WA 2XZTG 3RO2A 3CVPA 5DIZA 5KJKA 5AQ9A 3ZYLA 3CV0A 1E8ZA 4GTQA 1JWGA 2R05A 3F9WA 2JV0A 2O8JA 5KJMA 4G24A 2I1KA 4J0UA 2NC9A 3FUFA 1ZU2A 4YPAA 2GROB 2C2LA 3SO8A 4EPZA 2P9IG 3FHEA 4KZ0A 4GTRA 4EBAA 3HG0D 3KSQA 2VGEA 3DSSA 4UI9K 4I17A 5E75A 1RW2A 5AIJA 3TGOA 5CPRB 3SFZA 3F9ZA 4XEIG 3PS6A 4UUCA 4MRUA 3ULEG 1N4SA 2RFAA 3FY4A 3EHRA 2PL2A 2ETCA 4BT8A 3IXEA 3BEEA 4A3TA 3KSLA 4U8YD 1PEGA 2J8SD 3KMTA 4BFRA 4CGWA 2PM7A 5ENOD 3GZ1A 2RKKA 1X81A 1D8EA 2IOLA 3EDTB 4U07A 1N0QA 4E6HA 5LX8A 1SVXA 3IV0A 4GPKA 3FU0A 1OWOA 4QEPA 3Q49B 1N0RA 1WY6A 3JXIA 2FEZA 3UUXA 1YA0A 2XEVA 3CSFA 1JWFA 3ZNGA 3D9HA 2CG3A 3BO5A 5T8IA 2OV8A 2R3AA 5FJYA 2Y69E 1S64A 4DI3A 3HVEA 3ONLA 4J7WA 4KBQA 3NAWA 2LAHA 3APCA 4U0SA 4HLLA 4HQDA 4GA0A 4LCTA 2XENA 4IJ8A 3CVQA 5G05C 3TJPA 4BUPA 3CK7A 1K1BA 3V2XA 1MX2A 4MI0A 4DPRA 4KYOB 1TJCA 3PEUB 4UI9C 3LY9A 3L6AA 3EHQA 4ANXA 3M55A 3Q73A 5KWDA 4NQ0A 3VV0A 5TH7A 1H19A 5BXOA 4RSYA 4B0ZA 2IF4A 2FO7A 4M3OA 3E37A 4HLEA 4ANWA 2DIWA 3EHNA 2Y3AA 4TUMA 3KMJA 4HBDA 2F8XK 3DWLG 2BEDA 3LY7A 4B93B 3Q5MA 2Y4TA 4I6GA 4AXHA 2YNQA 4GMJA 3SFYA 3E30A 1LF8A 4JD2G 1MVHA 4HVBA 3EUVA 1OCOE 4XKBA 1MZCA 2WXRA 3CIAA 5B1AE 4UQZA 3CEQA 3TXNA 5CCLA 3T8MA 1JCQA 2DZNA 3T9KA 2CG2A 4GA2A 5CEAA 4N2QA 3MEKA 4YDOA 5LP0A 2X6FA 4HS2A 1BLXB 5TEGA 3FH8A 3CQGB 3ZFWA 4I6EA 2OVFA 2VSYA 4DX5D 2F69A 2AJAA 3SW9A 2ZU6B 3Q9NC 4E85A 4YVOA 4U96D 3NZUA 4CZ2D 2YINA 4AJWA 4KT6B 5JHNA 4B8CB 4DI4A 1OWPA 3F9YA 4YNDA 3KD7A 1N54A 1FVFA 4BWRA 5AYWD 1EDUA 2EIME 2EQXA 1O5MA 1MQSA 3OXGA 4AU7A 2MYOA 5D2MC 4JHRA 4AY5A 3APDA 3RRMB 4GCOA 3DPDA 1MUFA 3EIJA 4DX7D 3MO2A 3MCXA 3D9KA 1SZ9A 1E7UA 1U3CA 2P9PG 3TWUA 2KZTA 4B94A 4EZLA 3MV2B 4BERA 3CHRA 5FZRA 5ENSD 4WWOA 3ML8A 4CDRA 3CVLA 3UMVA 3B7RL 3NOGD 2J9QA 3KAEA 1O1TA 3LVQE 5BV1A 3AG4E 2J07A 1E8XA 5A23A 4LERA 2WXIA 3ESLA 1N9AA 1ELWA 1D9SA 2VGXB 4BT9A 3HIZA 4U8VD 3D9JA 3ZHEB 3LDZA 4KZCA 3BQOA 5IY5E 2HYZA 4O6FA 4OVVA 3CBOA 2VQ2A 3UINC 3B7SA 2AVPA 5AQBA 4C9BB 4JC8A 3L22A 4DK5A 4ILIA 1W3BA 3FH5A 4YDEA 4MBGA 2UY1B 2P9SG 1QQEA 5T5GA 3K5KA 3IHVA 4U8HA 3K9IA 2IOSA 5LSXA 3HXBA 3Q15A 3CR3A 3PUJA 4WAFA 1EF1C 2WXKA 4MI5A 4EZJA 1HU3A 3B7UX 2Y1LE 5JINA 4FULA 3UTMA 4IRUA 3OAWA 3SI5A 5D0QD 1H2TC 1DVPA 4GTSA 4F1PA 2L9BA 4JZYA 3SGHA 3HDXA 4DRXE 4GTPA 3MYVA 3FUJA 1PAQA 1OWNA 4KVOA 4L1BA 3NOCD 2QY7A 1H6PA 2QFCA 2VSXE 3J5PA 1L5JA 2QYJA 3KMAA 5BXUA 3CVWA 1N4PA 1S70B 3D9LA 4U95D 1UW4B 4ATGA 1JCSA 2X6IA 3JUEA 3MKRA 1FCHA 2JEKA 3ZGQA 2XEEA 3ESKA 3FWVA 4A55A 5BT1A 3EU9A 4AOFA 4YVQC 4U0UA 3S7BA 4GYYA 3IHYA 3VUZA 4LEUA 3W9GA 4F53A 3QC1A 4HRNA 3B7TA 2DZOA 4Q96A 4CRWA 3ASFA 5HKPA 2VTBA 5JJ6A 3S2AA 2W5ZA 1ZKKA 4FHKA 3MA5A 3ZRHA 2YHEA 2VSOE 3IKOB 1V54E 3KEZA 3MX3A 1O9SA 2WXPA 3ZHEA 5FWQA 3TWXA 3CVXA 3PUKA 2H6HA 4L9PA 4B89A 3DSTA 5M72A 3AU4A 4B8AA 4FC8A 5FQ4A 3QDNA 3HVEB 1UN8A 2AWIA 1IQUA 3SQVA 3HYMB 3CHOA 2JABA 4OYSA 1FT1A 1TNYA 2MRIA 2YHCA 1OXJA 1WDYA 3SF4A 3ZW3A 2XS8A 3MV3B 3FPDA 1N4QA 5ENNA 4RLYA 5A6CA 1WM5A 3CHPA 4I2ZA 3FUNA 4G8LA 2WXMA 2OOEA 4I1MA 1QNFA 5JHBA 2XHEA 3LJ3A 4WUYA 4O1OA 4BETA 3EJNA 4PS3A 4E47A 3M5AA 1JPLA 2V8SE 3IBEA 4TV3A 5CECB 3UPVA 3ZUVB 2J4DA 1EYHA 2L0TB 3FU6A 1A5EA 4GTVA 1TJFA 4KMOA 2VJ8A 3RSEG 4MKTA 4G25A 3G2WA 1AWCB 4CT0A 1WAO1 5EDSA 2C0LA 2R2LA 2WXGA 3WG7E 3FUEA 4GMRA 3G2TA 3CKCA 2RFIA 3FP3A 2IEJA 3SBSA 1OY3D 4GYOA 4PS8A 2KM4A 4YPUA 3PZ1A 3EHMA 2IGQA 3TWQA 3LVRE 2PQRA 4G1TA 3JXJA 2XRYA 5EILA 4R7LA 3V31A 3AS8A 5J90A 1HO8A 3PZ4A 4K5CA 1WG0A 3DB5A 2WXOA 1Y8MA 1UN9A 4XX5A 3QNKA 4DX1A 2AXZA 3RQ4A 2LXMA 3AS5A 3D3MA 3E32A 1U3DA 2IO3C 4JA9A 5KCMA 4Y6CA 2KZTB 4APOA 4Y6WA 2DYRE 5D66A 4L7TA 3M59A 2DCPA 2CFUA 1QYMA 2J49A 2P9UG 3T8KA 5CCMA 3NQPA 1YYHA 4UWKA 3RRNB 4ACKA 4C1QA 4OAVB 2XCBA 4NVQA 1UJKA 4NURA 1TNZA 3FUHA 2KCVA 3E33A 5FZQA 3BUAA 1NFIE 3LEWA 4ILGA 1KT0A 1BI7B 5T4YA 3R7QA 3FU3A 1LD7A 2L6BA 1A17A 3Q7AA 2I2OA 1HX8A 4YPEA 1ELRA 3O4ZA 3P2BA 4QQIA 4J83A 5ANRA 4MLPA 2WQ7A 4URKA 5AARA 2XS1A 2DVWA 1HS6A 3CLJA 1TR4A 3QARA 5JHAA 2XGOA 4GPMA 3AU5A 5T0MA 3UT8A 3DEPA 4HORA 4U7EB 5CBNA 4LUNU 4RG6A 5BV0A 2VSNA 4GTTA 5EYPF 2R03A 3SD5A 3ZEFA 2IJGX 4U63A 3WXXA 1OT8A 4I9CA 3L17A 4A63B 5F6KC 4O1PA 5AYFA 3AG3E 3I3NA 5C1DA 3QB2A 2P58C 3D9PA 1UJJA 3MZLB 4JEUA 3PH0C 2H6FA 5FINA 4DLOA 5JJ7A 3DSXA 4HNAD 4PDXA 3FUIA 3ASHA 1O1RA 2QC9A 2I1JA 3RJVA 4GZ3A 2V0PA 2CHWA 2E2EA 2LUHA 4DUIA 1MHQA 5CRUA 2IFUA 4NRHB 3ENEA 4IYPA 1HFAA 2AXVA 2F8YA 3L16A 3FEXA 4GTMA 2XCCA 3R9AB 3PRZA 5ANLA 3ML9A 4C0MA 1TNBA 4UWHA 3X2QE 5FIOA 2A4ZA 3ZPJA 1OWLA 4RG9A 4BESA 2WXQA 3M54A 3RIBA 1XQHA 1DCQA 3QKYA 4GCNA 2PM6A 3UI2A 4UWGA 3PEVB 4IJDA 1SQMA 4WWNA 3C3RA 3G2UA 1YMPA 3E34A 2E0IA 1D8DA 2HO1A 2GW1A 1LD8A 5ITZF 2X6HA 4HOUA 3MO0A 1U2VG 2VTBB 1NA3A 4WNGA 1H3IA 2QZAA 2IU1A 3GZSA 4GTOA 3B95A 1HH8A 5CERB 4HI8A 3PE4A 5CBOA 4CT4A 5BUZA 3V2OA 3HXEA 3Q75A 1H6KA 3M57A 1ZBPA 3SFXA 4OVUA 3OXLA 3PNLB 5EX0A 4GZ5A 3L13A 3UKRG 3ZXSA 2WXFA 1G3NB 3T5XA 4UWLA 2WQ6A 1MX6A 2YQ8A 4TXRA 5ARFA 2F37A 2OEWA 3C72A 1N4RA 4HXIA 3D9OA 4HRMB 2BKGA 3ZYMA 3PNTB 1MJ0A 4FHJA 4CDMA 5EKQD 3U3WA 4K5BA 4L2LA 2WB2A 5AJDA 5AJLA 1TYQG 3B7BA 4XIFA 2R59A 4G26A 1FPPA 4GZDA 1IHBA 4I1OB 2J09A 1Z3YA 3TG5A 4I43A 2R17C 1EPUA 4ANUA 1P5QA 1HF8A 2DWZA 5T3RA 2PQNA 5G2NA 3Q7FA 3GW4A 3UT4A 1S0PA 1TNOA 4J6IA 4F6RD 1VDYA 3NZSA 4I51A 2X38A 4G2VA 2IONA 2LO6A 3FUKA 3DSUA 3PZ3A 4BSXA 1JCRA 4AY6A 5F59A 4ABNA 3O48A 3MKQA 3I4GA 3OXFA 3CBMA 2RFMA 2ETAA 2OEVA 4G11A 3MO5A 4ZFHA 4FA6A 1PC2A 3EP0A 1X5BA 1ELKA 2GRPB 2VGYA 4I6JA 2EINE 3T5VA 5G05J 3LXUX 3FTSA 3HNAA 4IULA 5EIDA 2KXPC 4QEOA 4UI9J 4L2YA 5JA4D 3HRAA 3Q4AB 3ULYA 1IKND 2IY0C 5ENRD 4LSZE 4BX8A 2V5FA 1PY1A 2KBXA 3TWVA 1HG2A 3SHFA 2HE0A 4HRLA 2NSZA 4FLHA 3S7JA 1OCRE 1NZNA 3IHXA 2FO1E 1Y6IA 4GB9A 2Y4UA 3CVUA 3FTYA 4J7FA 3DXKG 4JA7A 2NXPA 2GRLA 1SZAA 3LY8A 2WXLA 2HR2A 5EIBE 3URZA 4QENA 1FT2A 3MJWA
