3S7FA

Structural basis of substrate methylation and inhibition of smyd2
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
429
structure length
429
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Structural Basis of Substrate Methylation and Inhibition of SMYD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 152
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3s7fA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s7fA01
5JJ0A 2XGSA 5DIZA 3MO2A 4EQFA 3ULQA 5JHNA 5FTPA 4ME2A 4J8OA 4UQYA 4UI9C 3SW9A 3TG5A 5F5EA 4I2WA 4AY5A 3S7JA 2KCLA 2XEVA 1IHGA 3QWWA 4CGWA 4LDGA 5CHEE 4YNPA 3E4BA 3GW4A 3MO5A 1QZ2A 5LSZA 2AVPA 1ML9A 3KMJA 3CK7A 1OUVA 3LY8A 5KJMA 4WUYA 2HYZA 4BTAA 4HOSA 4I9CA 3CVNA 4G1TA 1HH8A 3AS8A 2F69A 3VUZA 2YHCA 2KC7A 4H7YA 4XI0A 1XQHA 2FEZA 3S8PA 3CK9A 2FF4A 1QQEA 2VSYA 4GCNA 3CVPA 4MI0A 3U3WA 4N2SA 5EKQD 4G24A 2KCKA 3TGOA 5T0KA 3AS4A 5EX0A 2VGYA 2XPIA 5C1DA 2UWJG 1W3BA 4JA7A 4WNEA 3RQ4A 3IEGA 4GYWA 4NJ5A 4GA2A 4UQXA 4CGVA 3VTYA 3M57A 3EDTB 3FPDA 2FO7A 2J9QA 4WNGA 5FT9A 3TG4A 4GZ6A 3RO3A 3RKVA 3MO0A 3BEEA 4KYOB 2XGOA 3MEKA 3R9AB 4LEUA 3CV0A 4CDRA 5F59A 3ZHEA 4IN3B 4U0SA 2JLBA 5AYFA 3Q47B 1E96B 2E2EA 5TEGA 4WNFA 3OOIA 4KXKB 5BW8C 3CVQA 2LSUA 3BO5A 2BUGA 3GZ1A 4RG9A 2QFCA 3ASDA 1B89A 3CBMA 1PEGA 3EP0A 5F6LA 1YA0A 3ASHA 2C0LA 4RG6A 5TH7A 3QKYA 3NF1A 2Y4TA 2WPVA 2IFUA 3LPZA 3VTXA 3QWVA 3F9XA 4G23A 3GYZA 3Q4AB 1N6AA 3N71A 3QWPA 2PQNA 3RIBA 5BNWA 4APOA 3M53A 3AS5A 4J8DA 4J8FA 4UI9K 2IGQA 4YPEA 2Q7FA 3GZ2A 2VQ2A 5DBKA 3JYSA 4BWRA 2VGXB 2OOEA 2L6JA 5HI7A 4I2ZA 3RU0A 5D0OD 3KS2A 3MV3B 4U07A 4YNMA 3RO2A 4GA0A 4GZ5A 2WQHA 4YPUA 1O9SA 4J7FA 4E47A 3QDNA 1KT0A 2C2LA 2HR2A 5LSXA 4AM9A 5ARFA 4J7IA 1HXIA 4J8EA 3RJVA 3CBOA 4B94A 5G05J 3F9YA 3RAYA 3ASFA 5ARGA 4JHRA 2C0MA 2FBNA 4YPAA 5HQ8A 4H7XA 4F3VA 4WNDA 3TAXA 3Q5MA 4A1SA 3ZN3A 3OXFA 3FP3A 5JJ7A 1HZ4A 5G04C 3PE3A 4KBQA 3M59A 5BT1A 4NQ0A 4J0UA 4HORA 2GW1A 3O48A 3K9IA 4AY6A 2UY1B 3FFLA 3MV2B 2PL2A 4J83A 1N3JA 4HOUA 4I17A 4N5CA 1XNFA 4HOQA 4RZ0A 4QEPA 4I51A 4JA9A 3MKRA 3Q49B 4YVQC 3FWVA 5TTFA 3LKUA 4U0ZA 4G25A 3M5AA 4BUPA 4GCOA 5LCWJ 5T0MA 3LCAA 5KJLA 4N3BA 3CBPA 2LSVA 3MA5A 4GZ3A 5JINA 2IF4A 2JV0A 5A7DB 3KAEA 4Y6WA 4QENA 1ELRA 4G2VA 3UPVA 4YNDA 1FCHA 5EX3A 1A17A 2KCVA 3ZFWA 4NRHB 2W5ZA 1ZBPA 1WAO1 2RFIA 5JIYA 5T5GA 2LNIA 3DB5A 1ELWA 4O30A 3ZHEB 2YQ8A 2G46A 4N3CA 5EG2A 3OXGA 1ZKKA 4I9EA 3LY7A 3QOUA 4GA1A 3CVLA 1P5QA 2Y4UA 3PE4A 3UQ3A 4GPKA 1NZNA 3ZGQA 3S7FA 3K5KA 4UI9J 3OPEA 3CK8A 4GYOA 4U04A 5FJYA 3RJWA 3ZPJA 2UY1A 5D0QD 4W9RA 4N39A 5G05C 5FZSA 2KATA 3URZA 2PQRA 2I6HA 5KJKA 3ESKA 3OS5A 4YVOA 3KMTA 3PDNA 1MT6A 5FZQA 1Y8MA 1TJCA 1MUFA 2W5YA 1ZU2A 4UQZA 3LYAA 2ONDA 5JJ6A 5F6KC 1NA3A 4XIFA 4C1QA 3S7BA 2BQZA 1MVHA 3M56A 4GYYA 4FMUA 2VSNA 4BT9A 4Z4PA 2R3AA 3SWCA 2P58C 5AYWD 4IJ8A 3Q15A 3LY9A 4ABNA 2V5FA 2O8JA 4U0UA 4JL0A 3M55A 2VGXA 5G04J 1IYGA 3CKCA 3UUXA 5JJTA 3SF4A 2HO1A 3SZ7A 4IJDA 3HYMB 5A6CA 3IHXA 1PC2A 3M54A 1H3IA 2QPWA 3OXLA 4N3AA 5CCMA 4BT8A 5CPRB 5LCWC 4BTBA 3U4TA 4JLGA 3WXXA 5KJNA 3S7DA 2XCBA 4O6FA 5CCLA 3KD7A 2XGMA 3VV0A 4MI5A 3ASGA 4AIFA 4QEOA 2DBAA 3F9WA 4G26A 1KLXA 1KT1A 4Y6CA 3CKBA 4HOTA 4AU7A 4JDSA 2VYIA 4H12A 2XCCA 1NA0A 3M58A 3KMAA 3CEQA 2FI7A 5M72A 4NVQA 2MHKA 1MVXA 3HNAA 1WM5A 2NC9A 4N2QA 4XI9A 1N6CA 2R5SA 2PZIA 4I1AA 5FZRA 3DALA 3F9ZA
chains in the Genus database with same CATH superfamily
5DIZA 3ZKJA 3MO2A 4EQFA 2EIKE 5JHNA 4F6RD 4MBGA 1YCSB 4UQYA 2Y1LE 2OVBA 4I2WA 4K5AB 1EF1C 3S7JA 4GTOA 4LDGA 2RKKA 3JCKC 3ZW3A 3V31A 5LSZA 1E7VA 2YHEA 1BPOA 2X6KA 1DNPA 1OUVA 4WAFA 3ZRHA 1ELKA 3Q9UC 4I9CA 3WG7E 2YHCA 3KEZA 1XQHA 1LD7A 3DEPA 3S8PA 3CK9A 3PZ1A 4HFGA 2VSYA 3CVPA 3U3WA 2WXOA 5EKQD 5AENA 2WMOA 3C72A 3E34A 3LJNA 4R7LA 3NZUA 2J08A 3HXDA 3D9OA 3VLEA 1BU9A 1HO8A 1N54A 2L6BA 4WNEA 4QFVA 3RQ4A 1O1TA 3IEGA 3D9NA 4GA2A 3VTYA 4RQIA 4GU5A 2FO7A 5B1BE 1N11A 1H0AA 1NFIE 4K03A 3TG4A 3RO3A 3PH0C 4BETA 3MO0A 3JUIA 3UI2A 2XGOA 3R9AB 4LEUA 4L23A 2J09A 2F0YA 2VTBA 4P29A 3MGBA 2EIJE 2E2EA 4BSZB 3QARA 4WNFA 3OOIA 3SHFA 3APDA 4ZFHA 3DSWA 4HS2A 3PS6A 4GTMA 5EYLA 3APCA 3CBMA 3EP0A 5F6LA 1YA0A 3D9LA 3ASHA 4UUCA 2WPVA 3FTUA 4ANWA 2EINE 2ETBA 2NYJA 3GYZA 3Q4AB 4I6JA 3N71A 3OTNA 4ILHB 3RAUA 4LNBA 2B6CA 1L5JA 3BG1B 3W9GA 2Q7FA 3GZ2A 2ILRA 3HVEA 4MS6A 5DBKA 4BWRA 2V4HC 3PNTB 4HNAD 3LJ3A 3RU0A 1S64A 4IYPA 3KS2A 4U07A 2M63A 3J5QB 4KMOA 3B95A 4J7FA 3D9MA 3QDNA 1KT0A 3L08A 3LVRE 3T5VA 4KT6B 5LSXA 4ACKA 5ARFA 3SGHA 4DX5D 4J7WA 3DSUA 4TXQA 3F9YA 3RAYA 4MRUA 2GRRB 2IU1A 4DPRA 3V2OA 3C5RA 3ZXPA 3D9KA 4HLEA 2Y0BG 2C0MA 3ESLA 2WXHA 3CVWA 5ENRD 4H7XA 3MZLB 1DCQA 3FH8A 4ANVA 3JUEA 2GGFA 3OXFA 5JJ7A 5EIDA 1Z6TA 3PE3A 4KBQA 1UN9A 2GRQB 4DLQA 3R7QA 1UN8A 2PM6A 4YDOA 4ATZD 1H6OA 3HIZA 4J0UA 3L82A 3UM2A 2XPZA 3P1UA 3MJWA 3IXEA 4BY6A 3NZSA 1N3JA 2WB2A 1TEZA 1WG0A 4I51A 4HQDA 2CHWA 1BI8B 2X38A 1LF8A 2WXJA 1JCQA 4KZCA 3LKUA 4PUCA 2RFMA 4HXIA 3D9IA 3EHMA 4TUUA 5ENTD 3M5AA 4BUPA 4GCOA 5LCWJ 5ENNA 5T0MA 2L0TB 3MA5A 1LD8A 1JWFA 3L17A 4DUIA 4EBAA 3FHEA 2KCVA 3ZFWA 3FUIA 2ZIRA 4JEHA 2EQXA 4NRHB 3EHQA 2RFIA 5T5GA 3DB5A 1ELWA 4O30A 3DSXA 3ZHEB 2YQ8A 1ZKKA 1MX6A 3LDZA 4I9EA 3LY7A 2RG8A 2LUHA 2Y4UA 3C3RA 1O5MA 3FU6A 4JEUA 3OPEA 3FH7A 4O1PA 3NOCD 3ZPJA 1NI1A 5D0QD 5KBAA 5CBOA 4V3IA 2DCPA 1K1BA 1RW2A 2VJ8A 3TWXA 3SNXA 3HXFA 2WXPA 5H7PA 5B3SE 3KMTA 1EPUA 5E76A 4UQZA 4TUMA 2JABA 5F6KC 1NA3A 1S63A 2IY0C 2GRNB 2VGEA 1N4SA 3M56A 1YMPA 1UW4B 2VSNA 3FUHA 4BT9A 3PVLA 2CG2A 3E37A 3ZIMA 3SWCA 2P58C 5AYWD 5EIBE 2XHEA 3Q15A 2EIME 3LY9A 4ABNA 3G2UA 2WXMA 3M55A 1IYGA 2OCCE 3CKCA 4C0MA 1N94A 2I2OA 4Q69A 3ENEA 3SQVA 3TJPA 3R9MA 3HYMB 3FUFA 1H3IA 3T8MA 4CZ2D 2WM9A 2R03A 2J4DA 4N3AA 5LCWC 4L2YA 4MLPA 3D3MA 3TWQA 2XCBA 2CHZA 4O6FA 4ZHBA 5CBNA 3CSFA 4B8CB 2XGMA 1TN6A 3ISMC 5FQ4A 1KLXA 1KT1A 1SQMA 4U7EB 4HOTA 3ULEG 1NA0A 3JQ0A 3CEQA 4DK5A 4JZYA 2DWZA 5ANRA 1OWPA 3FY4A 3TWTA 4AJWA 4JXTA 5T3RA 2WQ7A 2R5SA 4I1AA 5JJ0A 2XGSA 4DJAA 2LXLA 3RRNB 5ITZF 3AG3E 4EBAG 4HRMB 3KSLA 4AY5A 3ASOE 2XEVA 4CGWA 2BKGA 4OYSA 4YNPA 4J8YA 1JPLA 5AQ7A 4GAAA 1ML9A 