3S7FA

Structural basis of substrate methylation and inhibition of smyd2
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
429
structure length
429
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Substrate Methylation and Inhibition of SMYD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords N-lysine methyltransferase SMYD2
total genus 152
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3s7fA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s7fA01
1Y8MA 5JHNA 5DIZA 3ZHEA 2UY1B 4U04A 4N2SA 3F9XA 5F6LA 4C1QA 4GYOA 5CPRB 3KD7A 5EX0A 1HH8A 3CEQA 5KJKA 2W5ZA 3RQ4A 2LSVA 4N3CA 4N3AA 4CGVA 4J8EA 2QPWA 3UQ3A 4ABNA 4GA2A 4GZ6A 2C0LA 2J9QA 4I51A 1ELWA 4J8OA 4QEOA 4U07A 4WNGA 3TG5A 5CCMA 3ZN3A 5AYFA 3VUZA 5JJ6A 1KT0A 5KJLA 4BT9A 5G04J 4AU7A 3WXXA 1WM5A 2FBNA 3MV2B 2L6JA 1MUFA 1HXIA 3CK9A 3GW4A 4J7IA 2Y4TA 5FZSA 4XIFA 3M5AA 2PQRA 2VYIA 5FZRA 3SZ7A 5TTFA 1E96B 3RIBA 4YNPA 3GZ2A 4BTBA 4WNFA 3IEGA 3LYAA 1NA3A 1W3BA 4JA9A 4YVQC 2XCCA 5D0OD 2F69A 4UQZA 3ESKA 3S8PA 4LEUA 3JYSA 4UI9J 3F9YA 4J0UA 2LNIA 3PE4A 5F6KC 2GW1A 3OS5A 4HOSA 4IJDA 1KT1A 5G05J 4GA1A 5F59A 2XGOA 4AY6A 3ZHEB 3LY8A 3MA5A 4I17A 5LCWC 4HOQA 2C2LA 5T0MA 5ARGA 3LY9A 3PDNA 3GYZA 2AVPA 1A17A 4UI9K 5BNWA 3S7BA 5HI7A 2VSYA 4BWRA 2LSUA 4GPKA 5KJMA 2C0MA 1N3JA 5EKQD 1ZBPA 2UWJG 4YPUA 3NF1A 4RG9A 2V5FA 3ZPJA 1ZKKA 1XNFA 2KATA 2HYZA 4O6FA 5KJNA 4GCNA 4MI5A 2BUGA 4A1SA 3Q5MA 3MO0A 1N6CA 3CVNA 4JA7A 3QWPA 2RFIA 4Y6WA 2XGSA 4N5CA 3RU0A 3SWCA 2YHCA 4UI9C 4U0ZA 3AS5A 4BTAA 3CKCA 1H3IA 1O9SA 3ZGQA 4NRHB 4YNDA 4NJ5A 4I9EA 3M55A 3GZ1A 3QWVA 1HZ4A 3M56A 5AYWD 3LCAA 3TAXA 3CVQA 4JLGA 1PC2A 4I9CA 3BO5A 5FJYA 2HO1A 4U0UA 3S7FA 2MHKA 4AM9A 3K5KA 4LDGA 3U3WA 2VGXA 3FFLA 5BT1A 2FEZA 2O8JA 4NVQA 4Y6CA 3K9IA 2W5YA 4HOTA 4E47A 1IHGA 3CBMA 3Q49B 3N71A 3LKUA 3OXFA 3Q47B 3RO3A 3HNAA 2KCVA 3CBOA 5T0KA 4ME2A 4QENA 3M59A 3PE3A 5LSXA 4B94A 5A7DB 3EDTB 4AIFA 5JIYA 2R5SA 3ASFA 4F3VA 3RAYA 2DBAA 5CHEE 3M53A 2R3AA 4HOUA 1ML9A 3ASDA 3ASGA 4G24A 4I2WA 3MO5A 2JV0A 3O48A 4JHRA 3OOIA 3SF4A 5EG2A 3TG4A 3CVPA 2WPVA 4I2ZA 3UPVA 3VV0A 5JJ7A 3F9ZA 1NA0A 1NZNA 2OOEA 5JJ0A 3EP0A 1IYGA 3U4TA 4J83A 4JL0A 4JDSA 3CK7A 4BUPA 2XCBA 3ULQA 2P58C 3LPZA 5LCWJ 2UY1A 4GZ3A 2E2EA 3VTYA 2FO7A 3FPDA 3DALA 3Q4AB 4G23A 4I1AA 3DB5A 4YPEA 3LY7A 2HR2A 4XI0A 3URZA 5A6CA 4J8FA 2KC7A 2QFCA 3CKBA 1MT6A 5C1DA 4RG6A 5ARFA 5LSZA 4N2QA 4YPAA 3VTXA 3MKRA 2Q7FA 3CV0A 2I6HA 3AS4A 3RJWA 1KLXA 4HORA 4H7XA 5BW8C 4W9RA 5FZQA 1N6AA 2ONDA 4Z4PA 4KYOB 3RKVA 4KXKB 3QWWA 5F5EA 3MV3B 3MEKA 1YA0A 4KBQA 1TJCA 4UQXA 4GA0A 5T5GA 3CVLA 2VGXB 2NC9A 2PQNA 3KMTA 5G04C 4YVOA 4G25A 4FMUA 4NQ0A 3M58A 5JJTA 2FF4A 3ASHA 1XQHA 4IJ8A 4IN3B 3R9AB 3AS8A 3ZFWA 3S7JA 3FP3A 2G46A 4QEPA 1B89A 4RZ0A 2IF4A 3FWVA 1MVXA 1QZ2A 1P5QA 3Q15A 4AY5A 3M57A 1MVHA 4BT8A 1ELRA 4CGWA 4CDRA 2JLBA 2VSNA 1OUVA 4G1TA 4GCOA 3CBPA 3F9WA 2WQHA 3QDNA 1ZU2A 5G05C 3UUXA 2XEVA 4YNMA 5JINA 4U0SA 3KMJA 3RJVA 3HYMB 3IHXA 2PZIA 5TEGA 4O30A 2XGMA 3S7DA 3KMAA 4N3BA 1WAO1 4APOA 4H7YA 4MI0A 4G2VA 5FTPA 3QOUA 2IGQA 3OXGA 3OXLA 2VGYA 2KCLA 2PL2A 3BEEA 4WNEA 5FT9A 4J8DA 4EQFA 5M72A 5EX3A 3M54A 3OPEA 3RO2A 2VQ2A 4WUYA 2YQ8A 4WNDA 2IFUA 1QQEA 4UQYA 5D0QD 4GYYA 3SW9A 2XPIA 3E4BA 2Y4UA 4N39A 4G26A 3TGOA 1PEGA 3MO2A 4XI9A 2BQZA 3QKYA 3KS2A 4GYWA 2FI7A 5TH7A 4GZ5A 5DBKA 5HQ8A 4J7FA 3CK8A 2KCKA 4H12A 1FCHA 5CCLA 3KAEA
chains in the Genus database with same CATH superfamily
2R17C 1S0PA 5JHNA 3V31A 3L54A 4LNUD 5CPRB 3B7UX 1BD8A 4U95D 3AJIA 1UG3A 4XKCA 5AIJA 2LSVA 3HIZA 4FJYA 3PH0C 4GA2A 4GZ6A 1OWMA 2X6JA 5FQ6A 4J8OA 4WNGA 1S64A 3DXMG 2XRYA 3PZ1A 2DYSE 3VUZA 4DX7D 4O60A 4XKBA 1H0AA 1MX2A 3CVXA 5CEAA 4OAUC 4I6JA 1UJJA 1MUFA 4DX1A 1OWLA 2A5UA 3FHEA 3GW4A 3U66A 4B89A 3CHPA 1HX8A 3M5AA 3Q79A 2DIWA 4BTBA 4EBAA 4WNFA 3JXIA 3MJWA 3IKOB 2F69A 4UQZA 3NAWA 3Q9UC 3F9YA 2XS1A 4OVUA 4ANXA 4FHKA 4IJDA 5G05J 4ANUA 3R7RA 2XGOA 5ARGA 3LY9A 4UI9K 2WXGA 1AP7A 1IQUA 2GRQB 1D8DA 3ZYKA 1U3CA 1ELKA 3ONLA 2RFMA 5E76A 5EKQD 4LUNU 3FUKA 2ETCA 4CEMA 5ENRD 3T5XA 3ZPJA 4GMLA 1DCEA 2BTDA 3UT7A 2WB2A 4OYSA 2XPZA 4MKTA 2L0TB 2X3MA 3RRUA 4IULA 4A1SA 3ZYLA 3Q5MA 3ZW3A 3UIOC 4I1MA 4Y6WA 3APCA 2CHZA 3RU0A 2YHCA 3AAAC 5AN8A 4U0ZA 1H3IA 1O9SA 2DZNA 4I9EA 3GZ1A 3LCAA 1OT8A 3FTWA 2AW6A 3KSLA 4HQDA 4OVVA 1N4PA 3FH8A 4LSZE 1HF8A 2L9BA 4GTOA 3BO5A 1LTXA 4PUCA 5KNGA 2P9KG 5H7PA 4I43A 3L13A 3DSUA 4U0UA 3W9FA 1IHBA 4AM9A 2P9PG 3APFA 3U3WA 3FUMA 1GW6A 3IHYA 2FEZA 4L7TA 3FTZA 3K9IA 3CBMA 3LKUA 5D66A 4YDEA 3RO3A 4KVMA 3HNAA 3VLFA 4NIKA 1LD8A 5ENSD 3ZNGA 4K0RA 1QBQA 2MYOA 3M59A 2V4LA 3EDTB 4AIFA 2AJAA 2R5SA 3ASFA 4PH4B 4GTRA 3RAYA 2DBAA 1ML9A 3ASGA 4B0ZA 2GRMA 3HRAA 3D9IA 2GRRB 3F9ZA 2DYRE 1Q2ZA 3ZEFA 1IYGA 3U4TA 4DX2A 1SVXA 3CK7A 3HXDA 1TNYA 4JDSA 1FVHA 5AARA 4TXPA 3T9KA 3TWVA 3EHMA 3SO8A 3FTVA 2LAHA 2PNNA 1MX4A 4UWFA 3U64A 3LY7A 1OCZE 3QK0A 5A6CA 3UIPC 2XZTG 3CHSA 3CKBA 3FTYA 1MQSA 1TN6A 3CHRA 4YPAA 3FTSA 3MKRA 5T3RA 3UMVA 1HFAA 2OV8A 3C98A 2I6HA 4H7XA 4TXQA 2ONDA 4KXKB 1E90A 1FVFA 1S63A 1INZA 3CHMA 4BESA 1Z5SC 3W9GA 3TXNA 4JXTA 2VTBB 4DI4A 5G55A 3MEKA 1YA0A 2H6FA 3SY2A 4ZFHA 2VGXB 4AV7A 2X6HA 1YMPA 1LD7A 3FDHA 4C48B 1V55E 3CLJA 3LS8A 2FF4A 4IN3B 1K3ZD 3ZFWA 2WXOA 3EU5A 3EU9A 3FULA 1O1SA 5A23A 2IF4A 4DX5D 2KZTB 1TJFA 1QZ2A 1P5QA 3Q15A 3ML9A 2WMOA 1MVHA 2OCCE 2VSNA 4G1TA 3CBPA 3AG4E 4TRQA 1ZU2A 4LNGA 3QC1A 1TN7A 5FQ8A 2OVFA 3BG1B 4HBDA 3HYMB 3IHXA 2PZIA 2WXQA 3S7DA 4JC8A 4N3BA 4WWPA 2P9NG 5FTPA 1RW2A 1DNPA 3OXLA 1NI1A 4CYMD 2WXIA 2J07A 3SNXA 2VTBA 3BEEA 4R7LA 3ABKE 4J8DA 4O1PA 1ZB1A 2P9UG 2OVBA 5JHBA 5ENOD 1JCRA 2VQ2A 4U96D 2L0IA 3BG0B 4WNDA 5KCMA 5D0QD 4EZLA 3EIQC 4HXIA 4J6IA 2I1JA 1G3NB 1DVPA 4N39A 2YNQA 3TGOA 3FH7A 3UTMA 1QYMA 4XI9A 3ZVVA 3QKYA 3KS2A 4GYWA 2RD0A 4GZ5A 3ASOE 1YCSB 3UI2A 1WDYA 4HLEA 5HQ8A 3C3QA 2KCKA 2QY7A 5CCLA 2WXJA 4HVBA 5DIZA 2UY1B 4BERA 4U04A 4HRMB 5F6LA 3FEYA 3V2XA 4U8VD 1PAQA 1HG5A 1HH8A 1H6PA 5CMWA 3B7RL 2FULA 4J7WA 5KJKA 3PNLB 4U63A 1H19A 4BSZB 2ILRA 1IXVA 4I51A 3PZ4A 4U07A 1V54E 2R2LA 4Q69A 1NFIE 5CCMA 5AYFA 3KEZA 5JJ6A 1KT0A 3B7TA 1VDYA 