chains in the Genus database with same CATH topology
1MVHA 3AS8A 3RKVA 4HVBA 5J90A 2J08A 4G23A 4XKBA 1HO8A 2WXRA 3CIAA 4EECA 5HQ8A 3FEYA 3CEQA 4UQZA 3S7DA 3TXNA 5CCLA 4GMLA 5CMWA 3T8MA 2BTDA 2C0MA 3DB5A 2WXOA 2CG2A 4GA2A 5ARGA 4N2QA 3MEKA 1Y8MA 5LP0A 1UN9A 2X6FA 2FF4A 4HS2A 3QNKA 4H7XA 4XX5A 3EIQC 3QWWA 4A3VA 2J4BA 3FFLA 5TEGA 3CK9A 4HFGA 3FH8A 2AXZA 3RQ4A 3QWPA 3CQGB 3ZFWA 4I6EA 4GZ6A 2OVFA 3M58A 2VSYA 3AS5A 3VTXA 4HOTA 2F69A 3CHMA 4NJ5A 3SW9A 2ZU6B 3D3MA 3RO3A 1U3DA 4ILHB 2CHXA 4E85A 4YVOA 4JA9A 3NZUA 5KCMA 2YINA 3APFA 4AJWA 4Y6CA 4KT6B 5JHNA 2GGFA 2KZTB 4YNPA 4N3AA 4APOA 5G04C 4Y6WA 5T0KA 4B8CB 4IN3B 2GRMA 4ME2A 3E4BA 3L54A 4DI4A 4L7TA 3M59A 1OWPA 2ILRA 5JIYA 3F9YA 2DCPA 3TAXA 2LAIA 4YNDA 2CFUA 2J49A 4JLGA 3KD7A 1N54A 5BNWA 5CCMA 4WNEA 3NQPA 4UWKA 3RRNB 1FVFA 4J8DA 4XI0A 5EX3A 3VLFA 4ACKA 4BWRA 4Q69A 3UX4A 4FMUA 4C1QA 3CHQA 1IHGA 5AYWD 1EDUA 2EQXA 3GYZA 1E90A 1MQSA 2XCBA 3FUMA 3OXGA 4JXTA 4BTAA 4NVQA 3G2SA 1UJKA 3RRUA 4AU7A 2M63A 4JHRA 4NURA 4AY5A 5FQ7A 3FUHA 2KCVA 5FZQA 2AXUA 4EBAG 4JW1A 3APDA 4FLBA 4O30A 3F9XA 3RRMB 2XPZA 4GCOA 3LEWA 3DPDA 4ILGA 1MUFA 1KT0A 2KCKA 3EIJA 4FU3A 3D9IA 3SNXA 3MO2A 3MCXA 4GU5A 5T4YA 3SWCA 3R7QA 3FU3A 3D9KA 3CVNA 1Z6TA 3N71A 4XKCA 2R5SA 3CGHA 4GA1A 1SZ9A 1E7UA 1U3CA 2WMNA 2KZTA 4B94A 2L0IA 4EZLA 1A17A 2BF0X 4UWFA 3MV2B 2I2OA 3UT7A 2W5YA 3BG1B 2MOWA 1HX8A 3AS4A 1ELRA 4YPEA 3CSTA 3CHRA 3O4ZA 4NACA 5FTPA 5FZRA 3P2BA 4WWOA 2LSVA 3IEGA 4F1SA 3ML8A 4I9EA 4CDRA 4J83A 5DBKA 5J08A 3CVLA 4MLPA 5ANRA 2WQHA 2WQ7A 4EQFA 1MT6A 4URKA 3UMVA 2CHZA 3SBTB 5LCWJ 2I9CA 3B7RL 2J9QA 2KCLA 4BTBA 3KAEA 4FADA 3DALA 1HS6A 3LVQE 3CLJA 3QARA 4PUCA 5BV1A 2J07A 4BX9A 1E8XA 5JHAA 5A23A 1GW6A 2XGOA 4AEZC 3AU5A 2XQ0A 4RVBA 5BPPA 4LERA 3FTWA 4AV7A 3UT8A 2WXIA 3ESLA 4HORA 3FTZA 3PREA 5T0MA 4UQXA 1ELWA 4A1GA 2VGXB 3ZVVA 4LUNU 4AP2A 4RG6A 4V3IA 5BV0A 2VSNA 4UQYA 4N2SA 4BT9A 3HIZA 5JJ0A 3SD5A 3D9JA 3ZEFA 1KLXA 3ZHEB 3LDZA 4KZCA 1XNFA 1HG5A 2IJGX 4U63A 2RG8A 2HYZA 4O6FA 4OVVA 4ANVA 5A7DB 3CBOA 3WXXA 3I4RB 2VQ2A 3QWVA 4FP7A 3L17A 4I9CA 2A5UA 5F6KC 2FULA 4WWPA 5AYFA 3I3NA 4Q94A 3B7SA 2AVPA 4XE0A 3L08A 5BW8C 3QB2A 3ZYQA 3ZIMA 5C1DA 2LNIA 4W9RA 2P58C 4N5CA 3ONKA 4CEMA 2WXNA 4C9BB 4JC8A 3RAYA 3FTUA 3UQ3A 3ASDA 5E76A 3MGBA 3L22A 3D9PA 4PH4B 4DK5A 1UJJA 4ILIA 1UG3A 3MZLB 4JEUA 5TTFA 2X6KA 3PH0C 1W3BA 2OVBA 5KJLA 3FH5A 4N3BA 4DLOA 2XPYA 5JJ7A 1E7VA 2UY1B 3CBPA 2KATA 1B89A 2VGXA 2LSUA 3JUIA 4PDXA 5AENA 1QQEA 5T5GA 3FUIA 3ASHA 3KS2A 3PVLA 4APFA 4DJAA 3K5KA 3U64A 1IYGA 3IHVA 2I1JA 3RJVA 4U8HA 3FTVA 3RK6A 3K9IA 2I6HA 4FJYA 3PDNA 2IOSA 3M56A 1MVXA 4GZ3A 5LSXA 3RU0A 3Q15A 3CR3A 3PUJA 2V0PA 2CHWA 4WAFA 5LSZA 2E2EA 3S7FA 1E8YA 1EF1C 4CGVA 1MHQA 4JL0A 5JJTA 2WXHA 2IFUA 2WXKA 4NRHB 3ZYKA 4MI5A 2QPWA 3ENEA 4I1AA 4EZJA 3HHMA 5G04J 1HU3A 4IYPA 1HFAA 2AXVA 3B7UX 3JCKC 4JEHA 4JDSA 5JINA 4A1SA 3L16A 5LOZA 4GAAA 4FULA 3CK8A 3FUDA 3FEXA 2Q7FA 1E96B 4IRUA 3OAWA 3SI5A 4AM9A 2XRZA 2XCCA 2UY1A 5D0QD 1TEZA 3R9AB 3PRZA 5ANLA 1H2TC 3ML9A 3I5PA 3ZN3A 4C0MA 3QAQA 2MHKA 1DVPA 4UWHA 3S8PA 2A4ZA 4TRQA 3ULQA 4DLQA 4QFVA 1JUQA 3U9WA 3FULA 3P1UA 4GYWA 3ZPJA 1OWLA 4RG9A 3U4TA 2L9BA 1N52A 4JZYA 3SGHA 2WXQA 3M54A 1BPOA 2X6JA 3RIBA 1XQHA 3HDXA 3QKYA 1Z3XA 3MYVA 4GCNA 3FUJA 1PAQA 1OWNA 2PM6A 4LRZA 4TUUA 4C0EA 4UWGA 4KVOA 4L1BA 3PEVB 4IJDA 2VYIA 5G55A 1SQMA 2QY7A 3B13A 4WWNA 5FQ8A 1H2UA 3G2UA 2QFCA 4YNMA 2VSXE 1QZ2A 4N3CA 1L5JA 2E0IA 3DBSA 3KMAA 4CCAA 3CVWA 3C98A 2HO1A 2GW1A 4BY6A 4J7IA 1DNPA 1E8WA 3D9MA 2X6HA 2XPIA 4HOUA 4CDNA 3MO0A 4LDGA 4D10C 3QK0A 3D9LA 4J8FA 3JQ1A 2VTBB 1NA3A 4WNGA 3QJZA 4I2WA 3FTXA 1UW4B 4FJZA 3RO2A 5HI7A 4ATGA 1H0AA 1H3IA 3M53A 3CVPA 1NP7A 5DIZA 5KJKA 2X6IA 2IU1A 3ZYLA 3GZSA 3CV0A 3FH7A 3MKRA 5F6LA 1HH8A 1E8ZA 1FCHA 2JEKA 2XGSA 3PE4A 3ZGQA 1JWGA 1NA0A 3D9NA 4CT4A 5BUZA 1INZA 4U04A 3F9WA 3ESKA 3FWVA 4R7LA 4A55A 1H6KA 5BT1A 2JV0A 4AOFA 3M57A 1ZBPA 2O8JA 5KJMA 4YVQC 4U0UA 3S7BA 3CQCB 4OVUA 4GYYA 3IHYA 4J8OA 4G24A 4ACLA 3OXLA 3PNLB 2I1KA 5EX0A 3VUZA 4GZ5A 5EG2A 4J0UA 3L13A 3SZ7A 4LEUA 2PZIA 4F53A 2NC9A 2WXFA 3QOUA 3FUFA 4JHKA 3ZXSA 1ZU2A 3QC1A 2KC7A 4J8EA 3T5XA 4YPAA 2C2LA 3B7TA 4RZ0A 4UWLA 2WQ6A 4Q96A 4EPZA 3CHSA 3FHEA 2DBAA 4CRWA 3ASFA 4MS6A 4KZ0A 2VTBA 5JJ6A 4U0ZA 4EBAA 2YQ8A 3S2AA 4AIFA 5ARFA 4GZCA 3BG0B 4UI9K 4F3VA 5LFAA 2W5ZA 4KXKB 1N6CA 4I17A 1ZKKA 3TG4A 4FHKA 3MA5A 5E75A 3ZRHA 3CVVA 2YHEA 5AIJA 4HXIA 2VSOE 3D9OA 3IKOB 4K03A 2BUGA 3TGOA 4WNFA 4JPSA 2X3MA 3KEZA 5CPRB 3SFZA 3MX3A 3PNTB 3ZYMA 4FHJA 4CDMA 3F9ZA 3PS6A 5EKQD 3CKBA 2XGMA 