3FUMA 3LY8A 3SD5A 5KJMA 4BTAA 5FQ7A 4U96D 4HOSA 3CVNA 3B7BA 3FUNA 3VUZA 2KC7A 3FTYA 3ONLA 4AXHA 4X8QA 1QQEA 3FULA 4MI0A 4N2SA 3GZSA 3CHSA 3AS4A 1KZOA 2A4ZA 3HVEB 4PH4B 2XPIA 2L9BA 2UWJG 4F1SA 5C1DA 3SI5A 4GMRA 2IONA 4AVXA 2YNQA 2J8SD 4UQXA 5AIJA 1HX8A 3KSQA 3DBSA 3DEOA 3G2WA 3RKVA 1OY3D 4L2LA 2V0PA 4G8KA 3CV0A 5D66A 3SFYA 2DVWA 4BESA 3OAWA 3ZHEA 4IN3B 4U0SA 2AXUA 4HI9A 3EUVA 3HXBA 2AXVA 3P2BA 3FUEA 3Q47B 1E96B 4LRZA 5TEGA 1NP7A 5IY5E 4YDYA 4AEZC 3HDXA 4F7AA 5BW8C 4UWLA 2LSUA 3GZ1A 2I1KA 1UJJA 2QFCA 3FU0A 3CVUA 4CT0A 5LOZA 3SY2A 2LO6A 4GTPA 4NURA 3JQ1A 4N5QA 1SZ9A 2C0LA 2OVFA 5TH7A 3LPZA 2OEWA 3QWVA 4JPSA 5LP0A 1DC2A 2H6IA 4WWOA 5BV0A 3QWPA 2PQNA 4GB9A 3FUDA 4APOA 3M53A 4C48B 4J8FA 2IGQA 2WXKA 2R02A 3UXGA 3JYSA 2VGXB 2OOEA 4Q94A 3LXUX 2I1JA 3SFZA 2DYSE 3CHMA 4I2ZA 1MX4A 2WXRA 1KPSB 2WXQA 3CHPA 4A3TA 4Z68A 4RLYA 1TNOA 4U63A 1O9SA 1H2UA 5J08A 5EILA 1JWGA 3QK0A 1IHBA 3B7SA 1UG3A 3ZVVA 4U95D 3UINC 4AM9A 4PS8A 3HRAA 1QYMA 5AJLA 1HXIA 4J8EA 3CBOA 4QQIA 2BTDA 4APFA 3ASFA 1E7UA 5JHBA 2XEHA 3AU4A 3CVYA 3C98A 5HQ8A 4F3VA 3TAXA 4E6HA 3BQOA 3PUKA 2X6FA 5G04C 5B1AE 2AWIA 3TXNA 4A1GA 4EZJA 4NQ0A 3PNLB 3EIJA 1MHQA 4I6EA 3APFA 4HLLA 3O48A 3PZDA 2H6FA 4AY6A 2RD0A 3MV2B 2PL2A 5AQ9A 3KEAA 4I17A 4HOQA 4QEPA 1N0RA 2A5UA 3L22A 4C0EA 3ZYMA 3MKRA 3UM3A 2ETAA 4YVQC 2IO3C 1S0PA 1FVFA 3D9HA 1HS6A 3SO8A 4N3BA 2LSVA 5JINA 1H2VC 2IF4A 5A7DB 1OWLA 4HB5A 2ZGDA 5AQBA 1A17A 1OWNA 2L0IA 1H2TC 4O60A 3CHQA 5CEDB 1ZBPA 4G8LA 5JIYA 2LNIA 4HBDA 2G46A 4N3CA 5EG2A 3AG4E 4L9PA 3B7TA 3Q7FA 3PZ4A 3CVLA 1DVPA 3ABME 3UQ3A 2KXPC 4GPKA 3K5KA 4UI9J 3IKOB 5AN8A 1QNFA 3CK8A 3UT8A 5CMYA 3RJWA 3L13A 2DIWA 3CSTA 3ABKE 3TL5A 1Y6IA 3FDHA 3UM1A 4FULA 1FPPA 4F1PA 1MYOA 3UIOC 1N9AA 5FZQA 2W5YA 1ZU2A 5JMND 2OV8A 1H6PA 4XIFA 3EHRA 3ZNGA 3ZYKA 2BQZA 5ANLA 4TXPA 1TR4A 1MVHA 1OCZE 2WXFA 4JW1A 2X3MA 4U8YD 3UKUG 4IJ8A 2O8JA 1OWOA 3UM0A 1FT1A 1JUQA 2VGXA 5CMWA 3UUXA 1XGWA 3SF4A 5ENQD 3RRMB 3TWUA 1IXVA 1HFAA 5G55A 2HO1A 3SZ7A 4EHMA 4KZ0A 3IHXA 4XX5A 5KNGA 3M54A 3Q73A 3UT7A 1Z3XA 2VSOE 5CCMA 1Z3YA 4BT8A 5CPRB 3U4TA 3WXXA 2F37A 3ULYA 4FHJA 2I9CA 2DBAA 3TWWA 3ZUVB 4JDSA 2XCCA 2P9KG 4FP7A 2MHKA 4DX6D 2J49A 2NC9A 4I1MA 4N2QA 4UWHA 4NIKA 1OT8A 3ULQA 2HE0A 2ZU6B 4UI9C 3SW9A 3TG5A 3FTZA 5F5EA 3G2VA 1OCCE 2KCLA 1H19A 4ILGA 3QWWA 3DSTA 5CHEE 3E4BA 3GW4A 2KZTB 1BLXB 1QZ2A 3LVQE 5JHAA 2AVPA 1Q2ZA 5BXOA 3KMJA 4OAUC 1OWMA 4WUYA 2P9LG 3AS8A 2F69A 4YDWA 1PAQA 4XI0A 4OAVB 4JHJA 2GROB 2FF4A 4FJZA 4GCNA 3HG0D 4G24A 4DI3A 1N4PA 2KCKA 3TGOA 4I6GA 5EX0A 1JCRA 5BUZA 1W3BA 1BD8A 4C9BB 3ONKA 1NL4A 2XENA 3PZ3A 4GYWA 5FQ8A 4CGVA 3M57A 3EDTB 3FPDA 5BV1A 4WNGA 3X2QE 2Y3AA 4GZ6A 3T9KA 4KYOB 3MEKA 4DX2A 3TXMA 2XPYA 4CDRA 5F59A 5FWQA 2JLBA 4U8HA 1SW6A 2AXZA 3RSEG 3G2TA 5EN5D 3BO5A 2BUGA 2J4BA 3J5PA 4JC8A 5ENSD 5T8IA 2P9IG 3IV0A 1PEGA 1MX2A 3FTXA 4KVOA 1N4RA 3IHYA 2PNNA 4J8SA 2WQ6A 2IFUA 2AJAA 3VTXA 3F9XA 4G23A 3L6AA 3VLDA 4BEPA 3RIBA 1D9SA 1MJ0A 4FC8A 3AS5A 2F8XK 5FINA 4TRQA 2V8SE 4XKCA 2VQ2A 4AV7A 2GRPB 3FU5A 1U2VG 2F8YA 2V5QC 4JVSA 5A23A 5HI7A 4CDNA 3NAWA 5D0OD 4YNMA 3RO2A 4LUNU 2XQ0A 3S2AA 3CHOA 2A5EA 3HXEA 4J7IA 2CFZA 4CDMA 5G05J 2R05A 1E8ZA 4F53A 2IOSA 2XRZA 4JHRA 1AWCB 3PEUB 1GW6A 3V79K 2FBNA 3DWLG 1G3NB 3RK6A 3UKRG 2LAHA 2YINA 4WNDA 3Q5MA 4GTTA 4A1SA 1WY6A 2LXMA 3ZN3A 3FP3A 1HZ4A 3DPDA 3M59A 5BT1A 5G2NA 3ASNE 1IKND 4BSXA 3ZYQA 4BFRA 4HORA 1D8EA 3Q75A 1TN7A 3K9IA 3FFLA 3EHNA 4J83A 5KNHD 1LTXA 3I4GA 4HOUA 4WWNA 3V2XA 4N5CA 1XNFA 2XRYA 4RZ0A 4PS7A 5CERB 4DI4A 2JEKA 3AG1E 4FLBA 3FUJA 3Q49B 2BEDA 3FWVA 2KZTA 5TTFA 1KZPA 4U0ZA 3AJIA 2WMNA 4DX7D 3LCAA 4RSYA 4XZ4A 2ZXWE 1FVHA 3UT4A 2JV0A 1TYQG 3KAEA 5JA4D 1ELRA 3UPVA 4YNDA 3VLFA 1FCHA 5EX3A 2Y69E 3ZXSA 1SVXA 2IJGX 3LS8A 4B0ZA 4K0RA 2ZISA 3MKQB 3BUAA 5CECB 4ANUA 2J07A 2PM7A 5D2MC 5FQ6A 3OXGA 5LFAA 1E90A 2RFAA 4RVBA 3W9FA 3ZGQA 1EDUA 2ETCA 5J90A 1VDYA 4DX1A 1OCOE 4GYOA 5FJYA 3FUKA 2UY1A 3UX4A 2QYUA 1HU3A 5G05C 2NSZA 2KATA 3URZA 4B89A 2PQRA 2I6HA 1SZAA 4EZKA 3OS5A 3FU3A 2H6GA 3PDNA 1Y8MA 1TJCA 3CR3A 3RRUA 3Q7AA 4KVMA 5JJ6A 2P9UG 5EYPF 3DRAA 3L9TA 1TNZA 3T8KA 1HF8A 4GZDA 2LAIA 4NACA 1TJFA 3CQGB 1INZA 4GYYA 4FMUA 4Z4PA 3HXCA 4AP2A 2R3AA 4JHKA 1EYHA 4CEMA 3I3NA 1SA4A 1DCEA 3QC1A 3CVVA 3FEYA 4A55A 4UWKA 3L54A 5A6CA 2AW6A 3ZEFA 1PC2A 3EIQC 2QY7A 2ZGGA 3CLJA 2QYJA 1IQUA 3JXJA 4GMLA 4K5BA 3FTSA 5HRYA 4DRXE 4B93B 4HVBA 4ATGA 3VV0A 4AIFA 4FHKA 4QEOA 3F9WA 4HI8A 4Y6CA 2IOLA 2VYIA 4GZCA 4H12A 3I4RB 4O1OA 3JXIA 1X81A 3KMAA 1JCSA 2FI7A 3TWSA 5M72A 4NVQA 1MVXA 2QC9A 4XI9A 4JD2G 3TWVA 4D10C 2DYRE 3DALA 1FT2A 3NQPA 3EU9A 2B0OE 3HHMA 4L1BA 4ME2A 5FTPA 1RZ4A 4J8OA 5HS0A 1V54E 4K5CA 4CT4A 1IHGA 4E85A 3MO5A 2HM8A 4GTRA 4PS3A 2NXPA 3CK7A 3C3QA 2HYZA 5AAOA 4G1TA 1HH8A 4H7YA 2V4LA 1N95A 2FEZA 3R7RA 3DXKG 2QZAA 3SBSA 5T0KA 2VGYA 5AQAA 2XEEA 2P9PG 2XZDG 1K8KG 5HKPA 2CG3A 4JA7A 2P9SG 3DSVA 3Q78A 2WXGA 3E30A 2CFUA 4NJ5A 2IO2C 1Z5SC 3AU5A 3EJNA 3SBTB 1V55E 2J9QA 5FT9A 4LG6A 1IQRA 3D9PA 3AAAC 1S70B 3BEEA 3MKQA 3E32A 4AOFA 2WVIA 3IBEA 3SFXA 3L16A 5BPPA 3CVXA 5AYFA 1TNYA 4UWFA 4LERA 4HRLA 4EZLA 3B7RL 4KXKB 4IRUA 2WXLA 2P9NG 2P2CP 3CVQA 1O1RA 2IQCA 4JB8P 4RG9A 2VSXE 4I43A 3ASDA 1B89A 2R17C 3T5XA 3IHVA 1UJKA 1ZB1A 4RG6A 3QKYA 3NF1A 2Y4TA 2OEVA 2GRLA 4TV3A 4GTSA 3QNKA 4J6IA 1N6AA 5BNWA 2KBXA 4J8DA 1PY1A 4UI9K 1HG2A 1QBQA 2E0IA 4YPEA 1WDYA 1H6KA 2R59A 4IULA 4Q96A 4LSZE 4EECA 4XKBA 1OXJA 4CYMD 2L6JA 2XS8A 1OCRE 2CHXA 3MV3B 2XZTG 4GA0A 4GZ5A 2WQHA 4YPUA 3O4ZA 3C3OA 3BU8A 4E47A 3G2SA 3I5PA 2MYOA 3QJZA 2C2LA 2HR2A 3CIAA 1TNBA 1HG5A 3RJVA 5ENPD 4B94A 2GRMA 1U3CA 5ARGA 3DXMG 4EPZA 3DSSA 5ENOD 4OVUA 4YPAA 1D8DA 3MCXA 4I1OB 1K3ZD 4OVVA 2WXIA 4WWPA 4FADA 4LNUD 2WXNA 3ML9A 1BI7B 3DPYA 1E8WA 3FTWA 2GW1A 5E75A 4ACLA 4CCAA 1N0QA 5EDSA 2XS1A 5CRVA 1MZCA 3UIPC 2UY1B 4M3OA 5FIOA 2DZOA 5LX8A 4JA9A 3B7UX 3PREA 3AG2E 1O1SA 4GTQA 2R2LA 3CGHA 2FULA 3E33A 2X6IA 4G25A 5AJDA 5KJLA 3CBPA 4TXRA 3D9JA 4GZ3A 5CRUA 2EILE 1SA5A 4Y6WA 4QENA 3PEVB 4G2VA 3U9WA 4MKTA 3NB2A 4GTVA 3PRZA 3CHRA 1A5EA 3F6QA 2W5ZA 1WAO1 4U8VD 4FA6A 4DLOA 5KWDA 5KCMA 2BF0X 2VTBB 3QOUA 4BERA 4A3VA 4GA1A 2MOWA 3NBNB 1P5QA 5T4YA 3PE4A 2DZNA 4ILIA 1NZNA 3MX3A 3ABLE 3S7FA 2KM4A 4FLHA 4GPMA 1TNUA 2FO1E 3NOGD 5CEAA 4U04A 4CRWA 4PDXA 4L7TA 3FTVA 4XE0A 4W9RA 4N39A 5FZSA 1E8YA 5KJKA 1TN8A 3ESKA 4G11A 4YVOA 1MT6A 3PUJA 1MUFA 1N52A 1U3DA 3UMVA 3LYAA 2MRIA 2ONDA 3FH5A 4FU3A 4B8AA 1YYHA 4URKA 4C1QA 3S7BA 1HE8A 5C2YA 1E8XA 4HRNA 4BX8A 3Q9NC 3EU5A 3U66A 4XEIG 3U64A 4UWGA 3V30A 2X6JA 2BKKB 3ZYLA 2V5FA 4U0UA 2IEJA 3UTMA 3Q79A 4JL0A 2X6HA 5G04J 3PZ2A 4A63B 1AP7A 5JJTA 4M7CA 3FEXA 3MYVA 4IJDA 1N4QA 3TWRA 2QPWA 3OXLA 4BX9A 3LEWA 4LNGA 1MQSA 1K1AA 4BTBA 4JLGA 4ANXA 5KJNA 3S7DA 5CCLA 4LCTA 3KD7A 4MI5A 3ASGA 3ML8A 4G26A 3B13A 3QB2A 3CKBA 4FJYA 4AU7A 1UOHA 3CQCB 3M58A 1X5BA 3HNAA 4YDEA 1WM5A 3ZU7B 1N6CA 4GMJA 5AARA 3QAQA 2PZIA 5FZRA 5BXUA 3BG0B 2H6HA 3F9ZA