3FUJA 4PS7A 2YHEA 4JB8P 4CDNA 4D10C 3MGBA 4J7IA 2Y4TA 5FZSA 5J90A 4XIFA 2PQRA 3PZ2A 5BXUA 2QZAA 2VYIA 5FZRA 1FT1A 3RIBA 3GZ2A 4UWHA 3SQVA 1OXJA 3D9JA 2WXPA 4N5QA 2GGFA 4AJWA 2EQXA 3ESKA 3LEWA 4LEUA 3JYSA 3L22A 1X81A 2LNIA 2IO3C 3PREA 4GZCA 2LXLA 2KZTA 2WXHA 4FC8A 4J8YA 5JA4D 2WXFA 5LCWC 2JABA 4TXRA 5T0MA 4A3VA 2WVIA 3GYZA 4KVOA 2X38A 1BI8B 3RRNB 4HNAD 2LSUA 2AXUA 1N3JA 3DXKG 4RQIA 4AEZC 3AU5A 5CERB 4DK5A 4GTVA 2WXLA 3C5RA 1TNZA 3JQ1A 3ASNE 1E7UA 3UM1A 5B1AE 4O6FA 5KJNA 4MLPA 2X6FA 3MZLB 3OAWA 4MI5A 3NQPA 2BUGA 2QYJA 3NOGD 3E34A 4JZYA 2XZDG 3CVNA 3QWPA 1YYHA 2OEVA 3V2OA 3SWCA 3J5QB 1UN8A 3AS5A 4BTAA 2ZGDA 3L82A 4NRHB 2FO1E 1SZ9A 3TL5A 3QWVA 1HZ4A 3CR3A 3I4GA 3CVQA 4JLGA 3ZKJA 4HI9A 1JWGA 4K03A 2V8SE 1O1RA 1N94A 4FU3A 3ULEG 3K5KA 3C3RA 3NOCD 3IBEA 3FFLA 5BT1A 2O8JA 4NVQA 4KZ0A 3MCXA 2J4BA 4HOTA 3Q49B 1U2VG 3N71A 2V5QC 3AU4A 4E85A 2H6HA 5FWQA 3KEAA 2KCVA 5CBOA 4QENA 2GROB 4B94A 2XHEA 5JIYA 2P9IG 1Z6TA 3D9PA 3ASDA 4NACA 3MO5A 2JV0A 4JHRA 4BY6A 3SF4A 1H6KA 2WPVA 3CVVA 1NZNA 4BFRA 2EINE 3TWUA 5JJ0A 4U7EB 4JL0A 4BUPA 3ULQA 2P58C 3LPZA 5LCWJ 2UY1A 4GZ3A 2FO7A 4LRZA 5KBAA 1EYHA 3Q4AB 4PS3A 2HR2A 1HO8A 4DLQA 3DSVA 3Q7FA 5C1DA 1MHQA 5ARFA 2GRLA 1MZCA 2Q7FA 3CHQA 1N54A 4DX6D 2I1KA 5EIBE 1KLXA 4B93B 4W9RA 5FZQA 2HM8A 1N6AA 2LUHA 3PRZA 2NSZA 2F8YA 3AG2E 3UT4A 2QC9A 3F6QA 3MV3B 4KBQA 4GTMA 1TJCA 1PY1A 5AQBA 1SA5A 3CVLA 4JW1A 1HG2A 2AXVA 4ACLA 2NC9A 2PQNA 3HXCA 3FUIA 4MBGA 3E30A 3KMTA 4QQIA 3J5PA 2XEEA 3O4ZA 4G25A 4FMUA 3LJNA 3EIJA 4NQ0A 4UUCA 3DSXA 5JJTA 2CHXA 2EIME 3R9AB 3MKQA 1JUQA 1BI7B 3PUJA 3FP3A 3GZSA 3CVUA 2G46A 4QEPA 2V0PA 3FWVA 3FUFA 4F1PA 3MX3A 1HU3A 5E75A 2KM4A 3BQOA 3C72A 4YDYA 3V30A 3FY4A 4CGWA 4JVSA 1OUVA 4RLYA 1DC2A 1UW4B 4GCOA 2CG2A 2WQHA 2VGEA 4YNMA 5JINA 1N4SA 4YDWA 1DCQA 3T8MA 2XGMA 3RK6A 3UKRG 3L17A 2Y3AA 3TWWA 4H7YA 1H2VC 3CVWA 2IGQA 3BU8A 2RKKA 2KCLA 2PL2A 2EIJE 1SQMA 3SGHA 5M72A 3TJPA 5EYLA 2WXMA 3M54A 3OPEA 2YQ8A 4AXHA 1H6OA 2IFUA 4UQYA 5AJLA 1FPPA 1OCOE 2A4ZA 2QYUA 4GYYA 4TUMA 3SW9A 3CSTA 2Y4UA 2F37A 1L5JA 3VLEA 3MO2A 1JCQA 5D2MC 1BPOA 3ZXPA 4G8KA 3EHNA 2MRIA 5TH7A 2CFUA 1OWNA 3MYVA 5AAOA 3IV0A 1FCHA 1BU9A 3KAEA 3SBTB 1Y8MA 3T5VA 1N0RA 4V3IA 2WXKA 3ZHEA 4BSXA 2P9LG 5FIOA 4N2SA 3F9XA 3B7BA 4GYOA 4XEIG 2IQCA 3APDA 4JPSA 5KNHD 3CEQA 3SD5A 5ENQD 5ENNA 3RQ4A 4N3CA 3CIAA 2QPWA 3UQ3A 4HLLA 4PDXA 2C0LA 2J9QA 2R05A 4B8AA 3JCKC 2LXMA 3ZN3A 3CQCB 5KJLA 4YDOA 4BT9A 3JUIA 3HHMA 3D9OA 5G04J 3D3MA 4AU7A 3WXXA 1WM5A 2FBNA 2L6JA 5LFAA 1HXIA 5ENTD 1E8WA 2ETAA 1WG0A 2J08A 1MYOA 3HXBA 5TTFA 3DPDA 3IEGA 1NA3A 1OCRE 1W3BA 1H2TC 4GTSA 3VLDA 4YVQC 2XCCA 5D0OD 2ETBA 3S8PA 3U9WA 2IONA 5F6KC 4PS8A 2GW1A 3OS5A 3PNTB 4HOSA 3WG7E 1KT1A 1U3DA 2MOWA 4GA1A 4CT0A 3TWQA 4HOQA 1H2UA 4FA6A 4LG6A 1MJ0A 2H6GA 4BETA 5BNWA 3S7BA 4GMRA 3HXFA 5HI7A 4EBAG 2VSYA 3P1UA 1SZAA 3ONKA 3NF1A 4ATZD 1ZKKA 4G8LA 2I2OA 5BXOA 2EIKE 4I6EA 3ZYMA 3BUAA 1N0QA 1A5EA 4KT6B 1N6CA 3IHVA 4EECA 3PUKA 4UWGA 3FU0A 3LDZA 2RFIA 4N5CA 4UI9C 3QNKA 4QFVA 3CKCA 4URKA 3NZUA 4YNDA 4NJ5A 1FT2A 2B0OE 1TN8A 1HS6A 2ZU6B 5AYWD 5CEDB 2F8XK 2AWIA 4APFA 3EHRA 2J4DA 3HDXA 3B13A 2WM9A 2HO1A 5LX8A 3V79K 3S7FA 2MHKA 3CQGB 3DWLG 1TNOA 3HG0D 4LDGA 5HRYA 2CHWA 4M7CA 5FQ4A 2W5YA 2X6IA 1JCSA 2E0IA 3ISMC 4L2LA 4B8CB 2NYJA 4LERA 4JEHA 3DPYA 5AQAA 3HVEB 5T0KA 4HS2A 3FTXA 1AWCB 5EDSA 4ME2A 1RZ4A 2IOSA 5BV0A 4C0EA 4F3VA 4AVXA 1IQRA 4CT4A 2R3AA 4HOUA 4L1BA 3UXGA 3Q75A 3O48A 4CRWA 3TG4A 4DJAA 3UPVA 3VV0A 3EP0A 4C9BB 1QNFA 2V4HC 1NP7A 4GTPA 2XCBA 1N4QA 4I1OB 1WY6A 3VTYA 3FPDA 3TXMA 4G23A 3DB5A 4YPEA 2DZOA 3FUNA 5ANLA 2KC7A 4ATGA 4U8HA 4N2QA 3VTXA 3S2AA 4GB9A 3AS4A 1SA4A 3RJWA 1UN9A 3RKVA 4AP2A 4I6GA 3QWWA 4C0MA 3QJZA 5F5EA 5J08A 4E6HA 3L6AA 1OWOA 4L9PA 5T5GA 3IXEA 3L16A 4Q96A 5G04C 4YVOA 4GTTA 2J49A 2KXPC 3Q78A 2HE0A 1SW6A 4MS6A 3ASHA 1XQHA 3PEVB 3DSSA 4IJ8A 4LCTA 3S7JA 3B7SA 1K8KG 4L2YA 4HRNA 4RZ0A 1KZOA 3G2SA 2RG8A 3AG1E 4AY5A 3M57A 4DI3A 4BT8A 2JLBA 5AENA 1OCCE 3QDNA 2XEVA 3EUVA 3ZIMA 4P29A 3RJVA 3R7QA 3FU3A 4EZJA 5TEGA 2GRNB 3UX4A 4XX5A 5CBNA 3SFYA 3KMAA 3G2TA 4CDMA 4JEUA 2XPYA 3ABME 4DUIA 3ZXSA 4LNBA 4G2VA 3QOUA 4FHJA 5AQ9A 1KPSB 1TYQG 2B6CA 5AJDA 5EIDA 5T4YA 3LVRE 4F7AA 3CGHA 3DEPA 4EQFA 4RSYA 3RO2A 3HXEA 4WUYA 2GRPB 2XPIA 3TWRA 4G26A 4K5AB 3D9KA 2F0YA 4J8SA 5ITZF 1EPUA 3DSWA 3ML8A 4XZ4A 3CK8A 4H12A 2Y1LE 4ANVA 1TR4A 2BKGA 2LAIA 2Y69E 2WXNA 3ESLA 2ZISA 3D9LA 3PS6A 4C1QA 4NURA 3FUEA 2AXZA 3KD7A 5EX0A 2VSOE 3FU6A 3T8KA 4AOFA 3E37A 2W5ZA 4N3AA 4TUUA 4CGVA 4J8EA 4ILGA 3JUEA 4ANWA 4F6RD 4ABNA 4QEOA 1ELWA 3LVQE 3TG5A 4FP7A 3PEUB 1TEZA 2R03A 4FLBA 5KWDA 1E8YA 3SFXA 1E8ZA 3MV2B 3CK9A 3L9TA 3L08A 2M63A 1N9AA 3SI5A 3Q7AA 3SZ7A 1E96B 2WQ7A 4YNPA 4A63B 3G2VA 2P2CP 3LYAA 3ENEA 2P9SG 3DBSA 4JA9A 4HRLA 2A5EA 2XENA 3DRAA 4O1OA 1D9SA 2PM7A 4UI9J 2YINA 4J0UA 3PE4A 3Q9NC 4DRXE 2XRZA 1X5BA 3AG3E 4DPRA 1UOHA 5F59A 3ZRHA 3ABLE 3ZHEB 4AY6A 3LY8A 1S70B 3MA5A 4I17A 4K5BA 3PVLA 2X6KA 2C2LA 3PDNA 1JWFA 4GU5A 1Y6IA 2AVPA 1A17A 4EPZA 5AQ7A 3FUHA 2H6IA 4BWRA 2DCPA 2IOLA 4GPKA 5KJMA 2C0MA 4Q94A 2NXPA 4MRUA 1ZBPA 1N95A 2UWJG 4EZKA 4ZHBA 4YPUA 4RG9A 2V5FA 4ILIA 3SHFA 3QB2A 1XNFA 4M3OA 4IYPA 4EHMA 2KATA 3ZYQA 2HYZA 3I5PA 3LJ3A 4GTQA 1BLXB 4GCNA 1LF8A 2IO2C 5CRVA 3MO0A 4JA7A 1N4RA 2XGSA 1MX6A 5BPPA 2CG3A 2XQ0A 4F1SA 5EILA 3D9NA 3ZGQA 3M55A 1TNUA 2R59A 1K1AA 4RVBA 3M56A 3TAXA 3RSEG 1PC2A 4I9CA 3B95A 4HB5A 5FJYA 2XS8A 3I3NA 4G11A 3C3OA 3E33A 2Y0BG 4CCAA 1NL4A 1KZPA 3E32A 5IY5E 1TNBA 1OWPA 1Z3XA 2VGXA 4A1GA 4TV3A 2EILE 2WMNA 5JHAA 4Y6CA 4E47A 2VJ8A 1IHGA 4GZDA 3QARA 1EDUA 3OXFA 3Q47B 5LP0A 4K5CA 3MKQB 4A3TA 3G2UA 2RFAA 1N52A 3CBOA 2J09A 2VSXE 1O1TA 5ANRA 4CZ2D 3PE3A 5LSXA 3RAUA 1IKND 5A7DB 2PM6A 1K1BA 2ZIRA 5CHEE 3M53A 3UM3A 2OEWA 1UJKA 3P2BA 2LO6A 3CVYA 3ULYA 4G24A 4I2WA 3UM0A 3OOIA 5EG2A 5HS0A 3CVPA 1Z3YA 4I2ZA 5C2YA 4GAAA 3SFZA 5JJ7A 1NA0A 2OOEA 4ACKA 1E8XA 5EYPF 2DVWA 3R9MA 4BX8A 4X8QA 4J83A 2BKKB 3DEOA 5FINA 1HE8A 4U8YD 5CECB 2E2EA 4FLHA 4WWOA 3NZSA 5EN5D 5HKPA 5BV1A 2IY0C 5BUZA 3TWXA 3DALA 4FJZA 4I1AA 2DWZA 1EF1C 4XI0A 3URZA 5G2NA 2IJGX 4J8FA 3UM2A 2QFCA 3EJNA 1MT6A 1E7VA 4ILHB 4RG6A 5LSZA 2J8SD 4UWKA 3CV0A 3D9HA 4HORA 4FULA 3NBNB 3I4RB 5BW8C 3UKUG 4BX9A 4Z4PA 4KYOB 2XEHA 3ZU7B 4OAVB 4JHJA 3DSTA 3ZUVB 3G2WA 3Q73A 4Z68A 2CFZA 4UQXA 4GA0A 5FQ7A 2WXRA 2IEJA 2JEKA 3M58A 4F53A 3FUDA 5ENPD 4L23A 3AS8A 1B89A 3HVEA 1MVXA 4BEPA 2IU1A 2KBXA 2ZXWE 1ELRA 4CDRA 3UT8A 4KMOA 4GPMA 2BEDA 3F9WA 5G05C 3TWTA 3UUXA 4KZCA 3OTNA 4U0SA 3KMJA 3NB2A 5JMND 3TWSA 4IRUA 4O30A 5LOZA 1N11A 1OY3D 5T8IA 2WQ6A 1WAO1 3LXUX 4APOA 2L6BA 2BF0X 5CRUA 4MI0A 2I9CA 3FEXA 3JQ0A 3OXGA 4WWNA 2VGYA 4GMJA 5B3SE 3KSQA 4WAFA 1JPLA 4A55A 3CSFA 4WNEA 5FT9A 3RRMB 5EX3A 3EHQA 4JHKA 1QQEA 3X2QE 3JXJA 3D9MA 3FU5A 4HI8A 3UINC 1D8EA 2R02A 3CHOA 3E4BA 5B1BE 4XE0A 1PEGA 3FH5A 2BQZA 4JD2G 3QAQA 4UWLA 2FI7A 4FADA 1XGWA 5DBKA 4DLOA 4J7FA 5CMYA 2ZGGA 1O5MA 3PZ3A 4HFGA 3SBSA 3PZDA 3FTUA