3U3WA 1O9SA 2WXPA 4L2LA 2BQZA 3LCAA 3ZHEA 5FWQA 3ASGA 2WB2A 5AJDA 5AJLA 1N3JA 3CVXA 2L6JA 3PUKA 3CVYA 4MRUA 4XIFA 4B89A 2R59A 3PE3A 4G26A 4GZDA 3FY4A 3PZDA 3VLEA 2UWJG 2J09A 4I1OB 1Z3YA 3MKQB 2PL2A 4XZ4A 3TG5A 3LS8A 4I43A 2R17C 4BT8A 1EPUA 4WNDA 3BEEA 3AU4A 4A3TA 4B8AA 4ANUA 1P5QA 5M72A 1PEGA 2G46A 2AW6A 1HF8A 1OWMA 5T3RA 1IQRA 3GZ2A 2PQNA 4FC8A 5FQ4A 3QDNA 3HVEB 5G2NA 1UN8A 3KMTA 3RJWA 2FI7A 4P29A 5FQ6A 3JYSA 2AWIA 3GW4A 1IQUA 3UT4A 4BFRA 1S0PA 4CGWA 4HOSA 3HYMB 4J6IA 1VDYA 2PM7A 3CHOA 3G2VA 3NZSA 5D0OD 3GZ1A 4OYSA 5KJNA 4I51A 2X38A 3VLDA 4G2VA 1H2VC 2IOLA 2MRIA 2IONA 2YHCA 2LO6A 3EDTB 4PS7A 4U07A 3SF4A 4E6HA 3FUKA 3ZW3A 1HE8A 3MV3B 5LX8A 3FPDA 4JHJA 3IV0A 1XGWA 4GPKA 5ENNA 4BSXA 3LYAA 3FU0A 1OWOA 4AY6A 5F59A 4QEPA 3Q49B 1WY6A 4ABNA 2FEZA 3O48A 3R7RA 3UUXA 3MKQA 1WM5A 3CHPA 3I4GA 4I2ZA 5A6CA 1YA0A 3FUNA 2V4LA 3OXFA 3CBMA 2WXMA 2XEVA 1JWFA 3CSFA 2OOEA 4I1MA 1QNFA 2CG3A 3BO5A 3OOIA 1FVHA 2FBNA 4G11A 5T8IA 2OV8A 2R3AA 5FJYA 3TL5A 4XI9A 3MO5A 5JHBA 4DI3A 1N6AA 3HVEA 3ONLA 4FA6A 2WVIA 2XHEA 4KBQA 1PC2A 3LJ3A 4WUYA 3EP0A 4H12A 2LAHA 2WM9A 3APCA 3EJNA 4PS3A 4U0SA 4E47A 1X5BA 3M5AA 4GA0A 1ELKA 4LCTA 1JPLA 2V8SE 4L23A 2VGYA 3IBEA 4IJ8A 3CVQA 4TV3A 3UPVA 2ONDA 4Z4PA 4I6JA 2J4DA 1EYHA 2CFZA 2HM8A 5G05C 3T5VA 3VTYA 3TJPA 5G05J 3CK7A 4BUPA 1HXIA 2L0TB 3FU6A 3LXUX 3FTSA 1OUVA 3U66A 3HNAA 4DPRA 4IULA 4MI0A 4KYOB 1TJCA 4KMOA 1TJFA 3PEUB 2VJ8A 3NF1A 4MKTA 4G25A 4K0RA 4UI9C 3G2WA 4QEOA 4KVMA 4H7YA 4CT0A 3LY9A 3L6AA 1HZ4A 1WAO1 2C0LA 4UI9J 4L2YA 5EDSA 5LCWC 2WXGA 4ANXA 3FUEA 3M55A 5CMYA 5C2YA 2RD0A 3Q4AB 4JVSA 3G2TA 4NQ0A 3CKCA 3VV0A 5TH7A 1H19A 4EZKA 4RSYA 4F7AA 2JLBA 3FU5A 5FT9A 4B0ZA 4BX8A 2V5FA 3FP3A 1ML9A 2RFIA 3OPEA 3SBSA 1PY1A 2WPVA 2IF4A 2FO7A 4M3OA 4GYOA 4HLEA 1HG2A 4ANWA 4PS8A 3SHFA 5F5EA 3LPZA 4J8SA 2DIWA 3EHNA 2KM4A 2NSZA 3TXMA 2Y3AA 2WMOA 3FDHA 4YPUA 3KMJA 4FLHA 3OTNA 3S7JA 3EHMA 1NZNA 3IHXA 3LY7A 4N39A 3Q5MA 1Y6IA 2IQCA 2Y4TA 2IGQA 4GB9A 2Y4UA 3CVUA 4I6GA 3FTYA 3LKUA 4J7FA 4AXHA 4JA7A 2YNQA 3LVRE 2PQRA 4G1TA 2NXPA 1KT1A 4GMJA 4HOQA 2GRLA 5CHEE 3JQ0A 4AVXA 1SZAA 3LY8A 2WXLA 3Q47B 1LF8A 2HR2A 2XRYA 3URZA 5FZSA 4QENA 3OS5A 3MJWA 2WXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MVH A;  3AS8 A;  3RKV A;  4G23 A;  5HQ8 A;  4UQZ A;  3CEQ A;  5CCL A;  3S7D A;  2C0M A;  3DB5 A;  4GA2 A;  5ARG A;  4N2Q A;  3MEK A;  1Y8M A;  2FF4 A;  4H7X A;  3QWW A;  3FFL A;  5TEG A;  3CK9 A;  3RQ4 A;  3QWP A;  3ZFW A;  4GZ6 A;  3M58 A;  2VSY A;  3AS5 A;  3VTX A;  4HOT A;  2F69 A;  4NJ5 A;  3SW9 A;  3RO3 A;  4YVO A;  4JA9 A;  4Y6C A;  5JHN A;  4YNP A;  4N3A A;  4APO A;  5G04 C;  4Y6W A;  5T0K A;  4IN3 B;  4ME2 A;  3E4B A;  3M59 A;  5JIY A;  3F9Y A;  3TAX A;  4YND A;  4JLG A;  3KD7 A;  5BNW A;  5CCM A;  4WNE A;  4J8D A;  4XI0 A;  5EX3 A;  4BWR A;  4FMU A;  4C1Q A;  1IHG A;  5AYW D;  3GYZ A;  2XCB A;  4BTA A;  3OXG A;  4NVQ A;  4AU7 A;  4JHR A;  4AY5 A;  2KCV A;  5FZQ A;  4O30 A;  3F9X A;  4GCO A;  1MUF A;  1KT0 A;  2KCK A;  3MO2 A;  3SWC A;  3CVN A;  3N71 A;  2R5S A;  4GA1 A;  4B94 A;  1A17 A;  3MV2 B;  2W5Y A;  3AS4 A;  4YPE A;  1ELR A;  5FTP A;  5FZR A;  2LSV A;  3IEG A;  4I9E A;  4CDR A;  4J83 A;  5DBK A;  3CVL A;  2WQH A;  4EQF A;  1MT6 A;  5LCW J;  2J9Q A;  2KCL A;  4BTB A;  3KAE A;  3DAL A;  2XGO A;  5T0M A;  4HOR A;  4UQX A;  1ELW A;  2VGX B;  4RG6 A;  2VSN A;  4UQY A;  4N2S A;  4BT9 A;  5JJ0 A;  1KLX A;  3ZHE B;  1XNF A;  2HYZ A;  4O6F A;  5A7D B;  3CBO A;  3WXX A;  2VQ2 A;  3QWV A;  4I9C A;  5F6K C;  5AYF A;  5C1D A;  2AVP A;  5BW8 C;  2LNI A;  4W9R A;  2P58 C;  4N5C A;  3RAY A;  3UQ3 A;  3ASD A;  5TTF A;  5KJL A;  1W3B A;  4N3B A;  5JJ7 A;  2UY1 B;  3CBP A;  2KAT A;  1B89 A;  2VGX A;  2LSU A;  1QQE A;  5T5G A;  3ASH A;  3KS2 A;  3K5K A;  1IYG A;  3RJV A;  3M56 A;  3K9I A;  2I6H A;  3PDN A;  1MVX A;  4GZ3 A;  5LSX A;  3RU0 A;  3Q15 A;  5LSZ A;  2E2E A;  3S7F A;  4CGV A;  4JL0 A;  5JJT A;  2IFU A;  4NRH B;  4MI5 A;  2QPW A;  4I1A A;  5G04 J;  4JDS A;  5JIN A;  4A1S A;  3CK8 A;  2Q7F A;  1E96 B;  4AM9 A;  2XCC A;  2UY1 A;  5D0Q D;  3R9A B;  3ZN3 A;  2MHK A;  3S8P A;  3ULQ A;  4GYW A;  3ZPJ A;  4RG9 A;  3U4T A;  3M54 A;  3RIB A;  1XQH A;  3QKY A;  4GCN A;  4IJD A;  2VYI A;  2QFC A;  4YNM A;  1QZ2 A;  4N3C A;  3KMA A;  2HO1 A;  2GW1 A;  4J7I A;  4HOU A;  2XPI A;  3MO0 A;  4LDG A;  4J8F A;  1NA3 A;  4WNG A;  4I2W A;  3RO2 A;  5HI7 A;  1H3I A;  3M53 A;  3CVP A;  5DIZ A;  5KJK A;  3CV0 A;  3MKR A;  5F6L A;  1HH8 A;  1FCH A;  2XGS A;  3PE4 A;  3ZGQ A;  1NA0 A;  4U04 A;  3F9W A;  3ESK A;  3FWV A;  5BT1 A;  2JV0 A;  3M57 A;  1ZBP A;  2O8J A;  5KJM A;  4YVQ C;  4U0U A;  3S7B A;  4J8O A;  4GYY A;  4G24 A;  3OXL A;  5EX0 A;  3VUZ A;  4GZ5 A;  5EG2 A;  4J0U A;  3SZ7 A;  4LEU A;  2PZI A;  2NC9 A;  3QOU A;  1ZU2 A;  2KC7 A;  4J8E A;  4YPA A;  2C2L A;  4RZ0 A;  2DBA A;  3ASF A;  5JJ6 A;  4U0Z A;  2YQ8 A;  4AIF A;  5ARF A;  4UI9 K;  4F3V A;  2W5Z A;  4KXK B;  1N6C A;  4I17 A;  1ZKK A;  3TG4 A;  3MA5 A;  2BUG A;  3TGO A;  4WNF A;  5CPR B;  3F9Z A;  5EKQ D;  3CKB A;  2XGM A;  3U3W A;  1O9S A;  2BQZ A;  3LCA A;  3ZHE A;  3ASG A;  1N3J