chains in the Genus database with same CATH topology
5JJ0A 3NQPA 2XGSA 4DJAA 5DIZA 3MO2A 4EQFA 3RRNB 3ULQA 5JHNA 4EBAG 3HHMA 4L1BA 4ME2A 5FTPA 2ZU6B 4UQYA 4J8OA 4UI9C 3SW9A 3TG5A 3FTZA 5F5EA 3G2VA 4I2WA 2OVBA 4AY5A 1EF1C 3S7JA 2KCLA 2XEVA 4CT4A 1H19A 4ILGA 1IHGA 4E85A 3QWWA 3JCKC 4CGWA 4LDGA 4OYSA 5CHEE 4YNPA 3E4BA 3GW4A 3ZW3A 2KZTB 3MO5A 1QZ2A 3LVQE 5LSZA 1E7VA 2AVPA 2HM8A 5JHAA 1JPLA 2YHEA 1BPOA 4PS3A 2NXPA 4GAAA 1ML9A 3CK7A 3KMJA 3FUMA 2X6KA 1OWMA 1DNPA 1OUVA 3LY8A 3SD5A 5KJMA 4WUYA 2HYZA 5FQ7A 4BTAA 4WAFA 3ZRHA 4HOSA 1ELKA 4I9CA 3CVNA 3FUNA 4G1TA 1HH8A 3AS8A 2F69A 3VUZA 2YHCA 1PAQA 2KC7A 4H7YA 2V4LA 3FTYA 4XI0A 3KEZA 3ONLA 4JHJA 1XQHA 4AXHA 2FEZA 3S8PA 3CK9A 2FF4A 4FJZA 3R7RA 1QQEA 4HFGA 2VSYA 4GCNA 3CVPA 3FULA 4MI0A 3U3WA 2WXOA 4N2SA 3GZSA 4G24A 5EKQD 4DI3A 5AENA 3SBSA 3CHSA 2KCKA 3TGOA 2WMOA 5T0KA 4I6GA 3AS4A 5EX0A 4R7LA 3NZUA 2A4ZA 2VGYA 3HVEB 2J08A 4PH4B 2XPIA 3D9OA 2L9BA 2UWJG 3VLEA 4F1SA 1W3BA 5BUZA 1HO8A 3SI5A 1N54A 4C9BB 2CG3A 2IONA 4JA7A 4WNEA 3ONKA 4AVXA 4QFVA 2YNQA 3RQ4A 2WXGA 3IEGA 4GYWA 3D9NA 2CFUA 4NJ5A 4GA2A 5FQ8A 4UQXA 4CGVA 3VTYA 3M57A 4GU5A 3AU5A 3EDTB 3EJNA 5AIJA 2FO7A 3FPDA 3SBTB 1HX8A 1H0AA 2J9QA 4WNGA 5BV1A 4K03A 3DBSA 2Y3AA 5FT9A 3TG4A 4GZ6A 1IQRA 3D9PA 3G2WA 3RKVA 3PH0C 3RO3A 3MO0A 3JUIA 4L2LA 3BEEA 4KYOB 2XGOA 3MEKA 2V0PA 3MKQA 3R9AB 4LEUA 3TXMA 3CV0A 4L23A 2XPYA 4AOFA 2J09A 4CDRA 2WVIA 5F59A 3OAWA 3ZHEA 4IN3B 3IBEA 4U0SA 2AXUA 5FWQA 3L16A 5BPPA 3CVXA 2AXVA 2JLBA 3FUEA 3P2BA 3Q47B 4P29A 3MGBA 4U8HA 1E96B 2VTBA 2E2EA 4LRZA 4UWFA 4LERA 5TEGA 1NP7A 2AXZA 3QARA 4WNFA 3OOIA 4EZLA 3SHFA 4AEZC 3HDXA 3B7RL 4KXKB 4F7AA 3G2TA 2WXLA 3CVQA 4IRUA 4UWLA 5BW8C 3APDA 2LSUA 2IQCA 3BO5A 2BUGA 2J4BA 3GZ1A 2I1KA 1UJJA 4RG9A 4HS2A 4JC8A 5T8IA 2VSXE 2QFCA 4I43A 3PS6A 3ASDA 3FU0A 1B89A 3CVUA 3IV0A 4CT0A 3APCA 2R17C 5LOZA 3IHVA 3T5XA 1PEGA 3CBMA 2LO6A 3EP0A 5F6LA 1YA0A 4NURA 3JQ1A 1UJKA 3D9LA 3FTXA 4KVOA 3ASHA 3IHYA 4J8SA 1SZ9A 2C0LA 4RG6A 2OVFA 5TH7A 3QKYA 3NF1A 2Y4TA 2WPVA 3FTUA 2GRLA 2IFUA 3LPZA 3VTXA 4ANWA 3QWVA 4TV3A 4JPSA 5LP0A 3QNKA 4J6IA 3F9XA 4G23A 3GYZA 3Q4AB 4WWOA 4I6JA 1N6AA 3N71A 3L6AA 5BV0A 3QWPA 3VLDA 2PQNA 3OTNA 4GB9A 3RIBA 5BNWA 4ILHB 3FUDA 4APOA 3M53A 4FC8A 3AS5A 4J8DA 1PY1A 4J8FA 4UI9K 2IGQA 1HG2A 1L5JA 3BG1B 2E0IA 4TRQA 4YPEA 2Q7FA 1H6KA 2R59A 2V8SE 2WXKA 3GZ2A 2ILRA 2VQ2A 3HVEA 4MS6A 4XKCA 5DBKA 4AV7A 3JYSA 4IULA 3FU5A 4Q96A 4BWRA 2VGXB 2OOEA 4EECA 3PNTB 4Q94A 4XKBA 3LXUX 2I1JA 3LJ3A 4JVSA 5A23A 3SFZA 2L6JA 5HI7A 4CDNA 3CHMA 4I2ZA 3RU0A 4IYPA 5D0OD 2WXRA 2CHXA 3KS2A 2WXQA 3MV3B 4U07A 3CHPA 4A3TA 4YNMA 3RO2A 4GA0A 4GZ5A 4U63A 2WQHA 4YPUA 2M63A 1O9SA 1H2UA 3O4ZA 4KMOA 4LUNU 5J08A 4J7FA 1JWGA 2XQ0A 3QK0A 4E47A 3G2SA 3S2AA 3D9MA 3I5PA 3QDNA 1KT0A 3B7SA 3CHOA 3L08A 3LVRE 3QJZA 3T5VA 2C2LA 4KT6B 2HR2A 5LSXA 1UG3A 3ZVVA 3CIAA 4AM9A 4PS8A 4ACKA 5AJLA 5ARFA 3SGHA 4J7IA 1HG5A 1HXIA 2CFZA 4J8EA 3RJVA 3CBOA 2BTDA 4B94A 4APFA 2GRMA 4CDMA 5G05J 3F9YA 1U3CA 3RAYA 1E8ZA 3ASFA 5ARGA 4MRUA 1E7UA 4F53A 2IOSA 5JHBA 2IU1A 4DPRA 4EPZA 2XRZA 3AU4A 3D9KA 4JHRA 4HLEA 3CVYA 3PEUB 1GW6A 2C0MA 2FBNA 4OVUA 4YPAA 3C98A 3ESLA 2WXHA 5HQ8A 3RK6A 3CVWA 3MCXA 4H7XA 2LAHA 4F3VA 4I1OB 2YINA 3MZLB 4WNDA 3FH8A 3TAXA 3Q5MA 4OVVA 4ANVA 4A1SA 1WY6A 4E6HA 2WXIA 3PUKA 3ZN3A 2GGFA 3OXFA 3FP3A 4WWPA 2X6FA 5JJ7A 1HZ4A 1Z6TA 5G04C 3PE3A 4KBQA 1UN9A 3DPDA 4FADA 3M59A 4DLQA 5BT1A 3R7QA 2AWIA 3TXNA 4A1GA 5G2NA 1UN8A 2PM6A 2WXNA 3ML9A 4NQ0A 4EZJA 3PNLB 4BSXA 3ZYQA 3EIJA 3HIZA 4J0UA 1E8WA 1MHQA 3FTWA 4BFRA 2GW1A 4I6EA 4HORA 5E75A 4ACLA 4CCAA 3APFA 2XPZA 3O48A 5EDSA 3PZDA 3P1UA 3MJWA 3K9IA 4AY6A 4BY6A 2UY1B 2RD0A 3EHNA 3FFLA 3MV2B 2PL2A 3NZSA 4M3OA 4J83A 1N3JA 3I4GA 4HOUA 4I17A 2WB2A 4WWNA 1TEZA 4N5CA 1XNFA 2XRYA 4HOQA 4RZ0A 5LX8A 4QEPA 4I51A 4JA9A 4PS7A 2A5UA 3L22A 2JEKA 3B7UX 3MKRA 3PREA 3ZYMA 4C0EA 4DI4A 2CHWA 5C1DA 2X38A 4FLBA 1LF8A 3FUJA 2WXJA 2WQ6A 3Q49B 4YVQC 3FWVA 2KZTA 4KZCA 5TTFA 3CGHA 3LKUA 2FULA 4PUCA 2X6IA 4HXIA 4U0ZA 3D9IA 1S0PA 1FVFA 3EHMA 4G25A 4TUUA 3M5AA 4BUPA 4GCOA 5AJDA 1HS6A 2WMNA 5ENNA 5LCWJ 3LCAA 2L0TB 5T0MA 4RSYA 5KJLA 4N3BA 3CBPA 2LSVA 3MA5A 4XZ4A 3D9JA 4GZ3A 1FVHA 3UT4A 5JINA 1H2VC 5AYFA 2IF4A 2JV0A 5A7DB 1JWFA 3KAEA 4Y6WA 4QENA 1OWLA 3PEVB 1ELRA 3L17A 4G2VA 4EBAA 3UPVA 4YNDA 3VLFA 3FHEA 1FCHA 5EX3A 1A17A 2KCVA 1OWNA 3ZFWA 2L0IA 3FUIA 3U9WA 1H2TC 3ZXSA 4MKTA 4JEHA 3PRZA 3CHRA 2EQXA 4NRHB 2IJGX 3LS8A 2W5ZA 3CHQA 1ZBPA 1WAO1 2RFIA 4B0ZA 4FA6A 4K0RA 5JIYA 3MKQB 4DLOA 5T5GA 2LNIA 4ANUA 2J07A 2PM7A 3DB5A 1ELWA 4O30A 3ZHEB 5KCMA 2YQ8A 2G46A 4N3CA 5FQ6A 5EG2A 3OXGA 5LFAA 2BF0X 1ZKKA 2VTBB 3LDZA 4I9EA 3B7TA 3LY7A 3QOUA 1E90A 4A3VA 4GA1A 3CVLA 2MOWA 2RG8A 1P5QA 1DVPA 4RVBA 5T4YA 2Y4UA 3PE4A 3UQ3A 4ILIA 4GPKA 1NZNA 3MX3A 3ZGQA 3S7FA 2KM4A 1EDUA 4FLHA 3K5KA 3FU6A 4UI9J 5J90A 1VDYA 3IKOB 4JEUA 1QNFA 3OPEA 3CK8A 3FH7A 4GYOA 5CMYA 3UT8A 4U04A 5FJYA 4CRWA 3RJWA 3ZPJA 3L13A 4PDXA 4L7TA 3FUKA 2UY1A 5D0QD 3FTVA 3UX4A 2DIWA 3CSTA 4XE0A 4W9RA 1HU3A 4N39A 5G05C 3TL5A 2NSZA 4V3IA 5FZSA 1E8YA 2KATA 2DCPA 3URZA 4B89A 2PQRA 2I6HA 1SZAA 1Y6IA 3FDHA 2VJ8A 4FULA 4EZKA 5KJKA 3SNXA 3ESKA 3OS5A 2WXPA 3FU3A 4G11A 4YVOA 3KMTA 1EPUA 3PDNA 5E76A 1MT6A 5FZQA 3PUJA 1Y8MA 1N52A 1TJCA 1U3DA 1ZU2A 