chains in the Genus database with same CATH topology
2LAIA 1Y8MA 1S0PA 2R17C 2WXJA 3T5VA 5JHNA 2WXNA 4HVBA 4V3IA 2WXKA 5DIZA 3ESLA 3ZHEA 2UY1B 4BSXA 3L54A 4U04A 3D9LA 3PS6A 4N2SA 5F6LA 4C1QA 4GYOA 4NURA 3F9XA 3FUEA 3FEYA 2AXZA 5CPRB 2IQCA 3B7UX 1PAQA 3KD7A 5EX0A 1HG5A 1HH8A 2VSOE 3FU6A 5CMWA 3APDA 4JPSA 4AOFA 3CEQA 3SD5A 3B7RL 2FULA 5KJKA 2W5ZA 1UG3A 4XKCA 5AIJA 5ENNA 3RQ4A 2LSVA 3HIZA 4N3CA 4N3AA 4TUUA 4CGVA 4J8EA 4ILGA 4FJYA 3PNLB 3CIAA 4U63A 2QPWA 4ANWA 1H19A 3UQ3A 3PH0C 4ABNA 4GA2A 2ILRA 4GZ6A 1OWMA 2C0LA 4PDXA 2J9QA 4I51A 1ELWA 2X6JA 5FQ6A 4U07A 4B8AA 4J8OA 4WNGA 3JCKC 4QEOA 3LVQE 4Q69A 3TG5A 2XRYA 5CCMA 3ZN3A 5AYFA 3KEZA 3VUZA 5JJ6A 1KT0A 4FP7A 3CQCB 4XKBA 5KJLA 3PEUB 4BT9A 1H0AA 1TEZA 5LSZA 3JUIA 3HHMA 3B7TA 4FLBA 1VDYA 3FUJA 4PS7A 3D9OA 2YHEA 3CVXA 1E8YA 5G04J 3D3MA 1E8ZA 4AU7A 3WXXA 1WM5A 2FBNA 3MV2B 4I6JA 4CDNA 1UJJA 2L6JA 4D10C 5LFAA 1MUFA 1OWLA 1HXIA 2A5UA 3CK9A 3FHEA 3GW4A 3U66A 3MGBA 4J7IA 4B89A 2Y4TA 3CHPA 5FZSA 5J90A 3L08A 4XIFA 1E8WA 1HX8A 3M5AA 2M63A 2J08A 2PQRA 2VYIA 3SI5A 5FZRA 3SZ7A 5TTFA 1E96B 2WQ7A 3RIBA 4YNPA 2DIWA 3GZ2A 3G2VA 4UWHA 4BTBA 4EBAA 4WNFA 3DPDA 3IEGA 3LYAA 3ENEA 1NA3A 3DBSA 1W3BA 3MJWA 4JA9A 1H2TC 3D9JA 2WXPA 3VLDA 2GGFA 3IKOB 2XCCA 2EQXA 5D0OD 4YVQC 4AJWA 2F69A 4UQZA 3ESKA 3S8PA 3LEWA 4LEUA 3JYSA 2PM7A 4UI9J 4OVUA 3F9YA 2YINA 3L22A 4J0UA 2LNIA 3U9WA 3PE4A 4ANXA 2XRZA 1X5BA 2IONA 3PREA 4GZCA 4PS8A 5F6KC 2GW1A 4DPRA 2KZTA 3OS5A 4FHKA 3PNTB 4HOSA 4IJDA 1KT1A 1U3DA 2MOWA 2WXHA 4FC8A 5G05J 4GA1A 4ANUA 4CT0A 3R7RA 5F59A 2XGOA 3ZRHA 3ZHEB 4AY6A 3LY8A 3MA5A 4I17A 2WXFA 5LCWC 4HOQA 3PVLA 2X6KA 2C2LA 5T0MA 1H2UA 5ARGA 4A3VA 4FA6A 3LY9A 3PDNA 1JWFA 4GU5A 2WVIA 1Y6IA 3GYZA 2AVPA 1A17A 4KVOA 4UI9K 4EPZA 5BNWA 3S7BA 3FUHA 2X38A 5HI7A 4EBAG 2WXGA 3RRNB 2VSYA 4BWRA 2DCPA 3P1UA 2IOLA 1IQUA 2LSUA 3ZYKA 5KJMA 4GPKA 1U3CA 2AXUA 1ELKA 2C0MA 3ONLA 1N3JA 4AEZC 3AU5A 5E76A 5EKQD 4Q94A 2NXPA 3FUKA 4LUNU 4MRUA 4DK5A 1SZAA 1ZBPA 3ONKA 2UWJG 4CEMA 4EZKA 4YPUA 2WXLA 3NF1A 4RG9A 2V5FA 4ILIA 3T5XA 3SHFA 3ZPJA 3QB2A 1ZKKA 1XNFA 3JQ1A 4GMLA 4M3OA 1E7UA 3UT7A 2BTDA 2WB2A 4IYPA 4OYSA 2KATA 3ZYQA 2HYZA 2XPZA 2I2OA 3I5PA 3LJ3A 4O6FA 4MKTA 5KJNA 4I6EA 2X6FA 4GCNA 2L0TB 1LF8A 4MLPA 3MZLB 3OAWA 3ZYMA 4MI5A 3NQPA 2BUGA 2X3MA 3RRUA 4IULA 4A1SA 3ZYLA 4KT6B 3Q5MA 3MO0A 3ZW3A 1N6CA 3IHVA 4EECA 3PUKA 4JZYA 3FU0A 4UWGA 3CVNA 3LDZA 4I1MA 4JA7A 3QWPA 2RFIA 4Y6WA 3APCA 2XGSA 2CHZA 4N5CA 3RU0A 5BPPA 3SWCA 2CG3A 2YHCA 4UI9C 2XQ0A 3QNKA 1UN8A 4U0ZA 3AS5A 4QFVA 4BTAA 3CKCA 1H3IA 4URKA 4F1SA 1O9SA 3NZUA 3D9NA 4NRHB 4YNDA 1SZ9A 3ZGQA 4NJ5A 3TL5A 4I9EA 3M55A 3GZ1A 2R59A 1HZ4A 3QWVA 4RVBA 1HS6A 2ZU6B 3M56A 5AYWD 3LCAA 3TAXA 2AWIA 3CR3A 4APFA 3FTWA 2AW6A 3I4GA 4OVVA 3CVQA 4JLGA 3FH8A 1PC2A 2J4DA 1HF8A 2L9BA 3HDXA 4I9CA 1JWGA 3BO5A 3B13A 4PUCA 5FJYA 4K03A 4I43A 2WM9A 2V8SE 3L13A 2HO1A 4U0UA 5LX8A 3I3NA 4G11A 4FU3A 3S7FA 2MHKA 4AM9A 3CQGB 3K5KA 3APFA 4CCAA 4LDGA 3IBEA 2CHWA 3U3WA 1OWPA 1Z3XA 2VGXA 3FFLA 3FUMA 1GW6A 5FQ4A 3IHYA 2FEZA 4A1GA 5BT1A 2O8JA 4NVQA 4L7TA 4TV3A 2WMNA 5JHAA 4KZ0A 3MCXA 3FTZA 2J4BA 3K9IA 4Y6CA 4HOTA 2X6IA 2W5YA 4E47A 2VJ8A 1IHGA 4GZDA 3CBMA 3QARA 2E0IA 3Q49B 3N71A 1EDUA 3LKUA 3OXFA 3Q47B 3AU4A 5LP0A 4L2LA 4B8CB 3MKQB 4E85A 4A3TA 3G2UA 4LERA 3RO3A 4KVMA 3HNAA 5FWQA 3VLFA 1N52A 4JEHA 2KCVA 2J09A 2VSXE 3CBOA 5ANRA 3HVEB 5T0KA 4HS2A 4K0RA 3FTXA 5EDSA 4ME2A 4QENA 3M59A 2V4LA 3PE3A 5LSXA 2IOSA 5BV0A 4B94A 5A7DB 3EDTB 2XHEA 4AIFA 5JIYA 2PM6A 4C0EA 2R5SA 3ASFA 4PH4B 4F3VA 4AVXA 1IQRA 3RAYA 2DBAA 5CHEE 3M53A 4CT4A 1Z6TA 1UJKA 3P2BA 2R3AA 3D9PA 4HOUA 1ML9A 4L1BA 2LO6A 3ASDA 3ASGA 4NACA 3CVYA 4G24A 4I2WA 4B0ZA 3MO5A 2JV0A 3O48A 4JHRA 3OOIA 2GRMA 3SF4A 1H6KA 4BY6A 4CRWA 5EG2A 3TG4A 3CVPA 2WPVA 1Z3YA 4I2ZA 5C2YA 4DJAA 3UPVA 3VV0A 4GAAA 3SFZA 3D9IA 5JJ7A 3CVVA 3F9ZA 1NA0A 1NZNA 2OOEA 4BFRA 4ACKA 1E8XA 3ZEFA 5JJ0A 3EP0A 4C9BB 1IYGA 1QNFA 4BX8A 1NP7A 3U4TA 4J83A 4JL0A 4JDSA 3CK7A 4BUPA 2XCBA 3ULQA 1FVHA 2P58C 3LPZA 5LCWJ 1HE8A 2UY1A 4I1OB 3EHMA 4GZ3A 1WY6A 2E2EA 3FTVA 2LAHA 4FLHA 3VTYA 4WWOA 3NZSA 4UWFA 3U64A 2FO7A 4LRZA 5BV1A 5BUZA 3FPDA 3TXMA 4FJZA 1EYHA 3Q4AB 3DALA 4G23A 4I1AA 4PS3A 3DB5A 4YPEA 3LY7A 2HR2A 1EF1C 4XI0A 3URZA 5G2NA 3QK0A 5A6CA 3FUNA 1HO8A 2IJGX 4J8FA 5ANLA 4DLQA 2KC7A 2QFCA 4ATGA 3CHSA 3CKBA 3EJNA 4U8HA 1E7VA 5C1DA 3FTYA 1MQSA 1MHQA 4ILHB 4RG6A 3CHRA 5ARFA 4N2QA 4YPAA 2GRLA 3FTSA 3MKRA 2Q7FA 3VTXA 5T3RA 3UMVA 4UWKA 3CHQA 3CV0A 1HFAA 2OV8A 1N54A 3C98A 3S2AA 2I6HA 2I1KA 3AS4A 4GB9A 3RJWA 1KLXA 4HORA 4FULA 4H7XA 3I4RB 1UN9A 4W9RA 5FZQA 2HM8A 5BW8C 1N6AA 2ONDA 4BX9A 4Z4PA 4KYOB 3RKVA 4KXKB 4AP2A 4I6GA 1E90A 3PRZA 1FVFA 2NSZA 3QWWA 4C0MA 3QJZA 1INZA 5F5EA 3CHMA 3UT4A 5J08A 3TXNA 4JXTA 3L6AA 4E6HA 2VTBB 4JHJA 4DI4A 3MV3B 5G55A 1OWOA 3MEKA 1YA0A 3G2WA 4KBQA 1TJCA 1MT6A 2CFZA 1PY1A 4UQXA 4GA0A 5T5GA 3CVLA 4JW1A 2VGXB 3L16A 1HG2A 2X6HA 4AV7A 5FQ7A 2AXVA 4ACLA 2NC9A 2PQNA 3FUIA 3FDHA 4Q96A 3KMTA 5G04C 2WXRA 3O4ZA 2JEKA 4G25A 4YVOA 4FMUA 2J49A 3EIJA 4NQ0A 3CLJA 3M58A 4F53A 5JJTA 4MS6A 3LS8A 2FF4A 2CHXA 3ASHA 3FUDA 4L23A 1XQHA 3PEVB 4IJ8A 4IN3B 3R9AB 3MKQA 4LCTA 1JUQA 3AS8A 3ZFWA 2WXOA 3PUJA 3FULA 3S7JA 3B7SA 3FP3A 3GZSA 4L2YA 3CVUA 2G46A 4QEPA 1B89A 