A;  2L6J A;  4XIF A;  3PE3 A;  4G26 A;  2UWJ G;  2PL2 A;  3TG5 A;  4BT8 A;  4WND A;  5M72 A;  3BEE A;  1P5Q A;  1PEG A;  2G46 A;  3GZ2 A;  2PQN A;  3QDN A;  3RJW A;  3KMT A;  2FI7 A;  3JYS A;  3GW4 A;  4CGW A;  4HOS A;  3HYM B;  5D0O D;  3GZ1 A;  5KJN A;  4I51 A;  4G2V A;  2YHC A;  3EDT B;  4U07 A;  3SF4 A;  3MV3 B;  3FPD A;  4GPK A;  3LYA A;  5F59 A;  4AY6 A;  4QEP A;  3Q49 B;  4ABN A;  2FEZ A;  3O48 A;  3UUX A;  5A6C A;  1WM5 A;  4I2Z A;  1YA0 A;  3OXF A;  3CBM A;  2XEV A;  2OOE A;  3BO5 A;  3OOI A;  2FBN A;  2R3A A;  5FJY A;  4XI9 A;  3MO5 A;  1N6A A;  4KBQ A;  1PC2 A;  4WUY A;  3EP0 A;  4H12 A;  4E47 A;  4U0S A;  3M5A A;  4GA0 A;  2VGY A;  4IJ8 A;  3CVQ A;  3UPV A;  2OND A;  4Z4P A;  5G05 C;  3VTY A;  5G05 J;  3CK7 A;  4BUP A;  1HXI A;  1OUV A;  3HNA A;  4MI0 A;  4KYO B;  1TJC A;  3NF1 A;  4G25 A;  4UI9 C;  4QEO A;  4H7Y A;  3LY9 A;  1HZ4 A;  1WAO 1;  2C0L A;  4UI9 J;  5LCW C;  3M55 A;  3Q4A B;  4NQ0 A;  3CKC A;  3VV0 A;  5TH7 A;  2JLB A;  1ML9 A;  5FT9 A;  2RFI A;  2V5F A;  3FP3 A;  3OPE A;  2WPV A;  2IF4 A;  2FO7 A;  4GYO A;  5F5E A;  3LPZ A;  4YPU A;  3KMJ A;  3S7J A;  1NZN A;  3IHX A;  3LY7 A;  4N39 A;  3Q5M A;  2Y4T A;  2IGQ A;  2Y4U A;  3LKU A;  4J7F A;  4JA7 A;  2PQR A;  4G1T A;  1KT1 A;  4HOQ A;  5CHE E;  3LY8 A;  3Q47 B;  2HR2 A;  3URZ A;  4QEN A;  5FZS A;  3OS5 A; 
#chains in the Genus database with same CATH topology
 3RKV A;  1K8K G;  2J08 A;  4G23 A;  4N5Q A;  5HQ8 A;  4EEC A;  4LNB A;  3FEY A;  4GML A;  3UXG A;  5ARG A;  2FF4 A;  1NI1 A;  4A3V A;  2J4B A;  3FFL A;  3QWP A;  4GZ6 A;  3M58 A;  1OCZ E;  3VTX A;  3DEO A;  4ILH B;  2CHX A;  2V5Q C;  3TWT A;  1SW6 A;  4YNP A;  5T0K A;  3E4B A;  3L54 A;  5ENP D;  3RAU A;  5JIY A;  1RZ4 A;  2LAI A;  3V79 K;  5BNW A;  3VLF A;  4XI0 A;  4Q69 A;  1NL4 A;  4FMU A;  3CHQ A;  1IHG A;  1KPS B;  3GYZ A;  1E90 A;  4BTA A;  4JXT A;  3RRU A;  2M63 A;  5FQ7 A;  4O30 A;  2AXU A;  4JW1 A;  3AAA C;  3TWS A;  3SNX A;  3D9I A;  3PZ2 A;  3V30 A;  4ZHB A;  3CVN A;  3N71 A;  3Q78 A;  4GA1 A;  2WMN A;  2L0I A;  2BF0 X;  4UWF A;  3NBN B;  3UT7 A;  3CST A;  3IEG A;  4F1S A;  2EIJ E;  2P9N G;  5J08 A;  3C3O A;  2WQH A;  3DXM G;  1MT6 A;  3F6Q A;  3SBT B;  5LCW J;  3DAL A;  3TWW A;  4PUC A;  1DCE A;  4BX9 A;  1GW6 A;  4AEZ C;  2XQ0 A;  4RVB A;  3FTW A;  3FTZ A;  3PRE A;  1ZB1 A;  4AP2 A;  4UQY A;  2H6G A;  2ZIS A;  1XNF A;  1TN6 A;  3BU8 A;  2PNN A;  4ANV A;  5A7D B;  3QWV A;  4FP7 A;  3ZU7 B;  2FUL A;  4Q94 A;  3ZIM A;  5BW8 C;  3CVV A;  4W9R A;  4N5C A;  2EIL E;  3ONK A;  2WXN A;  3R9M A;  3FTU A;  5E76 A;  4PH4 B;  3ABK E;  5AQA A;  5TTF A;  1UG3 A;  2X6K A;  4EHM A;  5KJL A;  4N3B A;  1B89 A;  3DRA A;  1O1S A;  2F0Y A;  5AEN A;  3NB2 A;  4APF A;  3PVL A;  3U64 A;  4FJY A;  1V55 E;  1MVX A;  1IXV A;  5EYL A;  3RU0 A;  5AAO A;  2EIK E;  3S7F A;  4CGV A;  5G04 J;  5KNH D;  4JEH A;  3UIO C;  4JDS A;  3UM0 A;  5LOZ A;  3CK8 A;  4AM9 A;  2XRZ A;  1TEZ A;  1BD8 A;  3I5P A;  2MHK A;  4J8Y A;  3S8P A;  3UM1 A;  4DLQ A;  3U9W A;  3HXD A;  3SY2 A;  3U4T A;  1TN7 A;  4RQI A;  4LRZ A;  4C0E A;  4TUU A;  2XZD G;  3B13 A;  5FQ8 A;  4TXQ A;  2OCC E;  3L9T A;  4N3C A;  3DPY A;  3DBS A;  4CCA A;  1TN8 A;  4J7I A;  1DNP A;  2H6I A;  4J8F A;  2BKK B;  3FTX A;  4FJZ A;  5HI7 A;  1H0A A;  3M53 A;  1NP7 A;  3UIP C;  2GRR B;  4HB5 A;  2P9L G;  4G8K A;  3FH7 A;  5F6L A;  2XGS A;  1NA0 A;  3D9N A;  1INZ A;  4U04 A;  2GRQ B;  3CQC B;  4J8O A;  3Q79 A;  4ACL A;  2ZIR A;  5EG2 A;  3SZ7 A;  5EN5 D;  2PZI A;  3QOU A;  4YDY A;  4JHK A;  2KC7 A;  4J8E A;  4RZ0 A;  3CHS A;  2DBA A;  4MS6 A;  4U0Z A;  4AIF A;  4GZC A;  3BG0 B;  4NIK A;  5LFA A;  4F3V A;  4KXK B;  1N6C A;  3TG4 A;  3LJN A;  1YCS B;  4K03 A;  2BUG A;  4WNF A;  4LG6 A;  2X3M A;  4JPS A;  3CKB A;  2XGM A;  3DSV A;  2BQZ A;  3LCA A;  4BEP A;  4DX6 D;  3ASG A;  5HRY A;  5KBA A;  1N3J A;  2L6J A;  3CVY A;  3PE3 A;  3EU5 A;  1MX4 A;  3PZD A;  3VLE A;  2UWJ G;  3MKQ B;  4XZ4 A;  5JMN D;  3LS8 A;  2XEH A;  4WND A;  2G46 A;  2AW6 A;  1OWM A;  1IQR A;  3GZ2 A;  3RJW A;  2FI7 A;  4P29 A;  5FQ6 A;  3UM2 A;  3JYS A;  4HOS A;  2A5E A;  3G2V A;  5B3S E;  5D0O D;  5KJN A;  3VLD A;  1H2V C;  1DC2 A;  4PS7 A;  1HE8 A;  4JHJ A;  1XGW A;  3LYA A;  3ABM E;  3R7R A;  5ENQ D;  2V4L A;  1K3Z D;  1OCC E;  3OOI A;  1FVH A;  2FBN A;  2DYS E;  3TL5 A;  1H6O A;  4XI9 A;  3HXF A;  3AJI A;  1N6A A;  2WVI A;  3ZKJ A;  4H12 A;  2WM9 A;  5HS0 A;  2Y0B G;  4OAU C;  4L23 A;  5KNG A;  2OND A;  4Z4P A;  2P2C P;  2CFZ A;  2HM8 A;  4O60 A;  3VTY A;  1HXI A;  1OUV A;  3U66 A;  2QYU A;  3NF1 A;  4K0R A;  4KVM A;  4H7Y A;  1HZ4 A;  5LCW C;  5CMY A;  5C2Y A;  2RD0 A;  4JVS A;  4EZK A;  4F7A A;  2JLB A;  3FU5 A;  5FT9 A;  1ML9 A;  3OPE A;  2WPV A;  5F5E A;  3LPZ A;  4J8S A;  1KZO A;  3TXM A;  2WMO A;  3FDH A;  3OTN A;  1N11 A;  4JB8 P;  4N39 A;  2IQC A;  1S63 A;  3KEA A;  3LKU A;  1Q2Z A;  2ZGG A;  4K5A B;  1KT1 A;  4HOQ A;  5CHE E;  3JQ0 A;  5CRV A;  4AVX A;  3Q47 B;  5FZS A;  3TWR A;  3OS5 A;  2WXJ A;  4M7C A;  3S7D A;  5CMW A;  2BTD A;  2C0M A;  5AQ7 A;  4H7X A;  