3CR3A 4UQZA 3RRUA 1MUFA 2W5YA 3UMVA 3LYAA 4KVMA 2MRIA 2ONDA 5JJ6A 2OV8A 3FH5A 4FU3A 5F6KC 1NA3A 4XIFA 4B8AA 4URKA 4C1QA 1HF8A 3S7BA 4GZDA 2LAIA 1HE8A 4NACA 1TJFA 3ZYKA 3CQGB 2BQZA 5C2YA 5ANLA 1E8XA 4BX8A 1MVHA 3M56A 1INZA 2WXFA 1UW4B 4GYYA 3U66A 4FMUA 2VSNA 3FUHA 4BT9A 4JW1A 3U64A 4UWGA 4Z4PA 4AP2A 2R3AA 3PVLA 2CG2A 4JHKA 3ZIMA 3SWCA 2X6JA 1EYHA 2P58C 2X3MA 5AYWD 2XHEA 4IJ8A 3Q15A 4CEMA 3ZYLA 3LY9A 4ABNA 2V5FA 2O8JA 1OWOA 3G2UA 4U0UA 2WXMA 3I3NA 4JL0A 1JUQA 2X6HA 3M55A 2VGXA 5G04J 5CMWA 1IYGA 3CKCA 3UUXA 1XGWA 3QC1A 4C0MA 5JJTA 2I2OA 4Q69A 3ENEA 3FEXA 3SF4A 3RRMB 3CVVA 3FEYA 3MYVA 5G55A 1HFAA 3TJPA 4A55A 2HO1A 3L54A 4UWKA 3SZ7A 4IJDA 3HYMB 4KZ0A 5A6CA 3IHXA 2AW6A 3FUFA 1PC2A 4XX5A 3ZEFA 3M54A 3EIQC 3T8MA 1H3IA 2QY7A 3UT7A 2WM9A 1Z3XA 2VSOE 3CLJA 2QPWA 3OXLA 4BX9A 2J4DA 1IQUA 3LEWA 1Z3YA 4N3AA 1MQSA 4BT8A 5CCMA 5LCWC 5CPRB 4GMLA 3FTSA 3U4TA 4BTBA 4JLGA 4ANXA 4L2YA 4MLPA 3WXXA 5KJNA 3D3MA 3S7DA 2XCBA 2CHZA 4O6FA 4HVBA 5CCLA 4LCTA 3KD7A 3CSFA 4B8CB 2XGMA 4ATGA 3VV0A 4FHJA 4MI5A 3ASGA 4AIFA 3ML8A 4FHKA 4QEOA 2I9CA 2DBAA 5FQ4A 3F9WA 4G26A 1KLXA 1KT1A 1SQMA 3B13A 3QB2A 4Y6CA 3CKBA 4HOTA 2IOLA 4FJYA 4AU7A 4JDSA 2VYIA 4GZCA 4H12A 3I4RB 2XCCA 1NA0A 3CQCB 3M58A 3JQ0A 3KMAA 3CEQA 2FI7A 4FP7A 1X5BA 4DK5A 5M72A 4JZYA 4NVQA 2MHKA 1MVXA 3HNAA 5ANRA 1OWPA 2J49A 1WM5A 2NC9A 3FY4A 4I1MA 4N2QA 4XI9A 1N6CA 4GMJA 4UWHA 4AJWA 4JXTA 4D10C 3QAQA 5T3RA 2WQ7A 2R5SA 2PZIA 4I1AA 5FZRA 3BG0B 3DALA 3F9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JJ0 A;  2XGS A;  5DIZ A;  3MO2 A;  4EQF A;  3ULQ A;  5JHN A;  5FTP A;  4ME2 A;  4J8O A;  4UQY A;  4UI9 C;  3SW9 A;  3TG5 A;  5F5E A;  4I2W A;  4AY5 A;  3S7J A;  2KCL A;  2XEV A;  1IHG A;  3QWW A;  4CGW A;  4LDG A;  5CHE E;  4YNP A;  3E4B A;  3GW4 A;  3MO5 A;  1QZ2 A;  5LSZ A;  2AVP A;  1ML9 A;  3KMJ A;  3CK7 A;  1OUV A;  3LY8 A;  5KJM A;  4WUY A;  2HYZ A;  4BTA A;  4HOS A;  4I9C A;  3CVN A;  4G1T A;  1HH8 A;  3AS8 A;  2F69 A;  3VUZ A;  2YHC A;  2KC7 A;  4H7Y A;  4XI0 A;  1XQH A;  2FEZ A;  3S8P A;  3CK9 A;  2FF4 A;  1QQE A;  2VSY A;  4GCN A;  3CVP A;  4MI0 A;  3U3W A;  4N2S A;  5EKQ D;  4G24 A;  2KCK A;  3TGO A;  5T0K A;  3AS4 A;  5EX0 A;  2VGY A;  2XPI A;  5C1D A;  2UWJ G;  1W3B A;  4JA7 A;  4WNE A;  3RQ4 A;  3IEG A;  4GYW A;  4NJ5 A;  4GA2 A;  4UQX A;  4CGV A;  3VTY A;  3M57 A;  3EDT B;  3FPD A;  2FO7 A;  2J9Q A;  4WNG A;  5FT9 A;  3TG4 A;  4GZ6 A;  3RO3 A;  3RKV A;  3MO0 A;  3BEE A;  4KYO B;  2XGO A;  3MEK A;  3R9A B;  4LEU A;  3CV0 A;  4CDR A;  5F59 A;  3ZHE A;  4IN3 B;  4U0S A;  2JLB A;  5AYF A;  3Q47 B;  1E96 B;  2E2E A;  5TEG A;  4WNF A;  3OOI A;  4KXK B;  5BW8 C;  3CVQ A;  2LSU A;  3BO5 A;  2BUG A;  3GZ1 A;  4RG9 A;  2QFC A;  3ASD A;  1B89 A;  3CBM A;  1PEG A;  3EP0 A;  5F6L A;  1YA0 A;  3ASH A;  2C0L A;  4RG6 A;  5TH7 A;  3QKY A;  3NF1 A;  2Y4T A;  2WPV A;  2IFU A;  3LPZ A;  3VTX A;  3QWV A;  3F9X A;  4G23 A;  3GYZ A;  3Q4A B;  1N6A A;  3N71 A;  3QWP A;  2PQN A;  3RIB A;  5BNW A;  4APO A;  3M53 A;  3AS5 A;  4J8D A;  4J8F A;  4UI9 K;  2IGQ A;  4YPE A;  2Q7F A;  3GZ2 A;  2VQ2 A;  5DBK A;  3JYS A;  4BWR A;  2VGX B;  2OOE A;  2L6J A;  5HI7 A;  4I2Z A;  3RU0 A;  5D0O D;  3KS2 A;  3MV3 B;  4U07 A;  4YNM A;  3RO2 A;  4GA0 A;  4GZ5 A;  2WQH A;  4YPU A;  1O9S A;  4J7F A;  4E47 A;  3QDN A;  1KT0 A;  2C2L A;  2HR2 A;  5LSX A;  4AM9 A;  5ARF A;  4J7I A;  1HXI A;  4J8E A;  3RJV A;  3CBO A;  4B94 A;  5G05 J;  3F9Y A;  3RAY A;  3ASF A;  5ARG A;  4JHR A;  2C0M A;  2FBN A;  4YPA A;  5HQ8 A;  4H7X A;  4F3V A;  4WND A;  3TAX A;  3Q5M A;  4A1S A;  3ZN3 A;  3OXF A;  3FP3 A;  5JJ7 A;  1HZ4 A;  5G04 C;  3PE3 A;  4KBQ A;  3M59 A;  5BT1 A;  4NQ0 A;  4J0U A;  4HOR A;  2GW1 A;  3O48 A;  3K9I A;  4AY6 A;  2UY1 B;  3FFL A;  3MV2 B;  2PL2 A;  4J83 A;  1N3J A;  4HOU A;  4I17 A;  4N5C A;  1XNF A;  4HOQ A;  4RZ0 A;  4QEP A;  4I51 A;  4JA9 A;  3MKR A;  3Q49 B;  4YVQ C;  3FWV A;  5TTF A;  3LKU A;  4U0Z A;  4G25 A;  3M5A A;  4BUP A;  4GCO A;  5LCW J;  5T0M A;  3LCA A;  5KJL A;  4N3B A;  3CBP A;  2LSV A;  3MA5 A;  4GZ3 A;  5JIN A;  2IF4 A;  2JV0 A;  5A7D B;  3KAE A;  4Y6W A;  4QEN A;  1ELR A;  4G2V A;  3UPV A;  4YND A;  1FCH A;  5EX3 A;  1A17 A;  2KCV A;  3ZFW A;  4NRH B;  2W5Z A;  1ZBP A;  1WAO 1;  2RFI A;  5JIY A;  5T5G A;  2LNI A;  3DB5 A;  1ELW A;  4O30 A;  3ZHE B;  2YQ8 A;  2G46 A;  4N3C A;  5EG2 A;  3OXG A;  1ZKK A;  4I9E A;  3LY7 A;  3QOU A;  4GA1 A;  3CVL A;  1P5Q A;  2Y4U A;  3PE4 A;  3UQ3 A;  4GPK A;  1NZN A;  3ZGQ A;  3S7F A;  3K5K A;  4UI9 J;  3OPE A;  3CK8 A;  4GYO A;  4U04 A;  5FJY A;  3RJW A;  3ZPJ A;  2UY1 A;  5D0Q D;  4W9R A;  4N39 A;  5G05 C;  5FZS A;  2KAT A;  3URZ A;  2PQR A;  2I6H A;  5KJK A;  3ESK A;  3OS5 A;  4YVO A;  3KMT A;  3PDN A;  1MT6 A;  5FZQ A;  1Y8M A;  1TJC A;  1MUF A;  2W5Y A;  1ZU2 A;  4UQZ A;  3LYA A;  2OND A;  5JJ6 A;  5F6K C;  1NA3 A;  4XIF A;  4C1Q A;  3S7B A;  2BQZ A;  1MVH A;  3M56 A;  4GYY A;  4FMU A;  2VSN A;  4BT9 A;  4Z4P A;  2R3A A;  3SWC A;  2P58 C;  5AYW D;  4IJ8 A;  3Q15 A;  3LY9 A;  4ABN A;  2V5F A;  2O8J A;  4U0U A;  4JL0 A;  3M55 A;  2VGX A;  5G04 J;  1IYG A;  3CKC A;  3UUX A;  5JJT A;  3SF4 A;  2HO1 A;  3SZ7 A;  4IJD A;  3HYM B;  5A6C A;  3IHX A;  1PC2 A;  3M54 A;  1H3I A;  2QPW A;  3OXL A;  4N3A A;  5CCM A;  4BT8 A;  5CPR B;  5LCW C;  4BTB A;  3U4T A;  4JLG A;  3WXX A;  5KJN A;  3S7D A;  2XCB A;  4O6F A;  5CCL A;  3KD7 A;  2XGM A;  3VV0 A;  4MI5 A;  3ASG A;  4AIF A;  4QEO A;  2DBA A;  3F9W A;  4G26 A;  1KLX A;  1KT1 A;  4Y6C A;  3CKB A;  4HOT A;  4AU7 A;  4JDS A;  2VYI A;  4H12 A;  2XCC A;  1NA0 A;  3M58 A;  3KMA A;  3CEQ A;  2FI7 A;  5M72 A;  4NVQ A;  2MHK A;  1MVX A;  3HNA A;  1WM5 A;  2NC9 A;  4N2Q A;  4XI9 A;  1N6C A;  2R5S A;  2PZI A;  4I1A A;  5FZR A;  3DAL A;  3F9Z A; 
#chains in the Genus database with same CATH topology