3HVEA 5A23A 4RZ0A 2IF4A 2V0PA 2KZTB 3FWVA 1TJFA 3G2SA 3FUFA 2RG8A 1MVXA 1QZ2A 2IU1A 1P5QA 3MX3A 3Q15A 1HU3A 3ML9A 5E75A 4AY5A 3M57A 2KM4A 2WMOA 1MVHA 4DI3A 4BT8A 1ELRA 3FY4A 4CGWA 4CDRA 4JVSA 2JLBA 2VSNA 3UT8A 5AENA 1OUVA 4KMOA 1UW4B 4G1TA 4GCOA 3CBPA 4TRQA 3F9WA 2CG2A 2WQHA 1ZU2A 3QDNA 5G05C 3UUXA 3QC1A 2XEVA 4KZCA 3OTNA 4YNMA 5JINA 3ZIMA 4P29A 4U0SA 5FQ8A 3KMJA 2OVFA 3BG1B 3RJVA 3R7QA 3HYMB 3IHXA 3FU3A 2PZIA 3T8MA 4EZJA 4IRUA 5TEGA 4O30A 3UX4A 4XX5A 5LOZA 2WXQA 2XGMA 3S7DA 4JC8A 3RK6A 4N3BA 3KMAA 4WWPA 3G2TA 5T8IA 3L17A 1WAO1 2WQ6A 4CDMA 4JEUA 2XPYA 2Y3AA 3LXUX 4APOA 3ZXSA 4H7YA 2BF0X 4MI0A 2I9CA 4G2VA 5FTPA 3QOUA 3FEXA 1H2VC 4FHJA 3CVWA 2IGQA 1DNPA 3JQ0A 3OXGA 4WWNA 3OXLA 2WXIA 5AJDA 2J07A 5T4YA 2VGYA 4GMJA 2KCLA 2PL2A 3LVRE 4WAFA 3SNXA 1JPLA 1SQMA 3BEEA 4R7LA 3SGHA 4A55A 4F7AA 2VTBA 3CSFA 4WNEA 5FT9A 3CGHA 4J8DA 4EQFA 3RRMB 5M72A 4RSYA 3TJPA 5JHBA 2WXMA 2OVBA 5EX3A 3M54A 3OPEA 3RO2A 2VQ2A 4WUYA 2YQ8A 4JHKA 4AXHA 2L0IA 3BG0B 4WNDA 2IFUA 5KCMA 1QQEA 4UQYA 3EIQC 5D0QD 2A4ZA 5AJLA 3D9MA 3FU5A 4EZLA 4HXIA 4GYYA 4J6IA 2I1JA 3CHOA 2XPIA 1DVPA 3CSTA 2Y4UA 3E4BA 3SW9A 4N39A 4XE0A 2YNQA 1L5JA 4G26A 3VLEA 3D9KA 3TGOA 3FH5A 1PEGA 3MO2A 1BPOA 3FH7A 4J8SA 4XI9A 2BQZA 1EPUA 3EHNA 3QKYA 3KS2A 3ML8A 4XZ4A 4GYWA 3ZVVA 3QAQA 2RD0A 4UWLA 2FI7A 4FADA 1XGWA 2MRIA 4GZ5A 5DBKA 5TH7A 4DLOA 5HQ8A 4HLEA 2CFUA 4J7FA 5CMYA 1OWNA 3CK8A 2KCKA 3MYVA 4H12A 4HFGA 3IV0A 4ANVA 1FCHA 2QY7A 3SBSA 5CCLA 3KAEA 3PZDA 3SBTB 3FTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y8M A;  5JHN A;  5DIZ A;  3ZHE A;  2UY1 B;  4U04 A;  4N2S A;  3F9X A;  5F6L A;  4C1Q A;  4GYO A;  5CPR B;  3KD7 A;  5EX0 A;  1HH8 A;  3CEQ A;  5KJK A;  2W5Z A;  3RQ4 A;  2LSV A;  4N3C A;  4N3A A;  4CGV A;  4J8E A;  2QPW A;  3UQ3 A;  4ABN A;  4GA2 A;  4GZ6 A;  2C0L A;  2J9Q A;  4I51 A;  1ELW A;  4J8O A;  4QEO A;  4U07 A;  4WNG A;  3TG5 A;  5CCM A;  3ZN3 A;  5AYF A;  3VUZ A;  5JJ6 A;  1KT0 A;  5KJL A;  4BT9 A;  5G04 J;  4AU7 A;  3WXX A;  1WM5 A;  2FBN A;  3MV2 B;  2L6J A;  1MUF A;  1HXI A;  3CK9 A;  3GW4 A;  4J7I A;  2Y4T A;  5FZS A;  4XIF A;  3M5A A;  2PQR A;  2VYI A;  5FZR A;  3SZ7 A;  5TTF A;  1E96 B;  3RIB A;  4YNP A;  3GZ2 A;  4BTB A;  4WNF A;  3IEG A;  3LYA A;  1NA3 A;  1W3B A;  4JA9 A;  4YVQ C;  2XCC A;  5D0O D;  2F69 A;  4UQZ A;  3ESK A;  3S8P A;  4LEU A;  3JYS A;  4UI9 J;  3F9Y A;  4J0U A;  2LNI A;  3PE4 A;  5F6K C;  2GW1 A;  3OS5 A;  4HOS A;  4IJD A;  1KT1 A;  5G05 J;  4GA1 A;  5F59 A;  2XGO A;  4AY6 A;  3ZHE B;  3LY8 A;  3MA5 A;  4I17 A;  5LCW C;  4HOQ A;  2C2L A;  5T0M A;  5ARG A;  3LY9 A;  3PDN A;  3GYZ A;  2AVP A;  1A17 A;  4UI9 K;  5BNW A;  3S7B A;  5HI7 A;  2VSY A;  4BWR A;  2LSU A;  4GPK A;  5KJM A;  2C0M A;  1N3J A;  5EKQ D;  1ZBP A;  2UWJ G;  4YPU A;  3NF1 A;  4RG9 A;  2V5F A;  3ZPJ A;  1ZKK A;  1XNF A;  2KAT A;  2HYZ A;  4O6F A;  5KJN A;  4GCN A;  4MI5 A;  2BUG A;  4A1S A;  3Q5M A;  3MO0 A;  1N6C A;  3CVN A;  4JA7 A;  3QWP A;  2RFI A;  4Y6W A;  2XGS A;  4N5C A;  3RU0 A;  3SWC A;  2YHC A;  4UI9 C;  4U0Z A;  3AS5 A;  4BTA A;  3CKC A;  1H3I A;  1O9S A;  3ZGQ A;  4NRH B;  4YND A;  4NJ5 A;  4I9E A;  3M55 A;  3GZ1 A;  3QWV A;  1HZ4 A;  3M56 A;  5AYW D;  3LCA A;  3TAX A;  3CVQ A;  4JLG A;  1PC2 A;  4I9C A;  3BO5 A;  5FJY A;  2HO1 A;  4U0U A;  3S7F A;  2MHK A;  4AM9 A;  3K5K A;  4LDG A;  3U3W A;  2VGX A;  3FFL A;  5BT1 A;  2FEZ A;  2O8J A;  4NVQ A;  4Y6C A;  3K9I A;  2W5Y A;  4HOT A;  4E47 A;  1IHG A;  3CBM A;  3Q49 B;  3N71 A;  3LKU A;  3OXF A;  3Q47 B;  3RO3 A;  3HNA A;  2KCV A;  3CBO A;  5T0K A;  4ME2 A;  4QEN A;  3M59 A;  3PE3 A;  5LSX A;  4B94 A;  5A7D B;  3EDT B;  4AIF A;  5JIY A;  2R5S A;  3ASF A;  4F3V A;  3RAY A;  2DBA A;  5CHE E;  3M53 A;  2R3A A;  4HOU A;  1ML9 A;  3ASD A;  3ASG A;  4G24 A;  4I2W A;  3MO5 A;  2JV0 A;  3O48 A;  4JHR A;  3OOI A;  3SF4 A;  5EG2 A;  3TG4 A;  3CVP A;  2WPV A;  4I2Z A;  3UPV A;  3VV0 A;  5JJ7 A;  3F9Z A;  1NA0 A;  1NZN A;  2OOE A;  5JJ0 A;  3EP0 A;  1IYG A;  3U4T A;  4J83 A;  4JL0 A;  4JDS A;  3CK7 A;  4BUP A;  2XCB A;  3ULQ A;  2P58 C;  3LPZ A;  5LCW J;  2UY1 A;  4GZ3 A;  2E2E A;  3VTY A;  2FO7 A;  3FPD A;  3DAL A;  3Q4A B;  4G23 A;  4I1A A;  3DB5 A;  4YPE A;  3LY7 A;  2HR2 A;  4XI0 A;  3URZ A;  5A6C A;  4J8F A;  2KC7 A;  2QFC A;  3CKB A;  1MT6 A;  5C1D A;  4RG6 A;  5ARF A;  5LSZ A;  4N2Q A;  4YPA A;  3VTX A;  3MKR A;  2Q7F A;  3CV0 A;  2I6H A;  3AS4 A;  3RJW A;  1KLX A;  4HOR A;  4H7X A;  5BW8 C;  4W9R A;  5FZQ A;  1N6A A;  2OND A;  4Z4P A;  4KYO B;  3RKV A;  4KXK B;  3QWW A;  5F5E A;  3MV3 B;  3MEK A;  1YA0 A;  4KBQ A;  1TJC A;  4UQX A;  4GA0 A;  5T5G A;  3CVL A;  2VGX B;  2NC9 A;  2PQN A;  3KMT A;  5G04 C;  4YVO A;  4G25 A;  4FMU A;  4NQ0 A;  3M58 A;  5JJT A;  2FF4 A;  3ASH A;  1XQH A;  4IJ8 A;  4IN3 B;  3R9A B;  3AS8 A;  3ZFW A;  3S7J A;  3FP3 A;  2G46 A;  4QEP A;  1B89 A;  4RZ0 A;  2IF4 A;  3FWV A;  1MVX A;  1QZ2 A;  1P5Q A;  3Q15 A;  4AY5 A;  3M57 A;  1MVH A;  4BT8 A;  1ELR A;  4CGW A;  4CDR A;  2JLB A;  2VSN A;  1OUV A;  4G1T A;  4GCO A;  3CBP A;  3F9W A;  2WQH A;  3QDN A;  1ZU2 A;  5G05 C;  3UUX A;  2XEV A;  4YNM A;  5JIN A;  4U0S A;  3KMJ A;  3RJV A;  3HYM B;  3IHX A;  2PZI A;  5TEG A;  4O30 A;  2XGM A;  3S7D A;  3KMA A;  4N3B A;  1WAO 1;  4APO A;  4H7Y A;  4MI0 A;  4G2V A;  5FTP A;  3QOU A;  2IGQ A;  3OXG A;  3OXL A;  2VGY A;  2KCL A;  2PL2 A;  3BEE A;  4WNE A;  5FT9 A;  4J8D A;  4EQF A;  5M72 A;  5EX3 A;  3M54 A;  3OPE A;  3RO2 A;  2VQ2 A;  4WUY A;  2YQ8 A;  4WND A;  2IFU A;  1QQE A;  4UQY A;  5D0Q D;  4GYY A;  3SW9 A;  2XPI A;  3E4B A;  2Y4U A;  4N39 A;  4G26 A;  3TGO A;  1PEG A;  3MO2 A;  4XI9 A;  2BQZ A;  3QKY A;  3KS2 A;  4GYW A;  2FI7 A;  5TH7 A;  4GZ5 A;  5DBK A;  5HQ8 A;  4J7F A;  3CK8 A;  2KCK A;  4H12 A;  1FCH A;  5CCL A;  3KAE A; 
#chains in the Genus database with same CATH topology