4C48 B;  3ZXP A;  2ZXW E;  3EIQ C;  3QWW A;  3CK9 A;  4HFG A;  5AN8 A;  4HOT A;  3CHM A;  4NJ5 A;  3RO3 A;  4CYM D;  5H7P A;  3APF A;  3UKU G;  4X8Q A;  2GGF A;  4N3A A;  5G04 C;  4IN3 B;  2GRM A;  4ME2 A;  4LNG A;  4YDW A;  2ILR A;  3TAX A;  4JLG A;  3UM3 A;  4WNE A;  4J8D A;  5EX3 A;  5CED B;  1TNU A;  3DSW A;  3AG2 E;  3UX4 A;  3FUM A;  3G2S A;  3HXC A;  1MYO A;  3F9X A;  4EBA G;  4FLB A;  2XPZ A;  2KCK A;  4FU3 A;  3SWC A;  4GU5 A;  1N94 A;  4XKC A;  1Z6T A;  2R5S A;  3CGH A;  2W5Y A;  3BG1 B;  2MOW A;  3AS4 A;  4HI9 A;  5FTP A;  4NAC A;  2LSV A;  2IO2 C;  4I9E A;  1BI8 B;  5DBK A;  4EQF A;  2B0O E;  2CHZ A;  2I9C A;  2KCL A;  4BTB A;  4FAD A;  2LXL A;  3W9F A;  1QBQ A;  2ETB A;  5BPP A;  4AV7 A;  4BSZ B;  3ASO E;  3C5R A;  4UQX A;  4A1G A;  3ZVV A;  4V3I A;  3J5Q B;  2P9K G;  4N2S A;  4Z68 A;  5JJ0 A;  1KLX A;  3C3Q A;  4TXP A;  1HG5 A;  2RG8 A;  3I4R B;  3ABL E;  3ASN E;  2A5U A;  4WWP A;  4XE0 A;  3L08 A;  3ZYQ A;  2LNI A;  2ZGD A;  4CEM A;  3RAY A;  3UQ3 A;  3ASD A;  3MGB A;  3Q9U C;  2OVB A;  2XPY A;  4ATZ D;  1E7V A;  3CBP A;  2KAT A;  4LNU D;  2VGX A;  2LSU A;  3JUI A;  1Z5S C;  2V4H C;  3KS2 A;  4DJA A;  1IYG A;  3FTV A;  3RK6 A;  3M56 A;  2I6H A;  3PDN A;  5LSZ A;  1BU9 A;  1E8Y A;  4JL0 A;  5JJT A;  2WXH A;  5ENT D;  3ZYK A;  2QPW A;  4I1A A;  3HHM A;  1N95 A;  3JCK C;  4A1S A;  4GAA A;  2R02 A;  3FUD A;  2Q7F A;  1E96 B;  1AP7 A;  2UY1 A;  3ZN3 A;  3QAQ A;  1SA5 A;  1LTX A;  4TRQ A;  3ULQ A;  2NYJ A;  4QFV A;  1JUQ A;  3FUL A;  3ISM C;  3P1U A;  4GYW A;  2B6C A;  4DX2 A;  1K1A A;  3AG1 E;  1N52 A;  2GRN B;  1BPO A;  1UOH A;  2X6J A;  1Z3X A;  3L82 A;  5B1B E;  2VYI A;  5G55 A;  1H2U A;  4YNM A;  1SA4 A;  1QZ2 A;  3C98 A;  4BY6 A;  1E8W A;  1KZP A;  3D9M A;  4CDN A;  2XPI A;  4LDG A;  4D10 C;  3QK0 A;  3JQ1 A;  3QJZ A;  4I2W A;  2XZT G;  3RO2 A;  3CVP A;  5DIZ A;  5KJK A;  5AQ9 A;  3ZYL A;  3CV0 A;  1E8Z A;  4GTQ A;  1JWG A;  2R05 A;  3F9W A;  2JV0 A;  2O8J A;  5KJM A;  4G24 A;  2I1K A;  4J0U A;  2NC9 A;  3FUF A;  1ZU2 A;  4YPA A;  2GRO B;  2C2L A;  3SO8 A;  4EPZ A;  2P9I G;  3FHE A;  4KZ0 A;  4GTR A;  4EBA A;  3HG0 D;  3KSQ A;  2VGE A;  3DSS A;  4UI9 K;  4I17 A;  5E75 A;  1RW2 A;  5AIJ A;  3TGO A;  5CPR B;  3SFZ A;  3F9Z A;  4XEI G;  3PS6 A;  4UUC A;  4MRU A;  3ULE G;  1N4S A;  2RFA A;  3FY4 A;  3EHR A;  2PL2 A;  2ETC A;  4BT8 A;  3IXE A;  3BEE A;  4A3T A;  3KSL A;  4U8Y D;  1PEG A;  2J8S D;  3KMT A;  4BFR A;  4CGW A;  2PM7 A;  5ENO D;  3GZ1 A;  2RKK A;  1X81 A;  1D8E A;  2IOL A;  3EDT B;  4U07 A;  1N0Q A;  4E6H A;  5LX8 A;  1SVX A;  3IV0 A;  4GPK A;  3FU0 A;  1OWO A;  4QEP A;  3Q49 B;  1N0R A;  1WY6 A;  3JXI A;  2FEZ A;  3UUX A;  1YA0 A;  2XEV A;  3CSF A;  1JWF A;  3ZNG A;  3D9H A;  2CG3 A;  3BO5 A;  5T8I A;  2OV8 A;  2R3A A;  5FJY A;  2Y69 E;  1S64 A;  4DI3 A;  3HVE A;  3ONL A;  4J7W A;  4KBQ A;  3NAW A;  2LAH A;  3APC A;  4U0S A;  4HLL A;  4HQD A;  4GA0 A;  4LCT A;  2XEN A;  4IJ8 A;  3CVQ A;  5G05 C;  3TJP A;  4BUP A;  3CK7 A;  1K1B A;  3V2X A;  1MX2 A;  4MI0 A;  4DPR A;  4KYO B;  1TJC A;  3PEU B;  4UI9 C;  3LY9 A;  3L6A A;  3EHQ A;  4ANX A;  3M55 A;  3Q73 A;  5KWD A;  4NQ0 A;  3VV0 A;  5TH7 A;  1H19 A;  5BXO A;  4RSY A;  4B0Z A;  2IF4 A;  2FO7 A;  4M3O A;  3E37 A;  4HLE A;  4ANW A;  2DIW A;  3EHN A;  2Y3A A;  4TUM A;  3KMJ A;  4HBD A;  2F8X K;  3DWL G;  2BED A;  3LY7 A;  4B93 B;  3Q5M A;  2Y4T A;  4I6G A;  4AXH A;  2YNQ A;  4GMJ A;  3SFY A;  3E30 A;  1LF8 A;  4JD2 G;  1MVH A;  4HVB A;  3EUV A;  1OCO E;  4XKB A;  1MZC A;  2WXR A;  3CIA A;  5B1A E;  4UQZ A;  3CEQ A;  3TXN A;  5CCL A;  3T8M A;  1JCQ A;  2DZN A;  3T9K A;  2CG2 A;  4GA2 A;  5CEA A;  4N2Q A;  3MEK A;  4YDO A;  5LP0 A;  2X6F A;  4HS2 A;  1BLX B;  5TEG A;  3FH8 A;  3CQG B;  3ZFW A;  4I6E A;  2OVF A;  2VSY A;  4DX5 D;  2F69 A;  2AJA A;  3SW9 A;  2ZU6 B;  3Q9N C;  4E85 A;  4YVO A;  4U96 D;  3NZU A;  4CZ2 D;  2YIN A;  4AJW A;  4KT6 B;  5JHN A;  4B8C B;  4DI4 A;  1OWP A;  3F9Y A;  4YND A;  3KD7 A;  1N54 A;  1FVF A;  4BWR A;  5AYW D;  1EDU A;  2EIM E;  2EQX A;  1O5M A;  1MQS A;  3OXG A;  4AU7 A;  2MYO A;  5D2M C;  4JHR A;  4AY5 A;  3APD A;  3RRM B;  4GCO A;  3DPD A;  1MUF A;  3EIJ A;  4DX7 D;  3MO2 A;  3MCX A;  3D9K A;  1SZ9 A;  1E7U A;  1U3C A;  2P9P G;  3TWU A;  2KZT A;  4B94 A;  4EZL A;  3MV2 B;  4BER A;  3CHR A;  5FZR A;  5ENS D;  4WWO A;  3ML8 A;  4CDR A;  3CVL A;  3UMV A;  3B7R L;  3NOG D;  2J9Q A;  3KAE A;  1O1T A;  3LVQ E;  5BV1 A;  3AG4 E;  2J07 A;  1E8X A;  5A23 A;  4LER A;  2WXI A;  3ESL A;  1N9A A;  1ELW A;  1D9S A;  2VGX B;  4BT9 A;  3HIZ A;  4U8V D;  3D9J A;  3ZHE B;  3LDZ A;  4KZC A;  3BQO A;  5IY5 E;  2HYZ A;  4O6F A;  4OVV A;  3CBO A;  2VQ2 A;  3UIN C;  3B7S A;  2AVP A;  5AQB A;  4C9B B;  4JC8 A;  3L22 A;  4DK5 A;  4ILI A;  1W3B A;  3FH5 A;  4YDE A;  4MBG A;  2UY1 B;  2P9S G;  1QQE A;  5T5G A;  3K5K A;  3IHV A;  4U8H A;  3K9I A;  2IOS A;  5LSX A;  3HXB A;  3Q15 A;  3CR3 A;  3PUJ A;  4WAF A;  1EF1 C;  2WXK A;  4MI5 A;  4EZJ A;  1HU3 A;  3B7U X;  2Y1L E;  5JIN A;  4FUL A;  3UTM A;  4IRU A;  3OAW A;  3SI5 A;  5D0Q