 5DIZ A;  3ZKJ A;  3MO2 A;  4EQF A;  2EIK E;  5JHN A;  4F6R D;  4MBG A;  1YCS B;  4UQY A;  2Y1L E;  2OVB A;  4I2W A;  4K5A B;  1EF1 C;  3S7J A;  4GTO A;  4LDG A;  2RKK A;  3JCK C;  3ZW3 A;  3V31 A;  5LSZ A;  1E7V A;  2YHE A;  1BPO A;  2X6K A;  1DNP A;  1OUV A;  4WAF A;  3ZRH A;  1ELK A;  3Q9U C;  4I9C A;  3WG7 E;  2YHC A;  3KEZ A;  1XQH A;  1LD7 A;  3DEP A;  3S8P A;  3CK9 A;  3PZ1 A;  4HFG A;  2VSY A;  3CVP A;  3U3W A;  2WXO A;  5EKQ D;  5AEN A;  2WMO A;  3C72 A;  3E34 A;  3LJN A;  4R7L A;  3NZU A;  2J08 A;  3HXD A;  3D9O A;  3VLE A;  1BU9 A;  1HO8 A;  1N54 A;  2L6B A;  4WNE A;  4QFV A;  3RQ4 A;  1O1T A;  3IEG A;  3D9N A;  4GA2 A;  3VTY A;  4RQI A;  4GU5 A;  2FO7 A;  5B1B E;  1N11 A;  1H0A A;  1NFI E;  4K03 A;  3TG4 A;  3RO3 A;  3PH0 C;  4BET A;  3MO0 A;  3JUI A;  3UI2 A;  2XGO A;  3R9A B;  4LEU A;  4L23 A;  2J09 A;  2F0Y A;  2VTB A;  4P29 A;  3MGB A;  2EIJ E;  2E2E A;  4BSZ B;  3QAR A;  4WNF A;  3OOI A;  3SHF A;  3APD A;  4ZFH A;  3DSW A;  4HS2 A;  3PS6 A;  4GTM A;  5EYL A;  3APC A;  3CBM A;  3EP0 A;  5F6L A;  1YA0 A;  3D9L A;  3ASH A;  4UUC A;  2WPV A;  3FTU A;  4ANW A;  2EIN E;  2ETB A;  2NYJ A;  3GYZ A;  3Q4A B;  4I6J A;  3N71 A;  3OTN A;  4ILH B;  3RAU A;  4LNB A;  2B6C A;  1L5J A;  3BG1 B;  3W9G A;  2Q7F A;  3GZ2 A;  2ILR A;  3HVE A;  4MS6 A;  5DBK A;  4BWR A;  2V4H C;  3PNT B;  4HNA D;  3LJ3 A;  3RU0 A;  1S64 A;  4IYP A;  3KS2 A;  4U07 A;  2M63 A;  3J5Q B;  4KMO A;  3B95 A;  4J7F A;  3D9M A;  3QDN A;  1KT0 A;  3L08 A;  3LVR E;  3T5V A;  4KT6 B;  5LSX A;  4ACK A;  5ARF A;  3SGH A;  4DX5 D;  4J7W A;  3DSU A;  4TXQ A;  3F9Y A;  3RAY A;  4MRU A;  2GRR B;  2IU1 A;  4DPR A;  3V2O A;  3C5R A;  3ZXP A;  3D9K A;  4HLE A;  2Y0B G;  2C0M A;  3ESL A;  2WXH A;  3CVW A;  5ENR D;  4H7X A;  3MZL B;  1DCQ A;  3FH8 A;  4ANV A;  3JUE A;  2GGF A;  3OXF A;  5JJ7 A;  5EID A;  1Z6T A;  3PE3 A;  4KBQ A;  1UN9 A;  2GRQ B;  4DLQ A;  3R7Q A;  1UN8 A;  2PM6 A;  4YDO A;  4ATZ D;  1H6O A;  3HIZ A;  4J0U A;  3L82 A;  3UM2 A;  2XPZ A;  3P1U A;  3MJW A;  3IXE A;  4BY6 A;  3NZS A;  1N3J A;  2WB2 A;  1TEZ A;  1WG0 A;  4I51 A;  4HQD A;  2CHW A;  1BI8 B;  2X38 A;  1LF8 A;  2WXJ A;  1JCQ A;  4KZC A;  3LKU A;  4PUC A;  2RFM A;  4HXI A;  3D9I A;  3EHM A;  4TUU A;  5ENT D;  3M5A A;  4BUP A;  4GCO A;  5LCW J;  5ENN A;  5T0M A;  2L0T B;  3MA5 A;  1LD8 A;  1JWF A;  3L17 A;  4DUI A;  4EBA A;  3FHE A;  2KCV A;  3ZFW A;  3FUI A;  2ZIR A;  4JEH A;  2EQX A;  4NRH B;  3EHQ A;  2RFI A;  5T5G A;  3DB5 A;  1ELW A;  4O30 A;  3DSX A;  3ZHE B;  2YQ8 A;  1ZKK A;  1MX6 A;  3LDZ A;  4I9E A;  3LY7 A;  2RG8 A;  2LUH A;  2Y4U A;  3C3R A;  1O5M A;  3FU6 A;  4JEU A;  3OPE A;  3FH7 A;  4O1P A;  3NOC D;  3ZPJ A;  1NI1 A;  5D0Q D;  5KBA A;  5CBO A;  4V3I A;  2DCP A;  1K1B A;  1RW2 A;  2VJ8 A;  3TWX A;  3SNX A;  3HXF A;  2WXP A;  5H7P A;  5B3S E;  3KMT A;  1EPU A;  5E76 A;  4UQZ A;  4TUM A;  2JAB A;  5F6K C;  1NA3 A;  1S63 A;  2IY0 C;  2GRN B;  2VGE A;  1N4S A;  3M56 A;  1YMP A;  1UW4 B;  2VSN A;  3FUH A;  4BT9 A;  3PVL A;  2CG2 A;  3E37 A;  3ZIM A;  3SWC A;  2P58 C;  5AYW D;  5EIB E;  2XHE A;  3Q15 A;  2EIM E;  3LY9 A;  4ABN A;  3G2U A;  2WXM A;  3M55 A;  1IYG A;  2OCC E;  3CKC A;  4C0M A;  1N94 A;  2I2O A;  4Q69 A;  3ENE A;  3SQV A;  3TJP A;  3R9M A;  3HYM B;  3FUF A;  1H3I A;  3T8M A;  4CZ2 D;  2WM9 A;  2R03 A;  2J4D A;  4N3A A;  5LCW C;  4L2Y A;  4MLP A;  3D3M A;  3TWQ A;  2XCB A;  2CHZ A;  4O6F A;  4ZHB A;  5CBN A;  3CSF A;  4B8C B;  2XGM A;  1TN6 A;  3ISM C;  5FQ4 A;  1KLX A;  1KT1 A;  1SQM A;  4U7E B;  4HOT A;  3ULE G;  1NA0 A;  3JQ0 A;  3CEQ A;  4DK5 A;  4JZY A;  2DWZ A;  5ANR A;  1OWP A;  3FY4 A;  3TWT A;  4AJW A;  4JXT A;  5T3R A;  2WQ7 A;  2R5S A;  4I1A A;  5JJ0 A;  2XGS A;  4DJA A;  2LXL A;  3RRN B;  5ITZ F;  3AG3 E;  4EBA G;  4HRM B;  3KSL A;  4AY5 A;  3ASO E;  2XEV A;  4CGW A;  2BKG A;  4OYS A;  4YNP A;  4J8Y A;  1JPL A;  5AQ7 A;  4GAA A;  1ML9 A;  3FUM A;  3LY8 A;  3SD5 A;  5KJM A;  4BTA A;  5FQ7 A;  4U96 D;  4HOS A;  3CVN A;  3B7B A;  3FUN A;  3VUZ A;  2KC7 A;  3FTY A;  3ONL A;  4AXH A;  4X8Q A;  1QQE A;  3FUL A;  4MI0 A;  4N2S A;  3GZS A;  3CHS A;  3AS4 A;  1KZO A;  2A4Z A;  3HVE B;  4PH4 B;  2XPI A;  2L9B A;  2UWJ G;  4F1S A;  5C1D A;  3SI5 A;  4GMR A;  2ION A;  4AVX A;  2YNQ A;  2J8S D;  4UQX A;  5AIJ A;  1HX8 A;  3KSQ A;  3DBS A;  3DEO A;  3G2W A;  3RKV A;  1OY3 D;  4L2L A;  2V0P A;  4G8K A;  3CV0 A;  5D66 A;  3SFY A;  2DVW A;  4BES A;  3OAW A;  3ZHE A;  4IN3 B;  4U0S A;  2AXU A;  4HI9 A;  3EUV A;  3HXB A;  2AXV A;  3P2B A;  3FUE A;  3Q47 B;  1E96 B;  4LRZ A;  5TEG A;  1NP7 A;  5IY5 E;  4YDY A;  4AEZ C;  3HDX A;  4F7A A;  5BW8 C;  4UWL A;  2LSU A;  3GZ1 A;  2I1K A;  1UJJ A;  2QFC A;  3FU0 A;  3CVU A;  4CT0 A;  5LOZ A;  3SY2 A;  2LO6 A;  4GTP A;  4NUR A;  3JQ1 A;  4N5Q A;  1SZ9 A;  2C0L A;  2OVF A;  5TH7 A;  3LPZ A;  2OEW A;  3QWV A;  4JPS A;  5LP0 A;  1DC2 A;  2H6I A;  4WWO A;  5BV0 A;  3QWP A;  2PQN A;  4GB9 A;  3FUD A;  4APO A;  3M53 A;  4C48 B;  4J8F A;  2IGQ A;  2WXK A;  2R02 A;  3UXG A;  3JYS A;  2VGX B;  2OOE A;  4Q94 A;  3LXU X;  2I1J A;  3SFZ A;  2DYS E;  3CHM A;  4I2Z A;  1MX4 A;  2WXR A;  1KPS B;  2WXQ A;  3CHP A;  4A3T A;  4Z68 A;  4RLY A;  1TNO A;  4U63 A;  1O9S A;  1H2U A;  5J08 A;  5EIL A;  1JWG A;  3QK0 A;  1IHB A;  3B7S A;  1UG3 A;  3ZVV A;  4U95 D;  3UIN C;  4AM9 A;  4PS8 A;  3HRA A;  1QYM A;  5AJL A;  1HXI A;  4J8E A;  3CBO A;  4QQI A;  2BTD A;  4APF A;  3ASF A;  1E7U A;  5JHB A;  2XEH A;  3AU4 A;  3CVY A;  3C98 A;  5HQ8 A;  4F3V A;  3TAX A;  4E6H A;  3BQO A;  3PUK A;  2X6F A;  5G04 C;  5B1A E;  2AWI A;  3TXN A;  4A1G A;  4EZJ A;  4NQ0 A;  3PNL B;  3EIJ A;  1MHQ A;  4I6E A;  3APF A;  4HLL A;  3O48 A;  3PZD A;  2H6F A;  4AY6 A;  2RD0 A;  3MV2 B;  2PL2 A;  5AQ9 A;  3KEA A;  4I17 A;  4HOQ A;  4QEP A;  1N0R A;  2A5U A;  3L22 A;  4C0E A;  3ZYM A;  3MKR A;  3UM3 A;  2ETA A;  4YVQ C;  2IO3 C;  1S0P A;  1FVF A;  3D9H A;  1HS6 A;  3SO8 A;  4N3B A;  2LSV A;  5JIN A;  1H2V C;  2IF4 A;  5A7D B;  1OWL A;  4HB5 A;  2ZGD A;  5AQB A;  1A17 A;  1OWN A;  2L0I A;  1H2T C;  4O60 A;  3CHQ A;  5CED B;  1ZBP A;  4G8L A;  