 2R17 C;  1S0P A;  5JHN A;  3V31 A;  3L54 A;  4LNU D;  5CPR B;  3B7U X;  1BD8 A;  4U95 D;  3AJI A;  1UG3 A;  4XKC A;  5AIJ A;  2LSV A;  3HIZ A;  4FJY A;  3PH0 C;  4GA2 A;  4GZ6 A;  1OWM A;  2X6J A;  5FQ6 A;  4J8O A;  4WNG A;  1S64 A;  3DXM G;  2XRY A;  3PZ1 A;  2DYS E;  3VUZ A;  4DX7 D;  4O60 A;  4XKB A;  1H0A A;  1MX2 A;  3CVX A;  5CEA A;  4OAU C;  4I6J A;  1UJJ A;  1MUF A;  4DX1 A;  1OWL A;  2A5U A;  3FHE A;  3GW4 A;  3U66 A;  4B89 A;  3CHP A;  1HX8 A;  3M5A A;  3Q79 A;  2DIW A;  4BTB A;  4EBA A;  4WNF A;  3JXI A;  3MJW A;  3IKO B;  2F69 A;  4UQZ A;  3NAW A;  3Q9U C;  3F9Y A;  2XS1 A;  4OVU A;  4ANX A;  4FHK A;  4IJD A;  5G05 J;  4ANU A;  3R7R A;  2XGO A;  5ARG A;  3LY9 A;  4UI9 K;  2WXG A;  1AP7 A;  1IQU A;  2GRQ B;  1D8D A;  3ZYK A;  1U3C A;  1ELK A;  3ONL A;  2RFM A;  5E76 A;  5EKQ D;  4LUN U;  3FUK A;  2ETC A;  4CEM A;  5ENR D;  3T5X A;  3ZPJ A;  4GML A;  1DCE A;  2BTD A;  3UT7 A;  2WB2 A;  4OYS A;  2XPZ A;  4MKT A;  2L0T B;  2X3M A;  3RRU A;  4IUL A;  4A1S A;  3ZYL A;  3Q5M A;  3ZW3 A;  3UIO C;  4I1M A;  4Y6W A;  3APC A;  2CHZ A;  3RU0 A;  2YHC A;  3AAA C;  5AN8 A;  4U0Z A;  1H3I A;  1O9S A;  2DZN A;  4I9E A;  3GZ1 A;  3LCA A;  1OT8 A;  3FTW A;  2AW6 A;  3KSL A;  4HQD A;  4OVV A;  1N4P A;  3FH8 A;  4LSZ E;  1HF8 A;  2L9B A;  4GTO A;  3BO5 A;  1LTX A;  4PUC A;  5KNG A;  2P9K G;  5H7P A;  4I43 A;  3L13 A;  3DSU A;  4U0U A;  3W9F A;  1IHB A;  4AM9 A;  2P9P G;  3APF A;  3U3W A;  3FUM A;  1GW6 A;  3IHY A;  2FEZ A;  4L7T A;  3FTZ A;  3K9I A;  3CBM A;  3LKU A;  5D66 A;  4YDE A;  3RO3 A;  4KVM A;  3HNA A;  3VLF A;  4NIK A;  1LD8 A;  5ENS D;  3ZNG A;  4K0R A;  1QBQ A;  2MYO A;  3M59 A;  2V4L A;  3EDT B;  4AIF A;  2AJA A;  2R5S A;  3ASF A;  4PH4 B;  4GTR A;  3RAY A;  2DBA A;  1ML9 A;  3ASG A;  4B0Z A;  2GRM A;  3HRA A;  3D9I A;  2GRR B;  3F9Z A;  2DYR E;  1Q2Z A;  3ZEF A;  1IYG A;  3U4T A;  4DX2 A;  1SVX A;  3CK7 A;  3HXD A;  1TNY A;  4JDS A;  1FVH A;  5AAR A;  4TXP A;  3T9K A;  3TWV A;  3EHM A;  3SO8 A;  3FTV A;  2LAH A;  2PNN A;  1MX4 A;  4UWF A;  3U64 A;  3LY7 A;  1OCZ E;  3QK0 A;  5A6C A;  3UIP C;  2XZT G;  3CHS A;  3CKB A;  3FTY A;  1MQS A;  1TN6 A;  3CHR A;  4YPA A;  3FTS A;  3MKR A;  5T3R A;  3UMV A;  1HFA A;  2OV8 A;  3C98 A;  2I6H A;  4H7X A;  4TXQ A;  2OND A;  4KXK B;  1E90 A;  1FVF A;  1S63 A;  1INZ A;  3CHM A;  4BES A;  1Z5S C;  3W9G A;  3TXN A;  4JXT A;  2VTB B;  4DI4 A;  5G55 A;  3MEK A;  1YA0 A;  2H6F A;  3SY2 A;  4ZFH A;  2VGX B;  4AV7 A;  2X6H A;  1YMP A;  1LD7 A;  3FDH A;  4C48 B;  1V55 E;  3CLJ A;  3LS8 A;  2FF4 A;  4IN3 B;  1K3Z D;  3ZFW A;  2WXO A;  3EU5 A;  3EU9 A;  3FUL A;  1O1S A;  5A23 A;  2IF4 A;  4DX5 D;  2KZT B;  1TJF A;  1QZ2 A;  1P5Q A;  3Q15 A;  3ML9 A;  2WMO A;  1MVH A;  2OCC E;  2VSN A;  4G1T A;  3CBP A;  3AG4 E;  4TRQ A;  1ZU2 A;  4LNG A;  3QC1 A;  1TN7 A;  5FQ8 A;  2OVF A;  3BG1 B;  4HBD A;  3HYM B;  3IHX A;  2PZI A;  2WXQ A;  3S7D A;  4JC8 A;  4N3B A;  4WWP A;  2P9N G;  5FTP A;  1RW2 A;  1DNP A;  3OXL A;  1NI1 A;  4CYM D;  2WXI A;  2J07 A;  3SNX A;  2VTB A;  3BEE A;  4R7L A;  3ABK E;  4J8D A;  4O1P A;  1ZB1 A;  2P9U G;  2OVB A;  5JHB A;  5ENO D;  1JCR A;  2VQ2 A;  4U96 D;  2L0I A;  3BG0 B;  4WND A;  5KCM A;  5D0Q D;  4EZL A;  3EIQ C;  4HXI A;  4J6I A;  2I1J A;  1G3N B;  1DVP A;  4N39 A;  2YNQ A;  3TGO A;  3FH7 A;  3UTM A;  1QYM A;  4XI9 A;  3ZVV A;  3QKY A;  3KS2 A;  4GYW A;  2RD0 A;  4GZ5 A;  3ASO E;  1YCS B;  3UI2 A;  1WDY A;  4HLE A;  5HQ8 A;  3C3Q A;  2KCK A;  2QY7 A;  5CCL A;  2WXJ A;  4HVB A;  5DIZ A;  2UY1 B;  4BER A;  4U04 A;  4HRM B;  5F6L A;  3FEY A;  3V2X A;  4U8V D;  1PAQ A;  1HG5 A;  1HH8 A;  1H6P A;  5CMW A;  3B7R L;  2FUL A;  4J7W A;  5KJK A;  3PNL B;  4U63 A;  1H19 A;  4BSZ B;  2ILR A;  1IXV A;  4I51 A;  3PZ4 A;  4U07 A;  1V54 E;  2R2L A;  4Q69 A;  1NFI E;  5CCM A;  5AYF A;  3KEZ A;  5JJ6 A;  1KT0 A;  3B7T A;  1VDY A;  3FUJ A;  4PS7 A;  2YHE A;  4JB8 P;  4CDN A;  4D10 C;  3MGB A;  4J7I A;  2Y4T A;  5FZS A;  5J90 A;  4XIF A;  2PQR A;  3PZ2 A;  5BXU A;  2QZA A;  2VYI A;  5FZR A;  1FT1 A;  3RIB A;  3GZ2 A;  4UWH A;  3SQV A;  1OXJ A;  3D9J A;  2WXP A;  4N5Q A;  2GGF A;  4AJW A;  2EQX A;  3ESK A;  3LEW A;  4LEU A;  3JYS A;  3L22 A;  1X81 A;  2LNI A;  2IO3 C;  3PRE A;  4GZC A;  2LXL A;  2KZT A;  2WXH A;  4FC8 A;  4J8Y A;  5JA4 D;  2WXF A;  5LCW C;  2JAB A;  4TXR A;  5T0M A;  4A3V A;  2WVI A;  3GYZ A;  4KVO A;  2X38 A;  1BI8 B;  3RRN B;  4HNA D;  2LSU A;  2AXU A;  1N3J A;  3DXK G;  4RQI A;  4AEZ C;  3AU5 A;  5CER B;  4DK5 A;  4GTV A;  2WXL A;  3C5R A;  1TNZ A;  3JQ1 A;  3ASN E;  1E7U A;  3UM1 A;  5B1A E;  4O6F A;  5KJN A;  4MLP A;  2X6F A;  3MZL B;  3OAW A;  4MI5 A;  3NQP A;  2BUG A;  2QYJ A;  3NOG D;  3E34 A;  4JZY A;  2XZD G;  3CVN A;  3QWP A;  1YYH A;  2OEV A;  3V2O A;  3SWC A;  3J5Q B;  1UN8 A;  3AS5 A;  4BTA A;  2ZGD A;  3L82 A;  4NRH B;  2FO1 E;  1SZ9 A;  3TL5 A;  3QWV A;  1HZ4 A;  3CR3 A;  3I4G A;  3CVQ A;  4JLG A;  3ZKJ A;  4HI9 A;  1JWG A;  4K03 A;  2V8S E;  1O1R A;  1N94 A;  4FU3 A;  3ULE G;  3K5K A;  3C3R A;  3NOC D;  3IBE A;  3FFL A;  5BT1 A;  2O8J A;  4NVQ A;  4KZ0 A;  3MCX A;  2J4B A;  4HOT A;  3Q49 B;  1U2V G;  3N71 A;  2V5Q C;  3AU4 A;  4E85 A;  2H6H A;  5FWQ A;  3KEA A;  2KCV A;  5CBO A;  4QEN A;  2GRO B;  4B94 A;  2XHE A;  5JIY A;  2P9I G;  1Z6T A;  3D9P A;  3ASD A;  4NAC A;  3MO5 A;  2JV0 A;  4JHR A;  4BY6 A;  3SF4 A;  1H6K A;  2WPV A;  3CVV A;  1NZN A;  4BFR A;  2EIN E;  3TWU A;  5JJ0 A;  4U7E B;  4JL0 A;  4BUP A;  3ULQ A;  2P58 C;  3LPZ A;  5LCW J;  2UY1 A;  4GZ3 A;  2FO7 A;  4LRZ A;  5KBA A;  1EYH A;  3Q4A B;  4PS3 A;  2HR2 A;  1HO8 A;  4DLQ A;  3DSV A;  3Q7F A;  5C1D A;  1MHQ A;  5ARF A;  2GRL A;  1MZC A;  2Q7F A;  3CHQ A;  1N54 A;  4DX6 D;  2I1K A;  5EIB E;  1KLX A;  4B93 B;  4W9R A;  5FZQ A;  2HM8 A;  1N6A A;  2LUH A;  3PRZ A;  2NSZ A;  2F8Y A;  3AG2 E;  3UT4 A;  2QC9 A;  3F6Q A;  3MV3 B;  4KBQ A;  4GTM A;  1TJC A;  1PY1 A;  5AQB A;  1SA5 A;  3CVL A;  4JW1 A;  1HG2 A;  2AXV A;  4ACL A;  2NC9 A;  2PQN A;  3HXC A;  3FUI A;  4MBG A;  3E30 A;  3KMT A;  4QQI A;  3J5P A;  2XEE A;  3O4Z A;  4G25 A;  4FMU A;  