D;  1H2T C;  1DVP A;  4GTS A;  4F1P A;  2L9B A;  4JZY A;  3SGH A;  3HDX A;  4DRX E;  4GTP A;  3MYV A;  3FUJ A;  1PAQ A;  1OWN A;  4KVO A;  4L1B A;  3NOC D;  2QY7 A;  1H6P A;  2QFC A;  2VSX E;  3J5P A;  1L5J A;  2QYJ A;  3KMA A;  5BXU A;  3CVW A;  1N4P A;  1S70 B;  3D9L A;  4U95 D;  1UW4 B;  4ATG A;  1JCS A;  2X6I A;  3JUE A;  3MKR A;  1FCH A;  2JEK A;  3ZGQ A;  2XEE A;  3ESK A;  3FWV A;  4A55 A;  5BT1 A;  3EU9 A;  4AOF A;  4YVQ C;  4U0U A;  3S7B A;  4GYY A;  3IHY A;  3VUZ A;  4LEU A;  3W9G A;  4F53 A;  3QC1 A;  4HRN A;  3B7T A;  2DZO A;  4Q96 A;  4CRW A;  3ASF A;  5HKP A;  2VTB A;  5JJ6 A;  3S2A A;  2W5Z A;  1ZKK A;  4FHK A;  3MA5 A;  3ZRH A;  2YHE A;  2VSO E;  3IKO B;  1V54 E;  3KEZ A;  3MX3 A;  1O9S A;  2WXP A;  3ZHE A;  5FWQ A;  3TWX A;  3CVX A;  3PUK A;  2H6H A;  4L9P A;  4B89 A;  3DST A;  5M72 A;  3AU4 A;  4B8A A;  4FC8 A;  5FQ4 A;  3QDN A;  3HVE B;  1UN8 A;  2AWI A;  1IQU A;  3SQV A;  3HYM B;  3CHO A;  2JAB A;  4OYS A;  1FT1 A;  1TNY A;  2MRI A;  2YHC A;  1OXJ A;  1WDY A;  3SF4 A;  3ZW3 A;  2XS8 A;  3MV3 B;  3FPD A;  1N4Q A;  5ENN A;  4RLY A;  5A6C A;  1WM5 A;  3CHP A;  4I2Z A;  3FUN A;  4G8L A;  2WXM A;  2OOE A;  4I1M A;  1QNF A;  5JHB A;  2XHE A;  3LJ3 A;  4WUY A;  4O1O A;  4BET A;  3EJN A;  4PS3 A;  4E47 A;  3M5A A;  1JPL A;  2V8S E;  3IBE A;  4TV3 A;  5CEC B;  3UPV A;  3ZUV B;  2J4D A;  1EYH A;  2L0T B;  3FU6 A;  1A5E A;  4GTV A;  1TJF A;  4KMO A;  2VJ8 A;  3RSE G;  4MKT A;  4G25 A;  3G2W A;  1AWC B;  4CT0 A;  1WAO 1;  5EDS A;  2C0L A;  2R2L A;  2WXG A;  3WG7 E;  3FUE A;  4GMR A;  3G2T A;  3CKC A;  2RFI A;  3FP3 A;  2IEJ A;  3SBS A;  1OY3 D;  4GYO A;  4PS8 A;  2KM4 A;  4YPU A;  3PZ1 A;  3EHM A;  2IGQ A;  3TWQ A;  3LVR E;  2PQR A;  4G1T A;  3JXJ A;  2XRY A;  5EIL A;  4R7L A;  3V31 A;  3AS8 A;  5J90 A;  1HO8 A;  3PZ4 A;  4K5C A;  1WG0 A;  3DB5 A;  2WXO A;  1Y8M A;  1UN9 A;  4XX5 A;  3QNK A;  4DX1 A;  2AXZ A;  3RQ4 A;  2LXM A;  3AS5 A;  3D3M A;  3E32 A;  1U3D A;  2IO3 C;  4JA9 A;  5KCM A;  4Y6C A;  2KZT B;  4APO A;  4Y6W A;  2DYR E;  5D66 A;  4L7T A;  3M59 A;  2DCP A;  2CFU A;  1QYM A;  2J49 A;  2P9U G;  3T8K A;  5CCM A;  3NQP A;  1YYH A;  4UWK A;  3RRN B;  4ACK A;  4C1Q A;  4OAV B;  2XCB A;  4NVQ A;  1UJK A;  4NUR A;  1TNZ A;  3FUH A;  2KCV A;  3E33 A;  5FZQ A;  3BUA A;  1NFI E;  3LEW A;  4ILG A;  1KT0 A;  1BI7 B;  5T4Y A;  3R7Q A;  3FU3 A;  1LD7 A;  2L6B A;  1A17 A;  3Q7A A;  2I2O A;  1HX8 A;  4YPE A;  1ELR A;  3O4Z A;  3P2B A;  4QQI A;  4J83 A;  5ANR A;  4MLP A;  2WQ7 A;  4URK A;  5AAR A;  2XS1 A;  2DVW A;  1HS6 A;  3CLJ A;  1TR4 A;  3QAR A;  5JHA A;  2XGO A;  4GPM A;  3AU5 A;  5T0M A;  3UT8 A;  3DEP A;  4HOR A;  4U7E B;  5CBN A;  4LUN U;  4RG6 A;  5BV0 A;  2VSN A;  4GTT A;  5EYP F;  2R03 A;  3SD5 A;  3ZEF A;  2IJG X;  4U63 A;  3WXX A;  1OT8 A;  4I9C A;  3L17 A;  4A63 B;  5F6K C;  4O1P A;  5AYF A;  3AG3 E;  3I3N A;  5C1D A;  3QB2 A;  2P58 C;  3D9P A;  1UJJ A;  3MZL B;  4JEU A;  3PH0 C;  2H6F A;  5FIN A;  4DLO A;  5JJ7 A;  3DSX A;  4HNA D;  4PDX A;  3FUI A;  3ASH A;  1O1R A;  2QC9 A;  2I1J A;  3RJV A;  4GZ3 A;  2V0P A;  2CHW A;  2E2E A;  2LUH A;  4DUI A;  1MHQ A;  5CRU A;  2IFU A;  4NRH B;  3ENE A;  4IYP A;  1HFA A;  2AXV A;  2F8Y A;  3L16 A;  3FEX A;  4GTM A;  2XCC A;  3R9A B;  3PRZ A;  5ANL A;  3ML9 A;  4C0M A;  1TNB A;  4UWH A;  3X2Q E;  5FIO A;  2A4Z A;  3ZPJ A;  1OWL A;  4RG9 A;  4BES A;  2WXQ A;  3M54 A;  3RIB A;  1XQH A;  1DCQ A;  3QKY A;  4GCN A;  2PM6 A;  3UI2 A;  4UWG A;  3PEV B;  4IJD A;  1SQM A;  4WWN A;  3C3R A;  3G2U A;  1YMP A;  3E34 A;  2E0I A;  1D8D A;  2HO1 A;  2GW1 A;  1LD8 A;  5ITZ F;  2X6H A;  4HOU A;  3MO0 A;  1U2V G;  2VTB B;  1NA3 A;  4WNG A;  1H3I A;  2QZA A;  2IU1 A;  3GZS A;  4GTO A;  3B95 A;  1HH8 A;  5CER B;  4HI8 A;  3PE4 A;  5CBO A;  4CT4 A;  5BUZ A;  3V2O A;  3HXE A;  3Q75 A;  1H6K A;  3M57 A;  1ZBP A;  3SFX A;  4OVU A;  3OXL A;  3PNL B;  5EX0 A;  4GZ5 A;  3L13 A;  3UKR G;  3ZXS A;  2WXF A;  1G3N B;  3T5X A;  4UWL A;  2WQ6 A;  1MX6 A;  2YQ8 A;  4TXR A;  5ARF A;  2F37 A;  2OEW A;  3C72 A;  1N4R A;  4HXI A;  3D9O A;  4HRM B;  2BKG A;  3ZYM A;  3PNT B;  1MJ0 A;  4FHJ A;  4CDM A;  5EKQ D;  3U3W A;  4K5B A;  4L2L A;  2WB2 A;  5AJD A;  5AJL A;  1TYQ G;  3B7B A;  4XIF A;  2R59 A;  4G26 A;  1FPP A;  4GZD A;  1IHB A;  4I1O B;  2J09 A;  1Z3Y A;  3TG5 A;  4I43 A;  2R17 C;  1EPU A;  4ANU A;  1P5Q A;  1HF8 A;  2DWZ A;  5T3R A;  2PQN A;  5G2N A;  3Q7F A;  3GW4 A;  3UT4 A;  1S0P A;  1TNO A;  4J6I A;  4F6R D;  1VDY A;  3NZS A;  4I51 A;  2X38 A;  4G2V A;  2ION A;  2LO6 A;  3FUK A;  3DSU A;  3PZ3 A;  4BSX A;  1JCR A;  4AY6 A;  5F59 A;  4ABN A;  3O48 A;  3MKQ A;  3I4G A;  3OXF A;  3CBM A;  2RFM A;  2ETA A;  2OEV A;  4G11 A;  3MO5 A;  4ZFH A;  4FA6 A;  1PC2 A;  3EP0 A;  1X5B A;  1ELK A;  2GRP B;  2VGY A;  4I6J A;  2EIN E;  3T5V A;  5G05 J;  3LXU X;  3FTS A;  3HNA A;  4IUL A;  5EID A;  2KXP C;  4QEO A;  4UI9 J;  4L2Y A;  5JA4 D;  3HRA A;  3Q4A B;  3ULY A;  1IKN D;  2IY0 C;  5ENR D;  4LSZ E;  4BX8 A;  2V5F A;  1PY1 A;  2KBX A;  3TWV A;  1HG2 A;  3SHF A;  2HE0 A;  4HRL A;  2NSZ A;  4FLH A;  3S7J A;  1OCR E;  1NZN A;  3IHX A;  2FO1 E;  1Y6I A;  4GB9 A;  2Y4U A;  3CVU A;  3FTY A;  4J7F A;  3DXK G;  4JA7 A;  2NXP A;  2GRL A;  1SZA A;  3LY8 A;  2WXL A;  2HR2 A;  5EIB E;  3URZ A;  4QEN A;  1FT2 A;  3MJW A; 