5JIY A;  2LNI A;  4HBD A;  2G46 A;  4N3C A;  5EG2 A;  3AG4 E;  4L9P A;  3B7T A;  3Q7F A;  3PZ4 A;  3CVL A;  1DVP A;  3ABM E;  3UQ3 A;  2KXP C;  4GPK A;  3K5K A;  4UI9 J;  3IKO B;  5AN8 A;  1QNF A;  3CK8 A;  3UT8 A;  5CMY A;  3RJW A;  3L13 A;  2DIW A;  3CST A;  3ABK E;  3TL5 A;  1Y6I A;  3FDH A;  3UM1 A;  4FUL A;  1FPP A;  4F1P A;  1MYO A;  3UIO C;  1N9A A;  5FZQ A;  2W5Y A;  1ZU2 A;  5JMN D;  2OV8 A;  1H6P A;  4XIF A;  3EHR A;  3ZNG A;  3ZYK A;  2BQZ A;  5ANL A;  4TXP A;  1TR4 A;  1MVH A;  1OCZ E;  2WXF A;  4JW1 A;  2X3M A;  4U8Y D;  3UKU G;  4IJ8 A;  2O8J A;  1OWO A;  3UM0 A;  1FT1 A;  1JUQ A;  2VGX A;  5CMW A;  3UUX A;  1XGW A;  3SF4 A;  5ENQ D;  3RRM B;  3TWU A;  1IXV A;  1HFA A;  5G55 A;  2HO1 A;  3SZ7 A;  4EHM A;  4KZ0 A;  3IHX A;  4XX5 A;  5KNG A;  3M54 A;  3Q73 A;  3UT7 A;  1Z3X A;  2VSO E;  5CCM A;  1Z3Y A;  4BT8 A;  5CPR B;  3U4T A;  3WXX A;  2F37 A;  3ULY A;  4FHJ A;  2I9C A;  2DBA A;  3TWW A;  3ZUV B;  4JDS A;  2XCC A;  2P9K G;  4FP7 A;  2MHK A;  4DX6 D;  2J49 A;  2NC9 A;  4I1M A;  4N2Q A;  4UWH A;  4NIK A;  1OT8 A;  3ULQ A;  2HE0 A;  2ZU6 B;  4UI9 C;  3SW9 A;  3TG5 A;  3FTZ A;  5F5E A;  3G2V A;  1OCC E;  2KCL A;  1H19 A;  4ILG A;  3QWW A;  3DST A;  5CHE E;  3E4B A;  3GW4 A;  2KZT B;  1BLX B;  1QZ2 A;  3LVQ E;  5JHA A;  2AVP A;  1Q2Z A;  5BXO A;  3KMJ A;  4OAU C;  1OWM A;  4WUY A;  2P9L G;  3AS8 A;  2F69 A;  4YDW A;  1PAQ A;  4XI0 A;  4OAV B;  4JHJ A;  2GRO B;  2FF4 A;  4FJZ A;  4GCN A;  3HG0 D;  4G24 A;  4DI3 A;  1N4P A;  2KCK A;  3TGO A;  4I6G A;  5EX0 A;  1JCR A;  5BUZ A;  1W3B A;  1BD8 A;  4C9B B;  3ONK A;  1NL4 A;  2XEN A;  3PZ3 A;  4GYW A;  5FQ8 A;  4CGV A;  3M57 A;  3EDT B;  3FPD A;  5BV1 A;  4WNG A;  3X2Q E;  2Y3A A;  4GZ6 A;  3T9K A;  4KYO B;  3MEK A;  4DX2 A;  3TXM A;  2XPY A;  4CDR A;  5F59 A;  5FWQ A;  2JLB A;  4U8H A;  1SW6 A;  2AXZ A;  3RSE G;  3G2T A;  5EN5 D;  3BO5 A;  2BUG A;  2J4B A;  3J5P A;  4JC8 A;  5ENS D;  5T8I A;  2P9I G;  3IV0 A;  1PEG A;  1MX2 A;  3FTX A;  4KVO A;  1N4R A;  3IHY A;  2PNN A;  4J8S A;  2WQ6 A;  2IFU A;  2AJA A;  3VTX A;  3F9X A;  4G23 A;  3L6A A;  3VLD A;  4BEP A;  3RIB A;  1D9S A;  1MJ0 A;  4FC8 A;  3AS5 A;  2F8X K;  5FIN A;  4TRQ A;  2V8S E;  4XKC A;  2VQ2 A;  4AV7 A;  2GRP B;  3FU5 A;  1U2V G;  2F8Y A;  2V5Q C;  4JVS A;  5A23 A;  5HI7 A;  4CDN A;  3NAW A;  5D0O D;  4YNM A;  3RO2 A;  4LUN U;  2XQ0 A;  3S2A A;  3CHO A;  2A5E A;  3HXE A;  4J7I A;  2CFZ A;  4CDM A;  5G05 J;  2R05 A;  1E8Z A;  4F53 A;  2IOS A;  2XRZ A;  4JHR A;  1AWC B;  3PEU B;  1GW6 A;  3V79 K;  2FBN A;  3DWL G;  1G3N B;  3RK6 A;  3UKR G;  2LAH A;  2YIN A;  4WND A;  3Q5M A;  4GTT A;  4A1S A;  1WY6 A;  2LXM A;  3ZN3 A;  3FP3 A;  1HZ4 A;  3DPD A;  3M59 A;  5BT1 A;  5G2N A;  3ASN E;  1IKN D;  4BSX A;  3ZYQ A;  4BFR A;  4HOR A;  1D8E A;  3Q75 A;  1TN7 A;  3K9I A;  3FFL A;  3EHN A;  4J83 A;  5KNH D;  1LTX A;  3I4G A;  4HOU A;  4WWN A;  3V2X A;  4N5C A;  1XNF A;  2XRY A;  4RZ0 A;  4PS7 A;  5CER B;  4DI4 A;  2JEK A;  3AG1 E;  4FLB A;  3FUJ A;  3Q49 B;  2BED A;  3FWV A;  2KZT A;  5TTF A;  1KZP A;  4U0Z A;  3AJI A;  2WMN A;  4DX7 D;  3LCA A;  4RSY A;  4XZ4 A;  2ZXW E;  1FVH A;  3UT4 A;  2JV0 A;  1TYQ G;  3KAE A;  5JA4 D;  1ELR A;  3UPV A;  4YND A;  3VLF A;  1FCH A;  5EX3 A;  2Y69 E;  3ZXS A;  1SVX A;  2IJG X;  3LS8 A;  4B0Z A;  4K0R A;  2ZIS A;  3MKQ B;  3BUA A;  5CEC B;  4ANU A;  2J07 A;  2PM7 A;  5D2M C;  5FQ6 A;  3OXG A;  5LFA A;  1E90 A;  2RFA A;  4RVB A;  3W9F A;  3ZGQ A;  1EDU A;  2ETC A;  5J90 A;  1VDY A;  4DX1 A;  1OCO E;  4GYO A;  5FJY A;  3FUK A;  2UY1 A;  3UX4 A;  2QYU A;  1HU3 A;  5G05 C;  2NSZ A;  2KAT A;  3URZ A;  4B89 A;  2PQR A;  2I6H A;  1SZA A;  4EZK A;  3OS5 A;  3FU3 A;  2H6G A;  3PDN A;  1Y8M A;  1TJC A;  3CR3 A;  3RRU A;  3Q7A A;  4KVM A;  5JJ6 A;  2P9U G;  5EYP F;  3DRA A;  3L9T A;  1TNZ A;  3T8K A;  1HF8 A;  4GZD A;  2LAI A;  4NAC A;  1TJF A;  3CQG B;  1INZ A;  4GYY A;  4FMU A;  4Z4P A;  3HXC A;  4AP2 A;  2R3A A;  4JHK A;  1EYH A;  4CEM A;  3I3N A;  1SA4 A;  1DCE A;  3QC1 A;  3CVV A;  3FEY A;  4A55 A;  4UWK A;  3L54 A;  5A6C A;  2AW6 A;  3ZEF A;  1PC2 A;  3EIQ C;  2QY7 A;  2ZGG A;  3CLJ A;  2QYJ A;  1IQU A;  3JXJ A;  4GML A;  4K5B A;  3FTS A;  5HRY A;  4DRX E;  4B93 B;  4HVB A;  4ATG A;  3VV0 A;  4AIF A;  4FHK A;  4QEO A;  3F9W A;  4HI8 A;  4Y6C A;  2IOL A;  2VYI A;  4GZC A;  4H12 A;  3I4R B;  4O1O A;  3JXI A;  1X81 A;  3KMA A;  1JCS A;  2FI7 A;  3TWS A;  5M72 A;  4NVQ A;  1MVX A;  2QC9 A;  4XI9 A;  4JD2 G;  3TWV A;  4D10 C;  2DYR E;  3DAL A;  1FT2 A;  3NQP A;  3EU9 A;  2B0O E;  3HHM A;  4L1B A;  4ME2 A;  5FTP A;  1RZ4 A;  4J8O A;  5HS0 A;  1V54 E;  4K5C A;  4CT4 A;  1IHG A;  4E85 A;  3MO5 A;  2HM8 A;  4GTR A;  4PS3 A;  2NXP A;  3CK7 A;  3C3Q A;  2HYZ A;  5AAO A;  4G1T A;  1HH8 A;  4H7Y A;  2V4L A;  1N95 A;  2FEZ A;  3R7R A;  3DXK G;  2QZA A;  3SBS A;  5T0K A;  2VGY A;  5AQA A;  2XEE A;  2P9P G;  2XZD G;  1K8K G;  5HKP A;  2CG3 A;  4JA7 A;  2P9S G;  3DSV A;  3Q78 A;  2WXG A;  3E30 A;  2CFU A;  4NJ5 A;  2IO2 C;  1Z5S C;  3AU5 A;  3EJN A;  3SBT B;  1V55 E;  2J9Q A;  5FT9 A;  4LG6 A;  1IQR A;  3D9P A;  3AAA C;  1S70 B;  3BEE A;  3MKQ A;  3E32 A;  4AOF A;  2WVI A;  3IBE A;  3SFX A;  3L16 A;  5BPP A;  3CVX A;  5AYF A;  1TNY A;  4UWF A;  4LER A;  4HRL A;  4EZL A;  3B7R L;  4KXK B;  4IRU A;  2WXL A;  2P9N G;  2P2C P;  3CVQ A;  1O1R A;  2IQC A;  4JB8 P;  4RG9 A;  2VSX E;  4I43 A;  3ASD A;  1B89 A;  2R17 C;  3T5X A;  3IHV A;  1UJK A;  1ZB1 A;  4RG6 A;  3QKY A;  3NF1 A;  2Y4T A;  2OEV A;  2GRL A;  4TV3 A;  4GTS A;  3QNK A;  4J6I A;  1N6A A;  5BNW A;  2KBX A;  4J8D A;  1PY1 A;  4UI9 K;  1HG2 A;  1QBQ A;  2E0I A;  4YPE A;  1WDY A;  1H6K A;  2R59 A;  4IUL A;  4Q96 A;  4LSZ E;  4EEC A;  4XKB A;  1OXJ A;  4CYM D;  2L6J A;  2XS8 A;  1OCR E;  2CHX A;  3MV3 B;  2XZT G;  4GA0 A;  4GZ5 A;  2WQH A;  4YPU A;  3O4Z A;  3C3O A;  3BU8 A;  4E47 A;  3G2S A;  3I5P A;  2MYO A;  3QJZ A;  2C2L A;  2HR2 A;  3CIA A;  1TNB A;  