3LJN A;  3EIJ A;  4NQ0 A;  4UUC A;  3DSX A;  5JJT A;  2CHX A;  2EIM E;  3R9A B;  3MKQ A;  1JUQ A;  1BI7 B;  3PUJ A;  3FP3 A;  3GZS A;  3CVU A;  2G46 A;  4QEP A;  2V0P A;  3FWV A;  3FUF A;  4F1P A;  3MX3 A;  1HU3 A;  5E75 A;  2KM4 A;  3BQO A;  3C72 A;  4YDY A;  3V30 A;  3FY4 A;  4CGW A;  4JVS A;  1OUV A;  4RLY A;  1DC2 A;  1UW4 B;  4GCO A;  2CG2 A;  2WQH A;  2VGE A;  4YNM A;  5JIN A;  1N4S A;  4YDW A;  1DCQ A;  3T8M A;  2XGM A;  3RK6 A;  3UKR G;  3L17 A;  2Y3A A;  3TWW A;  4H7Y A;  1H2V C;  3CVW A;  2IGQ A;  3BU8 A;  2RKK A;  2KCL A;  2PL2 A;  2EIJ E;  1SQM A;  3SGH A;  5M72 A;  3TJP A;  5EYL A;  2WXM A;  3M54 A;  3OPE A;  2YQ8 A;  4AXH A;  1H6O A;  2IFU A;  4UQY A;  5AJL A;  1FPP A;  1OCO E;  2A4Z A;  2QYU A;  4GYY A;  4TUM A;  3SW9 A;  3CST A;  2Y4U A;  2F37 A;  1L5J A;  3VLE A;  3MO2 A;  1JCQ A;  5D2M C;  1BPO A;  3ZXP A;  4G8K A;  3EHN A;  2MRI A;  5TH7 A;  2CFU A;  1OWN A;  3MYV A;  5AAO A;  3IV0 A;  1FCH A;  1BU9 A;  3KAE A;  3SBT B;  1Y8M A;  3T5V A;  1N0R A;  4V3I A;  2WXK A;  3ZHE A;  4BSX A;  2P9L G;  5FIO A;  4N2S A;  3F9X A;  3B7B A;  4GYO A;  4XEI G;  2IQC A;  3APD A;  4JPS A;  5KNH D;  3CEQ A;  3SD5 A;  5ENQ D;  5ENN A;  3RQ4 A;  4N3C A;  3CIA A;  2QPW A;  3UQ3 A;  4HLL A;  4PDX A;  2C0L A;  2J9Q A;  2R05 A;  4B8A A;  3JCK C;  2LXM A;  3ZN3 A;  3CQC B;  5KJL A;  4YDO A;  4BT9 A;  3JUI A;  3HHM A;  3D9O A;  5G04 J;  3D3M A;  4AU7 A;  3WXX A;  1WM5 A;  2FBN A;  2L6J A;  5LFA A;  1HXI A;  5ENT D;  1E8W A;  2ETA A;  1WG0 A;  2J08 A;  1MYO A;  3HXB A;  5TTF A;  3DPD A;  3IEG A;  1NA3 A;  1OCR E;  1W3B A;  1H2T C;  4GTS A;  3VLD A;  4YVQ C;  2XCC A;  5D0O D;  2ETB A;  3S8P A;  3U9W A;  2ION A;  5F6K C;  4PS8 A;  2GW1 A;  3OS5 A;  3PNT B;  4HOS A;  3WG7 E;  1KT1 A;  1U3D A;  2MOW A;  4GA1 A;  4CT0 A;  3TWQ A;  4HOQ A;  1H2U A;  4FA6 A;  4LG6 A;  1MJ0 A;  2H6G A;  4BET A;  5BNW A;  3S7B A;  4GMR A;  3HXF A;  5HI7 A;  4EBA G;  2VSY A;  3P1U A;  1SZA A;  3ONK A;  3NF1 A;  4ATZ D;  1ZKK A;  4G8L A;  2I2O A;  5BXO A;  2EIK E;  4I6E A;  3ZYM A;  3BUA A;  1N0Q A;  1A5E A;  4KT6 B;  1N6C A;  3IHV A;  4EEC A;  3PUK A;  4UWG A;  3FU0 A;  3LDZ A;  2RFI A;  4N5C A;  4UI9 C;  3QNK A;  4QFV A;  3CKC A;  4URK A;  3NZU A;  4YND A;  4NJ5 A;  1FT2 A;  2B0O E;  1TN8 A;  1HS6 A;  2ZU6 B;  5AYW D;  5CED B;  2F8X K;  2AWI A;  4APF A;  3EHR A;  2J4D A;  3HDX A;  3B13 A;  2WM9 A;  2HO1 A;  5LX8 A;  3V79 K;  3S7F A;  2MHK A;  3CQG B;  3DWL G;  1TNO A;  3HG0 D;  4LDG A;  5HRY A;  2CHW A;  4M7C A;  5FQ4 A;  2W5Y A;  2X6I A;  1JCS A;  2E0I A;  3ISM C;  4L2L A;  4B8C B;  2NYJ A;  4LER A;  4JEH A;  3DPY A;  5AQA A;  3HVE B;  5T0K A;  4HS2 A;  3FTX A;  1AWC B;  5EDS A;  4ME2 A;  1RZ4 A;  2IOS A;  5BV0 A;  4C0E A;  4F3V A;  4AVX A;  1IQR A;  4CT4 A;  2R3A A;  4HOU A;  4L1B A;  3UXG A;  3Q75 A;  3O48 A;  4CRW A;  3TG4 A;  4DJA A;  3UPV A;  3VV0 A;  3EP0 A;  4C9B B;  1QNF A;  2V4H C;  1NP7 A;  4GTP A;  2XCB A;  1N4Q A;  4I1O B;  1WY6 A;  3VTY A;  3FPD A;  3TXM A;  4G23 A;  3DB5 A;  4YPE A;  2DZO A;  3FUN A;  5ANL A;  2KC7 A;  4ATG A;  4U8H A;  4N2Q A;  3VTX A;  3S2A A;  4GB9 A;  3AS4 A;  1SA4 A;  3RJW A;  1UN9 A;  3RKV A;  4AP2 A;  4I6G A;  3QWW A;  4C0M A;  3QJZ A;  5F5E A;  5J08 A;  4E6H A;  3L6A A;  1OWO A;  4L9P A;  5T5G A;  3IXE A;  3L16 A;  4Q96 A;  5G04 C;  4YVO A;  4GTT A;  2J49 A;  2KXP C;  3Q78 A;  2HE0 A;  1SW6 A;  4MS6 A;  3ASH A;  1XQH A;  3PEV B;  3DSS A;  4IJ8 A;  4LCT A;  3S7J A;  3B7S A;  1K8K G;  4L2Y A;  4HRN A;  4RZ0 A;  1KZO A;  3G2S A;  2RG8 A;  3AG1 E;  4AY5 A;  3M57 A;  4DI3 A;  4BT8 A;  2JLB A;  5AEN A;  1OCC E;  3QDN A;  2XEV A;  3EUV A;  3ZIM A;  4P29 A;  3RJV A;  3R7Q A;  3FU3 A;  4EZJ A;  5TEG A;  2GRN B;  3UX4 A;  4XX5 A;  5CBN A;  3SFY A;  3KMA A;  3G2T A;  4CDM A;  4JEU A;  2XPY A;  3ABM E;  4DUI A;  3ZXS A;  4LNB A;  4G2V A;  3QOU A;  4FHJ A;  5AQ9 A;  1KPS B;  1TYQ G;  2B6C A;  5AJD A;  5EID A;  5T4Y A;  3LVR E;  4F7A A;  3CGH A;  3DEP A;  4EQF A;  4RSY A;  3RO2 A;  3HXE A;  4WUY A;  2GRP B;  2XPI A;  3TWR A;  4G26 A;  4K5A B;  3D9K A;  2F0Y A;  4J8S A;  5ITZ F;  1EPU A;  3DSW A;  3ML8 A;  4XZ4 A;  3CK8 A;  4H12 A;  2Y1L E;  4ANV A;  1TR4 A;  2BKG A;  2LAI A;  2Y69 E;  2WXN A;  3ESL A;  2ZIS A;  3D9L A;  3PS6 A;  4C1Q A;  4NUR A;  3FUE A;  2AXZ A;  3KD7 A;  5EX0 A;  2VSO E;  3FU6 A;  3T8K A;  4AOF A;  3E37 A;  2W5Z A;  4N3A A;  4TUU A;  4CGV A;  4J8E A;  4ILG A;  3JUE A;  4ANW A;  4F6R D;  4ABN A;  4QEO A;  1ELW A;  3LVQ E;  3TG5 A;  4FP7 A;  3PEU B;  1TEZ A;  2R03 A;  4FLB A;  5KWD A;  1E8Y A;  3SFX A;  1E8Z A;  3MV2 B;  3CK9 A;  3L9T A;  3L08 A;  2M63 A;  1N9A A;  3SI5 A;  3Q7A A;  3SZ7 A;  1E96 B;  2WQ7 A;  4YNP A;  4A63 B;  3G2V A;  2P2C P;  3LYA A;  3ENE A;  2P9S G;  3DBS A;  4JA9 A;  4HRL A;  2A5E A;  2XEN A;  3DRA A;  4O1O A;  1D9S A;  2PM7 A;  4UI9 J;  2YIN A;  4J0U A;  3PE4 A;  3Q9N C;  4DRX E;  2XRZ A;  1X5B A;  3AG3 E;  4DPR A;  1UOH A;  5F59 A;  3ZRH A;  3ABL E;  3ZHE B;  4AY6 A;  3LY8 A;  1S70 B;  3MA5 A;  4I17 A;  4K5B A;  3PVL A;  2X6K A;  2C2L A;  3PDN A;  1JWF A;  4GU5 A;  1Y6I A;  2AVP A;  1A17 A;  4EPZ A;  5AQ7 A;  3FUH A;  2H6I A;  4BWR A;  2DCP A;  2IOL A;  4GPK A;  5KJM A;  2C0M A;  4Q94 A;  2NXP A;  4MRU A;  1ZBP A;  1N95 A;  2UWJ G;  4EZK A;  4ZHB A;  4YPU A;  4RG9 A;  2V5F A;  4ILI A;  3SHF A;  3QB2 A;  1XNF A;  4M3O A;  4IYP A;  4EHM A;  2KAT A;  3ZYQ A;  2HYZ A;  3I5P A;  3LJ3 A;  4GTQ A;  1BLX B;  4GCN A;  1LF8 A;  2IO2 C;  5CRV A;  3MO0 A;  4JA7 A;  1N4R A;  2XGS A;  1MX6 A;  5BPP A;  2CG3 A;  2XQ0 A;  4F1S A;  5EIL A;  3D9N A;  3ZGQ A;  3M55 A;  1TNU A;  2R59 A;  1K1A A;  4RVB A;  3M56 A;  3TAX A;  3RSE G;  1PC2 A;  4I9C A;  3B95 A;  4HB5 A;  5FJY A;  2XS8 A;  3I3N A;  4G11 A;  3C3O A;  3E33 A;  2Y0B G;  4CCA A;  1NL4 A;  1KZP A;  3E32 A;  5IY5 E;  1TNB A;  1OWP A;  1Z3X A;  2VGX A;  4A1G A;  4TV3 A;  2EIL E;  2WMN A;  5JHA A;  4Y6C A;  4E47 A;  2VJ8 A;  1IHG A;  4GZD A;  3QAR A;  1EDU A;  