#chains in the Genus database with same CATH homology
 1MVH A;  3AS8 A;  3RKV A;  4HVB A;  5J90 A;  2J08 A;  4G23 A;  4XKB A;  1HO8 A;  2WXR A;  3CIA A;  4EEC A;  5HQ8 A;  3FEY A;  3CEQ A;  4UQZ A;  3S7D A;  3TXN A;  5CCL A;  4GML A;  5CMW A;  3T8M A;  2BTD A;  2C0M A;  3DB5 A;  2WXO A;  2CG2 A;  4GA2 A;  5ARG A;  4N2Q A;  3MEK A;  1Y8M A;  5LP0 A;  1UN9 A;  2X6F A;  2FF4 A;  4HS2 A;  3QNK A;  4H7X A;  4XX5 A;  3EIQ C;  3QWW A;  4A3V A;  2J4B A;  3FFL A;  5TEG A;  3CK9 A;  4HFG A;  3FH8 A;  2AXZ A;  3RQ4 A;  3QWP A;  3CQG B;  3ZFW A;  4I6E A;  4GZ6 A;  2OVF A;  3M58 A;  2VSY A;  3AS5 A;  3VTX A;  4HOT A;  2F69 A;  3CHM A;  4NJ5 A;  3SW9 A;  2ZU6 B;  3D3M A;  3RO3 A;  1U3D A;  4ILH B;  2CHX A;  4E85 A;  4YVO A;  4JA9 A;  3NZU A;  5KCM A;  2YIN A;  3APF A;  4AJW A;  4Y6C A;  4KT6 B;  5JHN A;  2GGF A;  2KZT B;  4YNP A;  4N3A A;  4APO A;  5G04 C;  4Y6W A;  5T0K A;  4B8C B;  4IN3 B;  2GRM A;  4ME2 A;  3E4B A;  3L54 A;  4DI4 A;  4L7T A;  3M59 A;  1OWP A;  2ILR A;  5JIY A;  3F9Y A;  2DCP A;  3TAX A;  2LAI A;  4YND A;  2CFU A;  2J49 A;  4JLG A;  3KD7 A;  1N54 A;  5BNW A;  5CCM A;  4WNE A;  3NQP A;  4UWK A;  3RRN B;  1FVF A;  4J8D A;  4XI0 A;  5EX3 A;  3VLF A;  4ACK A;  4BWR A;  4Q69 A;  3UX4 A;  4FMU A;  4C1Q A;  3CHQ A;  1IHG A;  5AYW D;  1EDU A;  2EQX A;  3GYZ A;  1E90 A;  1MQS A;  2XCB A;  3FUM A;  3OXG A;  4JXT A;  4BTA A;  4NVQ A;  3G2S A;  1UJK A;  3RRU A;  4AU7 A;  2M63 A;  4JHR A;  4NUR A;  4AY5 A;  5FQ7 A;  3FUH A;  2KCV A;  5FZQ A;  2AXU A;  4EBA G;  4JW1 A;  3APD A;  4FLB A;  4O30 A;  3F9X A;  3RRM B;  2XPZ A;  4GCO A;  3LEW A;  3DPD A;  4ILG A;  1MUF A;  1KT0 A;  2KCK A;  3EIJ A;  4FU3 A;  3D9I A;  3SNX A;  3MO2 A;  3MCX A;  4GU5 A;  5T4Y A;  3SWC A;  3R7Q A;  3FU3 A;  3D9K A;  3CVN A;  1Z6T A;  3N71 A;  4XKC A;  2R5S A;  3CGH A;  4GA1 A;  1SZ9 A;  1E7U A;  1U3C A;  2WMN A;  2KZT A;  4B94 A;  2L0I A;  4EZL A;  1A17 A;  2BF0 X;  4UWF A;  3MV2 B;  2I2O A;  3UT7 A;  2W5Y A;  3BG1 B;  2MOW A;  1HX8 A;  3AS4 A;  1ELR A;  4YPE A;  3CST A;  3CHR A;  3O4Z A;  4NAC A;  5FTP A;  5FZR A;  3P2B A;  4WWO A;  2LSV A;  3IEG A;  4F1S A;  3ML8 A;  4I9E A;  4CDR A;  4J83 A;  5DBK A;  5J08 A;  3CVL A;  4MLP A;  5ANR A;  2WQH A;  2WQ7 A;  4EQF A;  1MT6 A;  4URK A;  3UMV A;  2CHZ A;  3SBT B;  5LCW J;  2I9C A;  3B7R L;  2J9Q A;  2KCL A;  4BTB A;  3KAE A;  4FAD A;  3DAL A;  1HS6 A;  3LVQ E;  3CLJ A;  3QAR A;  4PUC A;  5BV1 A;  2J07 A;  4BX9 A;  1E8X A;  5JHA A;  5A23 A;  1GW6 A;  2XGO A;  4AEZ C;  3AU5 A;  2XQ0 A;  4RVB A;  5BPP A;  4LER A;  3FTW A;  4AV7 A;  3UT8 A;  2WXI A;  3ESL A;  4HOR A;  3FTZ A;  3PRE A;  5T0M A;  4UQX A;  1ELW A;  4A1G A;  2VGX B;  3ZVV A;  4LUN U;  4AP2 A;  4RG6 A;  4V3I A;  5BV0 A;  2VSN A;  4UQY A;  4N2S A;  4BT9 A;  3HIZ A;  5JJ0 A;  3SD5 A;  3D9J A;  3ZEF A;  1KLX A;  3ZHE B;  3LDZ A;  4KZC A;  1XNF A;  1HG5 A;  2IJG X;  4U63 A;  2RG8 A;  2HYZ A;  4O6F A;  4OVV A;  4ANV A;  5A7D B;  3CBO A;  3WXX A;  3I4R B;  2VQ2 A;  3QWV A;  4FP7 A;  3L17 A;  4I9C A;  2A5U A;  5F6K C;  2FUL A;  4WWP A;  5AYF A;  3I3N A;  4Q94 A;  3B7S A;  2AVP A;  4XE0 A;  3L08 A;  5BW8 C;  3QB2 A;  3ZYQ A;  3ZIM A;  5C1D A;  2LNI A;  4W9R A;  2P58 C;  4N5C A;  3ONK A;  4CEM A;  2WXN A;  4C9B B;  4JC8 A;  3RAY A;  3FTU A;  3UQ3 A;  3ASD A;  5E76 A;  3MGB A;  3L22 A;  3D9P A;  4PH4 B;  4DK5 A;  1UJJ A;  4ILI A;  1UG3 A;  3MZL B;  4JEU A;  5TTF A;  2X6K A;  3PH0 C;  1W3B A;  2OVB A;  5KJL A;  3FH5 A;  4N3B A;  4DLO A;  2XPY A;  5JJ7 A;  1E7V A;  2UY1 B;  3CBP A;  2KAT A;  1B89 A;  2VGX A;  2LSU A;  3JUI A;  4PDX A;  5AEN A;  1QQE A;  5T5G A;  3FUI A;  3ASH A;  3KS2 A;  3PVL A;  4APF A;  4DJA A;  3K5K A;  3U64 A;  1IYG A;  3IHV A;  2I1J A;  3RJV A;  4U8H A;  3FTV A;  3RK6 A;  3K9I A;  2I6H A;  4FJY A;  3PDN A;  2IOS A;  3M56 A;  1MVX A;  4GZ3 A;  5LSX A;  3RU0 A;  3Q15 A;  3CR3 A;  3PUJ A;  2V0P A;  2CHW A;  4WAF A;  5LSZ A;  2E2E A;  3S7F A;  1E8Y A;  1EF1 C;  4CGV A;  1MHQ A;  4JL0 A;  5JJT A;  2WXH A;  2IFU A;  2WXK A;  4NRH B;  3ZYK A;  4MI5 A;  2QPW A;  3ENE A;  4I1A A;  4EZJ A;  3HHM A;  5G04 J;  1HU3 A;  4IYP A;  1HFA A;  2AXV A;  3B7U X;  3JCK C;  4JEH A;  4JDS A;  5JIN A;  4A1S A;  3L16 A;  5LOZ A;  4GAA A;  4FUL A;  3CK8 A;  3FUD A;  3FEX A;  2Q7F A;  1E96 B;  4IRU A;  3OAW A;  3SI5 A;  4AM9 A;  2XRZ A;  2XCC A;  2UY1 A;  5D0Q D;  1TEZ A;  3R9A B;  3PRZ A;  5ANL A;  1H2T C;  3ML9 A;  3I5P A;  3ZN3 A;  4C0M A;  3QAQ A;  2MHK A;  1DVP A;  4UWH A;  3S8P A;  2A4Z A;  4TRQ A;  3ULQ A;  4DLQ A;  4QFV A;  1JUQ A;  3U9W A;  3FUL A;  3P1U A;  4GYW A;  3ZPJ A;  1OWL A;  4RG9 A;  3U4T A;  2L9B A;  1N52 A;  4JZY A;  3SGH A;  2WXQ A;  3M54 A;  1BPO A;  2X6J A;  3RIB A;  1XQH A;  3HDX A;  3QKY A;  1Z3X A;  3MYV A;  4GCN A;  3FUJ A;  1PAQ A;  1OWN A;  2PM6 A;  4LRZ A;  4TUU A;  4C0E A;  4UWG A;  4KVO