1HG5 A;  3RJV A;  5ENP D;  4B94 A;  2GRM A;  1U3C A;  5ARG A;  3DXM G;  4EPZ A;  3DSS A;  5ENO D;  4OVU A;  4YPA A;  1D8D A;  3MCX A;  4I1O B;  1K3Z D;  4OVV A;  2WXI A;  4WWP A;  4FAD A;  4LNU D;  2WXN A;  3ML9 A;  1BI7 B;  3DPY A;  1E8W A;  3FTW A;  2GW1 A;  5E75 A;  4ACL A;  4CCA A;  1N0Q A;  5EDS A;  2XS1 A;  5CRV A;  1MZC A;  3UIP C;  2UY1 B;  4M3O A;  5FIO A;  2DZO A;  5LX8 A;  4JA9 A;  3B7U X;  3PRE A;  3AG2 E;  1O1S A;  4GTQ A;  2R2L A;  3CGH A;  2FUL A;  3E33 A;  2X6I A;  4G25 A;  5AJD A;  5KJL A;  3CBP A;  4TXR A;  3D9J A;  4GZ3 A;  5CRU A;  2EIL E;  1SA5 A;  4Y6W A;  4QEN A;  3PEV B;  4G2V A;  3U9W A;  4MKT A;  3NB2 A;  4GTV A;  3PRZ A;  3CHR A;  1A5E A;  3F6Q A;  2W5Z A;  1WAO 1;  4U8V D;  4FA6 A;  4DLO A;  5KWD A;  5KCM A;  2BF0 X;  2VTB B;  3QOU A;  4BER A;  4A3V A;  4GA1 A;  2MOW A;  3NBN B;  1P5Q A;  5T4Y A;  3PE4 A;  2DZN A;  4ILI A;  1NZN A;  3MX3 A;  3ABL E;  3S7F A;  2KM4 A;  4FLH A;  4GPM A;  1TNU A;  2FO1 E;  3NOG D;  5CEA A;  4U04 A;  4CRW A;  4PDX A;  4L7T A;  3FTV A;  4XE0 A;  4W9R A;  4N39 A;  5FZS A;  1E8Y A;  5KJK A;  1TN8 A;  3ESK A;  4G11 A;  4YVO A;  1MT6 A;  3PUJ A;  1MUF A;  1N52 A;  1U3D A;  3UMV A;  3LYA A;  2MRI A;  2OND A;  3FH5 A;  4FU3 A;  4B8A A;  1YYH A;  4URK A;  4C1Q A;  3S7B A;  1HE8 A;  5C2Y A;  1E8X A;  4HRN A;  4BX8 A;  3Q9N C;  3EU5 A;  3U66 A;  4XEI G;  3U64 A;  4UWG A;  3V30 A;  2X6J A;  2BKK B;  3ZYL A;  2V5F A;  4U0U A;  2IEJ A;  3UTM A;  3Q79 A;  4JL0 A;  2X6H A;  5G04 J;  3PZ2 A;  4A63 B;  1AP7 A;  5JJT A;  4M7C A;  3FEX A;  3MYV A;  4IJD A;  1N4Q A;  3TWR A;  2QPW A;  3OXL A;  4BX9 A;  3LEW A;  4LNG A;  1MQS A;  1K1A A;  4BTB A;  4JLG A;  4ANX A;  5KJN A;  3S7D A;  5CCL A;  4LCT A;  3KD7 A;  4MI5 A;  3ASG A;  3ML8 A;  4G26 A;  3B13 A;  3QB2 A;  3CKB A;  4FJY A;  4AU7 A;  1UOH A;  3CQC B;  3M58 A;  1X5B A;  3HNA A;  4YDE A;  1WM5 A;  3ZU7 B;  1N6C A;  4GMJ A;  5AAR A;  3QAQ A;  2PZI A;  5FZR A;  5BXU A;  3BG0 B;  2H6H A;  3F9Z A; 
#chains in the Genus database with same CATH homology
 5JJ0 A;  3NQP A;  2XGS A;  4DJA A;  5DIZ A;  3MO2 A;  4EQF A;  3RRN B;  3ULQ A;  5JHN A;  4EBA G;  3HHM A;  4L1B A;  4ME2 A;  5FTP A;  2ZU6 B;  4UQY A;  4J8O A;  4UI9 C;  3SW9 A;  3TG5 A;  3FTZ A;  5F5E A;  3G2V A;  4I2W A;  2OVB A;  4AY5 A;  1EF1 C;  3S7J A;  2KCL A;  2XEV A;  4CT4 A;  1H19 A;  4ILG A;  1IHG A;  4E85 A;  3QWW A;  3JCK C;  4CGW A;  4LDG A;  4OYS A;  5CHE E;  4YNP A;  3E4B A;  3GW4 A;  3ZW3 A;  2KZT B;  3MO5 A;  1QZ2 A;  3LVQ E;  5LSZ A;  1E7V A;  2AVP A;  2HM8 A;  5JHA A;  1JPL A;  2YHE A;  1BPO A;  4PS3 A;  2NXP A;  4GAA A;  1ML9 A;  3CK7 A;  3KMJ A;  3FUM A;  2X6K A;  1OWM A;  1DNP A;  1OUV A;  3LY8 A;  3SD5 A;  5KJM A;  4WUY A;  2HYZ A;  5FQ7 A;  4BTA A;  4WAF A;  3ZRH A;  4HOS A;  1ELK A;  4I9C A;  3CVN A;  3FUN A;  4G1T A;  1HH8 A;  3AS8 A;  2F69 A;  3VUZ A;  2YHC A;  1PAQ A;  2KC7 A;  4H7Y A;  2V4L A;  3FTY A;  4XI0 A;  3KEZ A;  3ONL A;  4JHJ A;  1XQH A;  4AXH A;  2FEZ A;  3S8P A;  3CK9 A;  2FF4 A;  4FJZ A;  3R7R A;  1QQE A;  4HFG A;  2VSY A;  4GCN A;  3CVP A;  3FUL A;  4MI0 A;  3U3W A;  2WXO A;  4N2S A;  3GZS A;  4G24 A;  5EKQ D;  4DI3 A;  5AEN A;  3SBS A;  3CHS A;  2KCK A;  3TGO A;  2WMO A;  5T0K A;  4I6G A;  3AS4 A;  5EX0 A;  4R7L A;  3NZU A;  2A4Z A;  2VGY A;  3HVE B;  2J08 A;  4PH4 B;  2XPI A;  3D9O A;  2L9B A;  2UWJ G;  3VLE A;  4F1S A;  1W3B A;  5BUZ A;  1HO8 A;  3SI5 A;  1N54 A;  4C9B B;  2CG3 A;  2ION A;  4JA7 A;  4WNE A;  3ONK A;  4AVX A;  4QFV A;  2YNQ A;  3RQ4 A;  2WXG A;  3IEG A;  4GYW A;  3D9N A;  2CFU A;  4NJ5 A;  4GA2 A;  5FQ8 A;  4UQX A;  4CGV A;  3VTY A;  3M57 A;  4GU5 A;  3AU5 A;  3EDT B;  3EJN A;  5AIJ A;  2FO7 A;  3FPD A;  3SBT B;  1HX8 A;  1H0A A;  2J9Q A;  4WNG A;  5BV1 A;  4K03 A;  3DBS A;  2Y3A A;  5FT9 A;  3TG4 A;  4GZ6 A;  1IQR A;  3D9P A;  3G2W A;  3RKV A;  3PH0 C;  3RO3 A;  3MO0 A;  3JUI A;  4L2L A;  3BEE A;  4KYO B;  2XGO A;  3MEK A;  2V0P A;  3MKQ A;  3R9A B;  4LEU A;  3TXM A;  3CV0 A;  4L23 A;  2XPY A;  4AOF A;  2J09 A;  4CDR A;  2WVI A;  5F59 A;  3OAW A;  3ZHE A;  4IN3 B;  3IBE A;  4U0S A;  2AXU A;  5FWQ A;  3L16 A;  5BPP A;  3CVX A;  2AXV A;  2JLB A;  3FUE A;  3P2B A;  3Q47 B;  4P29 A;  3MGB A;  4U8H A;  1E96 B;  2VTB A;  2E2E A;  4LRZ A;  4UWF A;  4LER A;  5TEG A;  1NP7 A;  2AXZ A;  3QAR A;  4WNF A;  3OOI A;  4EZL A;  3SHF A;  4AEZ C;  3HDX A;  3B7R L;  4KXK B;  4F7A A;  3G2T A;  2WXL A;  3CVQ A;  4IRU A;  4UWL A;  5BW8 C;  3APD A;  2LSU A;  2IQC A;  3BO5 A;  2BUG A;  2J4B A;  3GZ1 A;  2I1K A;  1UJJ A;  4RG9 A;  4HS2 A;  4JC8 A;  5T8I A;  2VSX E;  2QFC A;  4I43 A;  3PS6 A;  3ASD A;  3FU0 A;  1B89 A;  3CVU A;  3IV0 A;  4CT0 A;  3APC A;  2R17 C;  5LOZ A;  3IHV A;  3T5X A;  1PEG A;  3CBM A;  2LO6 A;  3EP0 A;  5F6L A;  1YA0 A;  4NUR A;  3JQ1 A;  1UJK A;  3D9L A;  3FTX A;  4KVO A;  3ASH A;  3IHY A;  4J8S A;  1SZ9 A;  2C0L A;  4RG6 A;  2OVF A;  5TH7 A;  3QKY A;  3NF1 A;  2Y4T A;  2WPV A;  3FTU A;  2GRL A;  2IFU A;  3LPZ A;  3VTX A;  4ANW A;  3QWV A;  4TV3 A;  4JPS A;  5LP0 A;  3QNK A;  4J6I A;  3F9X A;  4G23 A;  3GYZ A;  3Q4A B;  4WWO A;  4I6J A;  1N6A A;  3N71 A;  3L6A A;  5BV0 A;  3QWP A;  3VLD A;  2PQN A;  3OTN A;  4GB9 A;  3RIB A;  5BNW A;  4ILH B;  3FUD A;  4APO A;  3M53 A;  4FC8 A;  3AS5 A;  4J8D A;  1PY1 A;  4J8F A;  4UI9 K;  2IGQ A;  1HG2 A;  1L5J A;  3BG1 B;  2E0I A;  4TRQ A;  4YPE A;  2Q7F A;  1H6K A;  2R59 A;  2V8S E;  2WXK A;  3GZ2 A;  2ILR A;  2VQ2 A;  3HVE A;  4MS6 A;  4XKC A;  5DBK A;  4AV7 A;  3JYS A;  4IUL A;  3FU5 A;  4Q96 A;  4BWR A;  2VGX B;  2OOE A;  4EEC A;  3PNT B;  4Q94 A;  4XKB A;  3LXU X;  2I1J A;  3LJ3 A;  4JVS A;  5A23 A;  3SFZ A;  2L6J A;  5HI7 A;  4CDN A;  3CHM A;  4I2Z A;  3RU0 A;  4IYP A;  5D0O D;  2WXR A;  2CHX A;  3KS2 A;  2WXQ A;  3MV3 B;  4U07 A;  3CHP A;  4A3T A;  4YNM A;  3RO2 A;  4GA0 A;  4GZ5 A;  4U63 A;  2WQH A;  4YPU A;  2M63 A;  1O9S A;  1H2U A;  3O4Z A;  4KMO A;  4LUN U;  5J08 A;  4J7F A;  1JWG