3OXF A;  3Q47 B;  5LP0 A;  4K5C A;  3MKQ B;  4A3T A;  3G2U A;  2RFA A;  1N52 A;  3CBO A;  2J09 A;  2VSX E;  1O1T A;  5ANR A;  4CZ2 D;  3PE3 A;  5LSX A;  3RAU A;  1IKN D;  5A7D B;  2PM6 A;  1K1B A;  2ZIR A;  5CHE E;  3M53 A;  3UM3 A;  2OEW A;  1UJK A;  3P2B A;  2LO6 A;  3CVY A;  3ULY A;  4G24 A;  4I2W A;  3UM0 A;  3OOI A;  5EG2 A;  5HS0 A;  3CVP A;  1Z3Y A;  4I2Z A;  5C2Y A;  4GAA A;  3SFZ A;  5JJ7 A;  1NA0 A;  2OOE A;  4ACK A;  1E8X A;  5EYP F;  2DVW A;  3R9M A;  4BX8 A;  4X8Q A;  4J83 A;  2BKK B;  3DEO A;  5FIN A;  1HE8 A;  4U8Y D;  5CEC B;  2E2E A;  4FLH A;  4WWO A;  3NZS A;  5EN5 D;  5HKP A;  5BV1 A;  2IY0 C;  5BUZ A;  3TWX A;  3DAL A;  4FJZ A;  4I1A A;  2DWZ A;  1EF1 C;  4XI0 A;  3URZ A;  5G2N A;  2IJG X;  4J8F A;  3UM2 A;  2QFC A;  3EJN A;  1MT6 A;  1E7V A;  4ILH B;  4RG6 A;  5LSZ A;  2J8S D;  4UWK A;  3CV0 A;  3D9H A;  4HOR A;  4FUL A;  3NBN B;  3I4R B;  5BW8 C;  3UKU G;  4BX9 A;  4Z4P A;  4KYO B;  2XEH A;  3ZU7 B;  4OAV B;  4JHJ A;  3DST A;  3ZUV B;  3G2W A;  3Q73 A;  4Z68 A;  2CFZ A;  4UQX A;  4GA0 A;  5FQ7 A;  2WXR A;  2IEJ A;  2JEK A;  3M58 A;  4F53 A;  3FUD A;  5ENP D;  4L23 A;  3AS8 A;  1B89 A;  3HVE A;  1MVX A;  4BEP A;  2IU1 A;  2KBX A;  2ZXW E;  1ELR A;  4CDR A;  3UT8 A;  4KMO A;  4GPM A;  2BED A;  3F9W A;  5G05 C;  3TWT A;  3UUX A;  4KZC A;  3OTN A;  4U0S A;  3KMJ A;  3NB2 A;  5JMN D;  3TWS A;  4IRU A;  4O30 A;  5LOZ A;  1N11 A;  1OY3 D;  5T8I A;  2WQ6 A;  1WAO 1;  3LXU X;  4APO A;  2L6B A;  2BF0 X;  5CRU A;  4MI0 A;  2I9C A;  3FEX A;  3JQ0 A;  3OXG A;  4WWN A;  2VGY A;  4GMJ A;  5B3S E;  3KSQ A;  4WAF A;  1JPL A;  4A55 A;  3CSF A;  4WNE A;  5FT9 A;  3RRM B;  5EX3 A;  3EHQ A;  4JHK A;  1QQE A;  3X2Q E;  3JXJ A;  3D9M A;  3FU5 A;  4HI8 A;  3UIN C;  1D8E A;  2R02 A;  3CHO A;  3E4B A;  5B1B E;  4XE0 A;  1PEG A;  3FH5 A;  2BQZ A;  4JD2 G;  3QAQ A;  4UWL A;  2FI7 A;  4FAD A;  1XGW A;  5DBK A;  4DLO A;  4J7F A;  5CMY A;  2ZGG A;  1O5M A;  3PZ3 A;  4HFG A;  3SBS A;  3PZD A;  3FTU A; 
#chains in the Genus database with same CATH homology
 2LAI A;  1Y8M A;  1S0P A;  2R17 C;  2WXJ A;  3T5V A;  5JHN A;  2WXN A;  4HVB A;  4V3I A;  2WXK A;  5DIZ A;  3ESL A;  3ZHE A;  2UY1 B;  4BSX A;  3L54 A;  4U04 A;  3D9L A;  3PS6 A;  4N2S A;  5F6L A;  4C1Q A;  4GYO A;  4NUR A;  3F9X A;  3FUE A;  3FEY A;  2AXZ A;  5CPR B;  2IQC A;  3B7U X;  1PAQ A;  3KD7 A;  5EX0 A;  1HG5 A;  1HH8 A;  2VSO E;  3FU6 A;  5CMW A;  3APD A;  4JPS A;  4AOF A;  3CEQ A;  3SD5 A;  3B7R L;  2FUL A;  5KJK A;  2W5Z A;  1UG3 A;  4XKC A;  5AIJ A;  5ENN A;  3RQ4 A;  2LSV A;  3HIZ A;  4N3C A;  4N3A A;  4TUU A;  4CGV A;  4J8E A;  4ILG A;  4FJY A;  3PNL B;  3CIA A;  4U63 A;  2QPW A;  4ANW A;  1H19 A;  3UQ3 A;  3PH0 C;  4ABN A;  4GA2 A;  2ILR A;  4GZ6 A;  1OWM A;  2C0L A;  4PDX A;  2J9Q A;  4I51 A;  1ELW A;  2X6J A;  5FQ6 A;  4U07 A;  4B8A A;  4J8O A;  4WNG A;  3JCK C;  4QEO A;  3LVQ E;  4Q69 A;  3TG5 A;  2XRY A;  5CCM A;  3ZN3 A;  5AYF A;  3KEZ A;  3VUZ A;  5JJ6 A;  1KT0 A;  4FP7 A;  3CQC B;  4XKB A;  5KJL A;  3PEU B;  4BT9 A;  1H0A A;  1TEZ A;  5LSZ A;  3JUI A;  3HHM A;  3B7T A;  4FLB A;  1VDY A;  3FUJ A;  4PS7 A;  3D9O A;  2YHE A;  3CVX A;  1E8Y A;  5G04 J;  3D3M A;  1E8Z A;  4AU7 A;  3WXX A;  1WM5 A;  2FBN A;  3MV2 B;  4I6J A;  4CDN A;  1UJJ A;  2L6J A;  4D10 C;  5LFA A;  1MUF A;  1OWL A;  1HXI A;  2A5U A;  3CK9 A;  3FHE A;  3GW4 A;  3U66 A;  3MGB A;  4J7I A;  4B89 A;  2Y4T A;  3CHP A;  5FZS A;  5J90 A;  3L08 A;  4XIF A;  1E8W A;  1HX8 A;  3M5A A;  2M63 A;  2J08 A;  2PQR A;  2VYI A;  3SI5 A;  5FZR A;  3SZ7 A;  5TTF A;  1E96 B;  2WQ7 A;  3RIB A;  4YNP A;  2DIW A;  3GZ2 A;  3G2V A;  4UWH A;  4BTB A;  4EBA A;  4WNF A;  3DPD A;  3IEG A;  3LYA A;  3ENE A;  1NA3 A;  3DBS A;  1W3B A;  3MJW A;  4JA9 A;  1H2T C;  3D9J A;  2WXP A;  3VLD A;  2GGF A;  3IKO B;  2XCC A;  2EQX A;  5D0O D;  4YVQ C;  4AJW A;  2F69 A;  4UQZ A;  3ESK A;  3S8P A;  3LEW A;  4LEU A;  3JYS A;  2PM7 A;  4UI9 J;  4OVU A;  3F9Y A;  2YIN A;  3L22 A;  4J0U A;  2LNI A;  3U9W A;  3PE4 A;  4ANX A;  2XRZ A;  1X5B A;  2ION A;  3PRE A;  4GZC A;  4PS8 A;  5F6K C;  2GW1 A;  4DPR A;  2KZT A;  3OS5 A;  4FHK A;  3PNT B;  4HOS A;  4IJD A;  1KT1 A;  1U3D A;  2MOW A;  2WXH A;  4FC8 A;  5G05 J;  4GA1 A;  4ANU A;  4CT0 A;  3R7R A;  5F59 A;  2XGO A;  3ZRH A;  3ZHE B;  4AY6 A;  3LY8 A;  3MA5 A;  4I17 A;  2WXF A;  5LCW C;  4HOQ A;  3PVL A;  2X6K A;  2C2L A;  5T0M A;  1H2U A;  5ARG A;  4A3V A;  4FA6 A;  3LY9 A;  3PDN A;  1JWF A;  4GU5 A;  2WVI A;  1Y6I A;  3GYZ A;  2AVP A;  1A17 A;  4KVO A;  4UI9 K;  4EPZ A;  5BNW A;  3S7B A;  3FUH A;  2X38 A;  5HI7 A;  4EBA G;  2WXG A;  3RRN B;  2VSY A;  4BWR A;  2DCP A;  3P1U A;  2IOL A;  1IQU A;  2LSU A;  3ZYK A;  5KJM A;  4GPK A;  1U3C A;  2AXU A;  1ELK A;  2C0M A;  3ONL A;  1N3J A;  4AEZ C;  3AU5 A;  5E76 A;  5EKQ D;  4Q94 A;  2NXP A;  3FUK A;  4LUN U;  4MRU A;  4DK5 A;  1SZA A;  1ZBP A;  3ONK A;  2UWJ G;  4CEM A;  4EZK A;  4YPU A;  2WXL A;  3NF1 A;  4RG9 A;  2V5F A;  4ILI A;  3T5X A;  3SHF A;  3ZPJ A;  3QB2 A;  1ZKK A;  1XNF A;  3JQ1 A;  4GML A;  4M3O A;  1E7U A;  3UT7 A;  2BTD A;  2WB2 A;  4IYP A;  4OYS A;  2KAT A;  3ZYQ A;  2HYZ A;  2XPZ A;  2I2O A;  3I5P A;  3LJ3 A;  4O6F A;  4MKT A;  5KJN A;  4I6E A;  2X6F A;  4GCN A;  2L0T B;  1LF8 A;  4MLP A;  3MZL B;  3OAW A;  3ZYM A;  4MI5 A;  3NQP A;  2BUG A;  2X3M A;  3RRU A;  4IUL A;  4A1S A;  3ZYL A;  4KT6 B;  3Q5M A;  3MO0 A;  3ZW3 A;  1N6C A;  3IHV A;  4EEC A;  3PUK A;  4JZY A;  3FU0 A;  4UWG A;  3CVN A;  3LDZ A;  4I1M A;  4JA7 A;  3QWP A;  2RFI A;  4Y6W A;  3APC A;  2XGS A;  2CHZ A;  4N5C A;  3RU0 A;  5BPP A;  3SWC A;  2CG3 A;  2YHC A;  4UI9 C;  2XQ0 A;  3QNK A;  1UN8 A;  4U0Z A;  3AS5 A;  4QFV A;  4BTA A;  3CKC A;  1H3I A;  4URK A;  4F1S A;  1O9S A;  3NZU A;  3D9N A;  4NRH B;  4YND A;  1SZ9 A;  3ZGQ A;  4NJ5 A;  3TL5 A;  4I9E A;  3M55 A;  3GZ1 A;  2R59 A;  1HZ4 A;  3QWV A;  4RVB A;  1HS6 A;  2ZU6 B;  3M56 A;  5AYW D;  3LCA A;  3TAX A;  2AWI A;  3CR3 