A;  4L1B A;  3PEV B;  4IJD A;  2VYI A;  5G55 A;  1SQM A;  2QY7 A;  3B13 A;  4WWN A;  5FQ8 A;  1H2U A;  3G2U A;  2QFC A;  4YNM A;  2VSX E;  1QZ2 A;  4N3C A;  1L5J A;  2E0I A;  3DBS A;  3KMA A;  4CCA A;  3CVW A;  3C98 A;  2HO1 A;  2GW1 A;  4BY6 A;  4J7I A;  1DNP A;  1E8W A;  3D9M A;  2X6H A;  2XPI A;  4HOU A;  4CDN A;  3MO0 A;  4LDG A;  4D10 C;  3QK0 A;  3D9L A;  4J8F A;  3JQ1 A;  2VTB B;  1NA3 A;  4WNG A;  3QJZ A;  4I2W A;  3FTX A;  1UW4 B;  4FJZ A;  3RO2 A;  5HI7 A;  4ATG A;  1H0A A;  1H3I A;  3M53 A;  3CVP A;  1NP7 A;  5DIZ A;  5KJK A;  2X6I A;  2IU1 A;  3ZYL A;  3GZS A;  3CV0 A;  3FH7 A;  3MKR A;  5F6L A;  1HH8 A;  1E8Z A;  1FCH A;  2JEK A;  2XGS A;  3PE4 A;  3ZGQ A;  1JWG A;  1NA0 A;  3D9N A;  4CT4 A;  5BUZ A;  1INZ A;  4U04 A;  3F9W A;  3ESK A;  3FWV A;  4R7L A;  4A55 A;  1H6K A;  5BT1 A;  2JV0 A;  4AOF A;  3M57 A;  1ZBP A;  2O8J A;  5KJM A;  4YVQ C;  4U0U A;  3S7B A;  3CQC B;  4OVU A;  4GYY A;  3IHY A;  4J8O A;  4G24 A;  4ACL A;  3OXL A;  3PNL B;  2I1K A;  5EX0 A;  3VUZ A;  4GZ5 A;  5EG2 A;  4J0U A;  3L13 A;  3SZ7 A;  4LEU A;  2PZI A;  4F53 A;  2NC9 A;  2WXF A;  3QOU A;  3FUF A;  4JHK A;  3ZXS A;  1ZU2 A;  3QC1 A;  2KC7 A;  4J8E A;  3T5X A;  4YPA A;  2C2L A;  3B7T A;  4RZ0 A;  4UWL A;  2WQ6 A;  4Q96 A;  4EPZ A;  3CHS A;  3FHE A;  2DBA A;  4CRW A;  3ASF A;  4MS6 A;  4KZ0 A;  2VTB A;  5JJ6 A;  4U0Z A;  4EBA A;  2YQ8 A;  3S2A A;  4AIF A;  5ARF A;  4GZC A;  3BG0 B;  4UI9 K;  4F3V A;  5LFA A;  2W5Z A;  4KXK B;  1N6C A;  4I17 A;  1ZKK A;  3TG4 A;  4FHK A;  3MA5 A;  5E75 A;  3ZRH A;  3CVV A;  2YHE A;  5AIJ A;  4HXI A;  2VSO E;  3D9O A;  3IKO B;  4K03 A;  2BUG A;  3TGO A;  4WNF A;  4JPS A;  2X3M A;  3KEZ A;  5CPR B;  3SFZ A;  3MX3 A;  3PNT B;  3ZYM A;  4FHJ A;  4CDM A;  3F9Z A;  3PS6 A;  5EKQ D;  3CKB A;  2XGM A;  3U3W A;  1O9S A;  2WXP A;  4L2L A;  2BQZ A;  3LCA A;  3ZHE A;  5FWQ A;  3ASG A;  2WB2 A;  5AJD A;  5AJL A;  1N3J A;  3CVX A;  2L6J A;  3PUK A;  3CVY A;  4MRU A;  4XIF A;  4B89 A;  2R59 A;  3PE3 A;  4G26 A;  4GZD A;  3FY4 A;  3PZD A;  3VLE A;  2UWJ G;  2J09 A;  4I1O B;  1Z3Y A;  3MKQ B;  2PL2 A;  4XZ4 A;  3TG5 A;  3LS8 A;  4I43 A;  2R17 C;  4BT8 A;  1EPU A;  4WND A;  3BEE A;  3AU4 A;  4A3T A;  4B8A A;  4ANU A;  1P5Q A;  5M72 A;  1PEG A;  2G46 A;  2AW6 A;  1HF8 A;  1OWM A;  5T3R A;  1IQR A;  3GZ2 A;  2PQN A;  4FC8 A;  5FQ4 A;  3QDN A;  3HVE B;  5G2N A;  1UN8 A;  3KMT A;  3RJW A;  2FI7 A;  4P29 A;  5FQ6 A;  3JYS A;  2AWI A;  3GW4 A;  1IQU A;  3UT4 A;  4BFR A;  1S0P A;  4CGW A;  4HOS A;  3HYM B;  4J6I A;  1VDY A;  2PM7 A;  3CHO A;  3G2V A;  3NZS A;  5D0O D;  3GZ1 A;  4OYS A;  5KJN A;  4I51 A;  2X38 A;  3VLD A;  4G2V A;  1H2V C;  2IOL A;  2MRI A;  2ION A;  2YHC A;  2LO6 A;  3EDT B;  4PS7 A;  4U07 A;  3SF4 A;  4E6H A;  3FUK A;  3ZW3 A;  1HE8 A;  3MV3 B;  5LX8 A;  3FPD A;  4JHJ A;  3IV0 A;  1XGW A;  4GPK A;  5ENN A;  4BSX A;  3LYA A;  3FU0 A;  1OWO A;  4AY6 A;  5F59 A;  4QEP A;  3Q49 B;  1WY6 A;  4ABN A;  2FEZ A;  3O48 A;  3R7R A;  3UUX A;  3MKQ A;  1WM5 A;  3CHP A;  3I4G A;  4I2Z A;  5A6C A;  1YA0 A;  3FUN A;  2V4L A;  3OXF A;  3CBM A;  2WXM A;  2XEV A;  1JWF A;  3CSF A;  2OOE A;  4I1M A;  1QNF A;  2CG3 A;  3BO5 A;  3OOI A;  1FVH A;  2FBN A;  4G11 A;  5T8I A;  2OV8 A;  2R3A A;  5FJY A;  3TL5 A;  4XI9 A;  3MO5 A;  5JHB A;  4DI3 A;  1N6A A;  3HVE A;  3ONL A;  4FA6 A;  2WVI A;  2XHE A;  4KBQ A;  1PC2 A;  3LJ3 A;  4WUY A;  3EP0 A;  4H12 A;  2LAH A;  2WM9 A;  3APC A;  3EJN A;  4PS3 A;  4U0S A;  4E47 A;  1X5B A;  3M5A A;  4GA0 A;  1ELK A;  4LCT A;  1JPL A;  2V8S E;  4L23 A;  2VGY A;  3IBE A;  4IJ8 A;  3CVQ A;  4TV3 A;  3UPV A;  2OND A;  4Z4P A;  4I6J A;  2J4D A;  1EYH A;  2CFZ A;  2HM8 A;  5G05 C;  3T5V A;  3VTY A;  3TJP A;  5G05 J;  3CK7 A;  4BUP A;  1HXI A;  2L0T B;  3FU6 A;  3LXU X;  3FTS A;  1OUV A;  3U66 A;  3HNA A;  4DPR A;  4IUL A;  4MI0 A;  4KYO B;  1TJC A;  4KMO A;  1TJF A;  3PEU B;  2VJ8 A;  3NF1 A;  4MKT A;  4G25 A;  4K0R A;  4UI9 C;  3G2W A;  4QEO A;  4KVM A;  4H7Y A;  4CT0 A;  3LY9 A;  3L6A A;  1HZ4 A;  1WAO 1;  2C0L A;  4UI9 J;  4L2Y A;  5EDS A;  5LCW C;  2WXG A;  4ANX A;  3FUE A;  3M55 A;  5CMY A;  5C2Y A;  2RD0 A;  3Q4A B;  4JVS A;  3G2T A;  4NQ0 A;  3CKC A;  3VV0 A;  5TH7 A;  1H19 A;  4EZK A;  4RSY A;  4F7A A;  2JLB A;  3FU5 A;  5FT9 A;  4B0Z A;  4BX8 A;  2V5F A;  3FP3 A;  1ML9 A;  2RFI A;  3OPE A;  3SBS A;  1PY1 A;  2WPV A;  2IF4 A;  2FO7 A;  4M3O A;  4GYO A;  4HLE A;  1HG2 A;  4ANW A;  4PS8 A;  3SHF A;  5F5E A;  3LPZ A;  4J8S A;  2DIW A;  3EHN A;  2KM4 A;  2NSZ A;  3TXM A;  2Y3A A;  2WMO A;  3FDH A;  4YPU A;  3KMJ A;  4FLH A;  3OTN A;  3S7J A;  3EHM A;  1NZN A;  3IHX A;  3LY7 A;  4N39 A;  3Q5M A;  1Y6I A;  2IQC A;  2Y4T A;  2IGQ A;  4GB9 A;  2Y4U A;  3CVU A;  4I6G A;  3FTY A;  3LKU A;  4J7F A;  4AXH A;  4JA7 A;  2YNQ A;  3LVR E;  2PQR A;  4G1T A;  2NXP A;  1KT1 A;  4GMJ A;  4HOQ A;  2GRL A;  5CHE E;  3JQ0 A;  4AVX A;  1SZA A;  3LY8 A;  2WXL A;  3Q47 B;  1LF8 A;  2HR2 A;  2XRY A;  3URZ A;  5FZS A;  4QEN A;  3OS5 A;  3MJW A;  2WXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...