A;  2XQ0 A;  3QK0 A;  4E47 A;  3G2S A;  3S2A A;  3D9M A;  3I5P A;  3QDN A;  1KT0 A;  3B7S A;  3CHO A;  3L08 A;  3LVR E;  3QJZ A;  3T5V A;  2C2L A;  4KT6 B;  2HR2 A;  5LSX A;  1UG3 A;  3ZVV A;  3CIA A;  4AM9 A;  4PS8 A;  4ACK A;  5AJL A;  5ARF A;  3SGH A;  4J7I A;  1HG5 A;  1HXI A;  2CFZ A;  4J8E A;  3RJV A;  3CBO A;  2BTD A;  4B94 A;  4APF A;  2GRM A;  4CDM A;  5G05 J;  3F9Y A;  1U3C A;  3RAY A;  1E8Z A;  3ASF A;  5ARG A;  4MRU A;  1E7U A;  4F53 A;  2IOS A;  5JHB A;  2IU1 A;  4DPR A;  4EPZ A;  2XRZ A;  3AU4 A;  3D9K A;  4JHR A;  4HLE A;  3CVY A;  3PEU B;  1GW6 A;  2C0M A;  2FBN A;  4OVU A;  4YPA A;  3C98 A;  3ESL A;  2WXH A;  5HQ8 A;  3RK6 A;  3CVW A;  3MCX A;  4H7X A;  2LAH A;  4F3V A;  4I1O B;  2YIN A;  3MZL B;  4WND A;  3FH8 A;  3TAX A;  3Q5M A;  4OVV A;  4ANV A;  4A1S A;  1WY6 A;  4E6H A;  2WXI A;  3PUK A;  3ZN3 A;  2GGF A;  3OXF A;  3FP3 A;  4WWP A;  2X6F A;  5JJ7 A;  1HZ4 A;  1Z6T A;  5G04 C;  3PE3 A;  4KBQ A;  1UN9 A;  3DPD A;  4FAD A;  3M59 A;  4DLQ A;  5BT1 A;  3R7Q A;  2AWI A;  3TXN A;  4A1G A;  5G2N A;  1UN8 A;  2PM6 A;  2WXN A;  3ML9 A;  4NQ0 A;  4EZJ A;  3PNL B;  4BSX A;  3ZYQ A;  3EIJ A;  3HIZ A;  4J0U A;  1E8W A;  1MHQ A;  3FTW A;  4BFR A;  2GW1 A;  4I6E A;  4HOR A;  5E75 A;  4ACL A;  4CCA A;  3APF A;  2XPZ A;  3O48 A;  5EDS A;  3PZD A;  3P1U A;  3MJW A;  3K9I A;  4AY6 A;  4BY6 A;  2UY1 B;  2RD0 A;  3EHN A;  3FFL A;  3MV2 B;  2PL2 A;  3NZS A;  4M3O A;  4J83 A;  1N3J A;  3I4G A;  4HOU A;  4I17 A;  2WB2 A;  4WWN A;  1TEZ A;  4N5C A;  1XNF A;  2XRY A;  4HOQ A;  4RZ0 A;  5LX8 A;  4QEP A;  4I51 A;  4JA9 A;  4PS7 A;  2A5U A;  3L22 A;  2JEK A;  3B7U X;  3MKR A;  3PRE A;  3ZYM A;  4C0E A;  4DI4 A;  2CHW A;  5C1D A;  2X38 A;  4FLB A;  1LF8 A;  3FUJ A;  2WXJ A;  2WQ6 A;  3Q49 B;  4YVQ C;  3FWV A;  2KZT A;  4KZC A;  5TTF A;  3CGH A;  3LKU A;  2FUL A;  4PUC A;  2X6I A;  4HXI A;  4U0Z A;  3D9I A;  1S0P A;  1FVF A;  3EHM A;  4G25 A;  4TUU A;  3M5A A;  4BUP A;  4GCO A;  5AJD A;  1HS6 A;  2WMN A;  5ENN A;  5LCW J;  3LCA A;  2L0T B;  5T0M A;  4RSY A;  5KJL A;  4N3B A;  3CBP A;  2LSV A;  3MA5 A;  4XZ4 A;  3D9J A;  4GZ3 A;  1FVH A;  3UT4 A;  5JIN A;  1H2V C;  5AYF A;  2IF4 A;  2JV0 A;  5A7D B;  1JWF A;  3KAE A;  4Y6W A;  4QEN A;  1OWL A;  3PEV B;  1ELR A;  3L17 A;  4G2V A;  4EBA A;  3UPV A;  4YND A;  3VLF A;  3FHE A;  1FCH A;  5EX3 A;  1A17 A;  2KCV A;  1OWN A;  3ZFW A;  2L0I A;  3FUI A;  3U9W A;  1H2T C;  3ZXS A;  4MKT A;  4JEH A;  3PRZ A;  3CHR A;  2EQX A;  4NRH B;  2IJG X;  3LS8 A;  2W5Z A;  3CHQ A;  1ZBP A;  1WAO 1;  2RFI A;  4B0Z A;  4FA6 A;  4K0R A;  5JIY A;  3MKQ B;  4DLO A;  5T5G A;  2LNI A;  4ANU A;  2J07 A;  2PM7 A;  3DB5 A;  1ELW A;  4O30 A;  3ZHE B;  5KCM A;  2YQ8 A;  2G46 A;  4N3C A;  5FQ6 A;  5EG2 A;  3OXG A;  5LFA A;  2BF0 X;  1ZKK A;  2VTB B;  3LDZ A;  4I9E A;  3B7T A;  3LY7 A;  3QOU A;  1E90 A;  4A3V A;  4GA1 A;  3CVL A;  2MOW A;  2RG8 A;  1P5Q A;  1DVP A;  4RVB A;  5T4Y A;  2Y4U A;  3PE4 A;  3UQ3 A;  4ILI A;  4GPK A;  1NZN A;  3MX3 A;  3ZGQ A;  3S7F A;  2KM4 A;  1EDU A;  4FLH A;  3K5K A;  3FU6 A;  4UI9 J;  5J90 A;  1VDY A;  3IKO B;  4JEU A;  1QNF A;  3OPE A;  3CK8 A;  3FH7 A;  4GYO A;  5CMY A;  3UT8 A;  4U04 A;  5FJY A;  4CRW A;  3RJW A;  3ZPJ A;  3L13 A;  4PDX A;  4L7T A;  3FUK A;  2UY1 A;  5D0Q D;  3FTV A;  3UX4 A;  2DIW A;  3CST A;  4XE0 A;  4W9R A;  1HU3 A;  4N39 A;  5G05 C;  3TL5 A;  2NSZ A;  4V3I A;  5FZS A;  1E8Y A;  2KAT A;  2DCP A;  3URZ A;  4B89 A;  2PQR A;  2I6H A;  1SZA A;  1Y6I A;  3FDH A;  2VJ8 A;  4FUL A;  4EZK A;  5KJK A;  3SNX A;  3ESK A;  3OS5 A;  2WXP A;  3FU3 A;  4G11 A;  4YVO A;  3KMT A;  1EPU A;  3PDN A;  5E76 A;  1MT6 A;  5FZQ A;  3PUJ A;  1Y8M A;  1N52 A;  1TJC A;  1U3D A;  1ZU2 A;  3CR3 A;  4UQZ A;  3RRU A;  1MUF A;  2W5Y A;  3UMV A;  3LYA A;  4KVM A;  2MRI A;  2OND A;  5JJ6 A;  2OV8 A;  3FH5 A;  4FU3 A;  5F6K C;  1NA3 A;  4XIF A;  4B8A A;  4URK A;  4C1Q A;  1HF8 A;  3S7B A;  4GZD A;  2LAI A;  1HE8 A;  4NAC A;  1TJF A;  3ZYK A;  3CQG B;  2BQZ A;  5C2Y A;  5ANL A;  1E8X A;  4BX8 A;  1MVH A;  3M56 A;  1INZ A;  2WXF A;  1UW4 B;  4GYY A;  3U66 A;  4FMU A;  2VSN A;  3FUH A;  4BT9 A;  4JW1 A;  3U64 A;  4UWG A;  4Z4P A;  4AP2 A;  2R3A A;  3PVL A;  2CG2 A;  4JHK A;  3ZIM A;  3SWC A;  2X6J A;  1EYH A;  2P58 C;  2X3M A;  5AYW D;  2XHE A;  4IJ8 A;  3Q15 A;  4CEM A;  3ZYL A;  3LY9 A;  4ABN A;  2V5F A;  2O8J A;  1OWO A;  3G2U A;  4U0U A;  2WXM A;  3I3N A;  4JL0 A;  1JUQ A;  2X6H A;  3M55 A;  2VGX A;  5G04 J;  5CMW A;  1IYG A;  3CKC A;  3UUX A;  1XGW A;  3QC1 A;  4C0M A;  5JJT A;  2I2O A;  4Q69 A;  3ENE A;  3FEX A;  3SF4 A;  3RRM B;  3CVV A;  3FEY A;  3MYV A;  5G55 A;  1HFA A;  3TJP A;  4A55 A;  2HO1 A;  3L54 A;  4UWK A;  3SZ7 A;  4IJD A;  3HYM B;  4KZ0 A;  5A6C A;  3IHX A;  2AW6 A;  3FUF A;  1PC2 A;  4XX5 A;  3ZEF A;  3M54 A;  3EIQ C;  3T8M A;  1H3I A;  2QY7 A;  3UT7 A;  2WM9 A;  1Z3X A;  2VSO E;  3CLJ A;  2QPW A;  3OXL A;  4BX9 A;  2J4D A;  1IQU A;  3LEW A;  1Z3Y A;  4N3A A;  1MQS A;  4BT8 A;  5CCM A;  5LCW C;  5CPR B;  4GML A;  3FTS A;  3U4T A;  4BTB A;  4JLG A;  4ANX A;  4L2Y A;  4MLP A;  3WXX A;  5KJN A;  3D3M A;  3S7D A;  2XCB A;  2CHZ A;  4O6F A;  4HVB A;  5CCL A;  4LCT A;  3KD7 A;  3CSF A;  4B8C B;  2XGM A;  4ATG A;  3VV0 A;  4FHJ A;  4MI5 A;  3ASG A;  4AIF A;  3ML8 A;  4FHK A;  4QEO A;  2I9C A;  2DBA A;  5FQ4 A;  3F9W A;  4G26 A;  1KLX A;  1KT1 A;  1SQM A;  3B13 A;  3QB2 A;  4Y6C A;  3CKB A;  4HOT A;  2IOL A;  4FJY A;  4AU7 A;  4JDS A;  2VYI A;  4GZC A;  4H12 A;  3I4R B;  2XCC A;  1NA0 A;  3CQC B;  3M58 A;  3JQ0 A;  3KMA A;  3CEQ A;  2FI7 A;  4FP7 A;  1X5B A;  4DK5 A;  5M72 A;  4JZY A;  4NVQ A;  2MHK A;  1MVX A;  3HNA A;  5ANR A;  1OWP A;  2J49 A;  1WM5 A;  2NC9 A;  3FY4 A;  4I1M A;  4N2Q A;  4XI9 A;  1N6C A;  4GMJ A;  4UWH A;  4AJW A;  4JXT A;  4D10 C;  3QAQ A;  5T3R A;  2WQ7 A;  2R5S A;  2PZI A;  4I1A A;  5FZR A;  3BG0 B;  3DAL A;  3F9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...