A;  4APF A;  3FTW A;  2AW6 A;  3I4G A;  4OVV A;  3CVQ A;  4JLG A;  3FH8 A;  1PC2 A;  2J4D A;  1HF8 A;  2L9B A;  3HDX A;  4I9C A;  1JWG A;  3BO5 A;  3B13 A;  4PUC A;  5FJY A;  4K03 A;  4I43 A;  2WM9 A;  2V8S E;  3L13 A;  2HO1 A;  4U0U A;  5LX8 A;  3I3N A;  4G11 A;  4FU3 A;  3S7F A;  2MHK A;  4AM9 A;  3CQG B;  3K5K A;  3APF A;  4CCA A;  4LDG A;  3IBE A;  2CHW A;  3U3W A;  1OWP A;  1Z3X A;  2VGX A;  3FFL A;  3FUM A;  1GW6 A;  5FQ4 A;  3IHY A;  2FEZ A;  4A1G A;  5BT1 A;  2O8J A;  4NVQ A;  4L7T A;  4TV3 A;  2WMN A;  5JHA A;  4KZ0 A;  3MCX A;  3FTZ A;  2J4B A;  3K9I A;  4Y6C A;  4HOT A;  2X6I A;  2W5Y A;  4E47 A;  2VJ8 A;  1IHG A;  4GZD A;  3CBM A;  3QAR A;  2E0I A;  3Q49 B;  3N71 A;  1EDU A;  3LKU A;  3OXF A;  3Q47 B;  3AU4 A;  5LP0 A;  4L2L A;  4B8C B;  3MKQ B;  4E85 A;  4A3T A;  3G2U A;  4LER A;  3RO3 A;  4KVM A;  3HNA A;  5FWQ A;  3VLF A;  1N52 A;  4JEH A;  2KCV A;  2J09 A;  2VSX E;  3CBO A;  5ANR A;  3HVE B;  5T0K A;  4HS2 A;  4K0R A;  3FTX A;  5EDS A;  4ME2 A;  4QEN A;  3M59 A;  2V4L A;  3PE3 A;  5LSX A;  2IOS A;  5BV0 A;  4B94 A;  5A7D B;  3EDT B;  2XHE A;  4AIF A;  5JIY A;  2PM6 A;  4C0E A;  2R5S A;  3ASF A;  4PH4 B;  4F3V A;  4AVX A;  1IQR A;  3RAY A;  2DBA A;  5CHE E;  3M53 A;  4CT4 A;  1Z6T A;  1UJK A;  3P2B A;  2R3A A;  3D9P A;  4HOU A;  1ML9 A;  4L1B A;  2LO6 A;  3ASD A;  3ASG A;  4NAC A;  3CVY A;  4G24 A;  4I2W A;  4B0Z A;  3MO5 A;  2JV0 A;  3O48 A;  4JHR A;  3OOI A;  2GRM A;  3SF4 A;  1H6K A;  4BY6 A;  4CRW A;  5EG2 A;  3TG4 A;  3CVP A;  2WPV A;  1Z3Y A;  4I2Z A;  5C2Y A;  4DJA A;  3UPV A;  3VV0 A;  4GAA A;  3SFZ A;  3D9I A;  5JJ7 A;  3CVV A;  3F9Z A;  1NA0 A;  1NZN A;  2OOE A;  4BFR A;  4ACK A;  1E8X A;  3ZEF A;  5JJ0 A;  3EP0 A;  4C9B B;  1IYG A;  1QNF A;  4BX8 A;  1NP7 A;  3U4T A;  4J83 A;  4JL0 A;  4JDS A;  3CK7 A;  4BUP A;  2XCB A;  3ULQ A;  1FVH A;  2P58 C;  3LPZ A;  5LCW J;  1HE8 A;  2UY1 A;  4I1O B;  3EHM A;  4GZ3 A;  1WY6 A;  2E2E A;  3FTV A;  2LAH A;  4FLH A;  3VTY A;  4WWO A;  3NZS A;  4UWF A;  3U64 A;  2FO7 A;  4LRZ A;  5BV1 A;  5BUZ A;  3FPD A;  3TXM A;  4FJZ A;  1EYH A;  3Q4A B;  3DAL A;  4G23 A;  4I1A A;  4PS3 A;  3DB5 A;  4YPE A;  3LY7 A;  2HR2 A;  1EF1 C;  4XI0 A;  3URZ A;  5G2N A;  3QK0 A;  5A6C A;  3FUN A;  1HO8 A;  2IJG X;  4J8F A;  5ANL A;  4DLQ A;  2KC7 A;  2QFC A;  4ATG A;  3CHS A;  3CKB A;  3EJN A;  4U8H A;  1E7V A;  5C1D A;  3FTY A;  1MQS A;  1MHQ A;  4ILH B;  4RG6 A;  3CHR A;  5ARF A;  4N2Q A;  4YPA A;  2GRL A;  3FTS A;  3MKR A;  2Q7F A;  3VTX A;  5T3R A;  3UMV A;  4UWK A;  3CHQ A;  3CV0 A;  1HFA A;  2OV8 A;  1N54 A;  3C98 A;  3S2A A;  2I6H A;  2I1K A;  3AS4 A;  4GB9 A;  3RJW A;  1KLX A;  4HOR A;  4FUL A;  4H7X A;  3I4R B;  1UN9 A;  4W9R A;  5FZQ A;  2HM8 A;  5BW8 C;  1N6A A;  2OND A;  4BX9 A;  4Z4P A;  4KYO B;  3RKV A;  4KXK B;  4AP2 A;  4I6G A;  1E90 A;  3PRZ A;  1FVF A;  2NSZ A;  3QWW A;  4C0M A;  3QJZ A;  1INZ A;  5F5E A;  3CHM A;  3UT4 A;  5J08 A;  3TXN A;  4JXT A;  3L6A A;  4E6H A;  2VTB B;  4JHJ A;  4DI4 A;  3MV3 B;  5G55 A;  1OWO A;  3MEK A;  1YA0 A;  3G2W A;  4KBQ A;  1TJC A;  1MT6 A;  2CFZ A;  1PY1 A;  4UQX A;  4GA0 A;  5T5G A;  3CVL A;  4JW1 A;  2VGX B;  3L16 A;  1HG2 A;  2X6H A;  4AV7 A;  5FQ7 A;  2AXV A;  4ACL A;  2NC9 A;  2PQN A;  3FUI A;  3FDH A;  4Q96 A;  3KMT A;  5G04 C;  2WXR A;  3O4Z A;  2JEK A;  4G25 A;  4YVO A;  4FMU A;  2J49 A;  3EIJ A;  4NQ0 A;  3CLJ A;  3M58 A;  4F53 A;  5JJT A;  4MS6 A;  3LS8 A;  2FF4 A;  2CHX A;  3ASH A;  3FUD A;  4L23 A;  1XQH A;  3PEV B;  4IJ8 A;  4IN3 B;  3R9A B;  3MKQ A;  4LCT A;  1JUQ A;  3AS8 A;  3ZFW A;  2WXO A;  3PUJ A;  3FUL A;  3S7J A;  3B7S A;  3FP3 A;  3GZS A;  4L2Y A;  3CVU A;  2G46 A;  4QEP A;  1B89 A;  3HVE A;  5A23 A;  4RZ0 A;  2IF4 A;  2V0P A;  2KZT B;  3FWV A;  1TJF A;  3G2S A;  3FUF A;  2RG8 A;  1MVX A;  1QZ2 A;  2IU1 A;  1P5Q A;  3MX3 A;  3Q15 A;  1HU3 A;  3ML9 A;  5E75 A;  4AY5 A;  3M57 A;  2KM4 A;  2WMO A;  1MVH A;  4DI3 A;  4BT8 A;  1ELR A;  3FY4 A;  4CGW A;  4CDR A;  4JVS A;  2JLB A;  2VSN A;  3UT8 A;  5AEN A;  1OUV A;  4KMO A;  1UW4 B;  4G1T A;  4GCO A;  3CBP A;  4TRQ A;  3F9W A;  2CG2 A;  2WQH A;  1ZU2 A;  3QDN A;  5G05 C;  3UUX A;  3QC1 A;  2XEV A;  4KZC A;  3OTN A;  4YNM A;  5JIN A;  3ZIM A;  4P29 A;  4U0S A;  5FQ8 A;  3KMJ A;  2OVF A;  3BG1 B;  3RJV A;  3R7Q A;  3HYM B;  3IHX A;  3FU3 A;  2PZI A;  3T8M A;  4EZJ A;  4IRU A;  5TEG A;  4O30 A;  3UX4 A;  4XX5 A;  5LOZ A;  2WXQ A;  2XGM A;  3S7D A;  4JC8 A;  3RK6 A;  4N3B A;  3KMA A;  4WWP A;  3G2T A;  5T8I A;  3L17 A;  1WAO 1;  2WQ6 A;  4CDM A;  4JEU A;  2XPY A;  2Y3A A;  3LXU X;  4APO A;  3ZXS A;  4H7Y A;  2BF0 X;  4MI0 A;  2I9C A;  4G2V A;  5FTP A;  3QOU A;  3FEX A;  1H2V C;  4FHJ A;  3CVW A;  2IGQ A;  1DNP A;  3JQ0 A;  3OXG A;  4WWN A;  3OXL A;  2WXI A;  5AJD A;  2J07 A;  5T4Y A;  2VGY A;  4GMJ A;  2KCL A;  2PL2 A;  3LVR E;  4WAF A;  3SNX A;  1JPL A;  1SQM A;  3BEE A;  4R7L A;  3SGH A;  4A55 A;  4F7A A;  2VTB A;  3CSF A;  4WNE A;  5FT9 A;  3CGH A;  4J8D A;  4EQF A;  3RRM B;  5M72 A;  4RSY A;  3TJP A;  5JHB A;  2WXM A;  2OVB A;  5EX3 A;  3M54 A;  3OPE A;  3RO2 A;  2VQ2 A;  4WUY A;  2YQ8 A;  4JHK A;  4AXH A;  2L0I A;  3BG0 B;  4WND A;  2IFU A;  5KCM A;  1QQE A;  4UQY A;  3EIQ C;  5D0Q D;  2A4Z A;  5AJL A;  3D9M A;  3FU5 A;  4EZL A;  4HXI A;  4GYY A;  4J6I A;  2I1J A;  3CHO A;  2XPI A;  1DVP A;  3CST A;  2Y4U A;  3E4B A;  3SW9 A;  4N39 A;  4XE0 A;  2YNQ A;  1L5J A;  4G26 A;  3VLE A;  3D9K A;  3TGO A;  3FH5 A;  1PEG A;  3MO2 A;  1BPO A;  3FH7 A;  4J8S A;  4XI9 A;  2BQZ A;  1EPU A;  3EHN A;  3QKY A;  3KS2 A;  3ML8 A;  4XZ4 A;  4GYW A;  3ZVV A;  3QAQ A;  2RD0 A;  4UWL A;  2FI7 A;  4FAD A;  1XGW A;  2MRI A;  4GZ5 A;  5DBK A;  5TH7 A;  4DLO A;  5HQ8 A;  4HLE A;  2CFU A;  4J7F A;  5CMY A;  1OWN A;  3CK8 A;  2KCK A;  3MYV A;  4H12 A;  4HFG A;  3IV0 A;  4ANV A;  1FCH A;  2QY7 A;  3SBS A;  5CCL A;  3KAE A;  3PZD A;  3SBT B;  3FTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...