3S7FA

Structural basis of substrate methylation and inhibition of smyd2
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
429
structure length
429
Chain Sequence
b'GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Structural Basis of Substrate Methylation and Inhibition of SMYD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 152
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3s7fA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s7fA01
4GCNA 4GA1A 3MV3B 5KJMA 3OXGA 4IJ8A 3LKUA 5HQ8A 2UY1B 1TJCA 5G04C 2FEZA 2JV0A 5AYFA 5JINA 3GW4A 3EP0A 1A17A 4YNMA 5LCWJ 2QFCA 4J83A 3QOUA 3IEGA 2KCLA 4NRHB 2LNIA 3LPZA 3BEEA 4JDSA 2C0LA 1NA3A 5EX3A 3CKBA 3ASHA 2J9QA 5D0QD 3Q15A 2HO1A 4JA7A 4GCOA 3QDNA 2AVPA 3URZA 4XI0A 1ELRA 1ZU2A 3UPVA 4I9EA 5F59A 3CK8A 2LSVA 2ONDA 3KAEA 3RJWA 2VSNA 5ARFA 3ZN3A 2RFIA 4GA2A 5ARGA 5CPRB 5JJTA 3CBMA 2C0MA 4J7FA 3DB5A 5KJLA 3CVPA 1IYGA 4BT9A 2Q7FA 4H12A 2Y4TA 3ZHEA 5G04J 5TTFA 3MKRA 4GPKA 4N3CA 3EDTB 1NZNA 4UQXA 3KMJA 3ASDA 2QPWA 1N3JA 2YQ8A 2XPIA 4N3AA 2DBAA 5TH7A 4WNEA 4YVQC 4IJDA 3AS4A 3RJVA 2BUGA 2KCKA 2VQ2A 4KXKB 3CBPA 4UI9C 1FCHA 3U4TA 4GZ5A 3M53A 3KMAA 3SW9A 3HNAA 4YPEA 2R5SA 3MEKA 3MO0A 3ESKA 4KBQA 5CCLA 3OPEA 4G2VA 2PZIA 5F6KC 3LY8A 4AIFA 1HH8A 3Q4AB 5TEGA 4J8FA 3LY9A 2NC9A 4UI9K 3F9WA 4YPAA 4I2ZA 5CHEE 5FZSA 2VGYA 1PC2A 3KS2A 4GZ3A 4I1AA 4HOTA 4J8OA 4JLGA 4N2QA 4ABNA 3RQ4A 4WNDA 3M54A 1WM5A 4I9CA 3CK9A 4LDGA 2P58C 4AY5A 4RG6A 5EKQD 2E2EA 3TG5A 4N39A 4NVQA 4ME2A 1IHGA 1W3BA 4N2SA 2HYZA 4GYWA 4MI5A 5FZRA 4BWRA 4HORA 5FZQA 3RIBA 3LCAA 3MO2A 3HYMB 5FT9A 2FF4A 3RO3A 2FBNA 4YNDA 4WUYA 1ML9A 1MT6A 2LSUA 5G05J 1WAO1 1KT1A 3CV0A 3PDNA 5LSXA 3OXLA 4F3VA 4XI9A 1HXIA 2Y4UA 1MVXA 3RO2A 4Z4PA 2XGOA 4N3BA 1O9SA 5F5EA 2KCVA 3M57A 3TGOA 3Q49B 4W9RA 4QEPA 4A1SA 4I17A 1PEGA 2IFUA 4YNPA 3AS5A 4JHRA 4U0UA 3RU0A 3ZHEB 1ZBPA 1OUVA 3U3WA 5BNWA 3TG4A 3CKCA 3N71A 3O48A 5D0OD 3S8PA 4HOSA 3KMTA 4J7IA 5BT1A 3LYAA 3K9IA 5T0KA 4BTBA 1MUFA 2F69A 3ASGA 2IGQA 2I6HA 2XGSA 3OOIA 2L6JA 4U04A 3UUXA 1N6AA 3F9ZA 2IF4A 4YPUA 4GA0A 1YA0A 3KD7A 4H7YA 5LSZA 4IN3B 3MA5A 3VTXA 4QEOA 4CGVA 3K5KA 5FJYA 3WXXA 4I51A 3RAYA 4Y6WA 4JL0A 4G1TA 4HOUA 4GYYA 5F6LA 1ZKKA 4JA9A 1N6CA 2WPVA 2BQZA 3ULQA 1P5QA 4Y6CA 5FTPA 4EQFA 1H3IA 4BT8A 3R9AB 3CBOA 5JJ6A 2W5ZA 3PE4A 1HZ4A 3JYSA 4WNGA 4UI9J 5JJ0A 3MV2B 2FO7A 2FI7A 2VYIA 5CCMA 2MHKA 3FP3A 4GYOA 4J8DA 2C2LA 1E96B 3FPDA 4J8EA 2W5YA 4RG9A 1QQEA 3QWPA 3CVLA 2UY1A 2PQNA 3CK7A 4GZ6A 4N5CA 3ASFA 4U0SA 5KJKA 4HOQA 4BTAA 3OS5A 4FMUA 5EX0A 3CVQA 4UQZA 3E4BA 3M55A 3GZ1A 3AS8A 4NQ0A 2KATA 4G25A 4XIFA 5DIZA 3S7FA 4AU7A 2KC7A 4BUPA 3GYZA 4O30A 2PQRA 4QENA 5HI7A 2VSYA 4KYOB 3ZGQA 4RZ0A 5JHNA 3M56A 4YVOA 1KT0A 1B89A 4UQYA 4CGWA 3Q5MA 5AYWD 1MVHA 3QWVA 4C1QA 1XNFA 2YHCA 3VUZA 4CDRA 4WNFA 3LY7A 3S7BA 3OXFA 2G46A 1ELWA 5A6CA 3NF1A 3FWVA 2XCCA 5T5GA 4O6FA 5DBKA 2O8JA 3CVNA 3Q47B 3SF4A 1KLXA 4AM9A 3VTYA 5KJNA 3SWCA 5A7DB 5T0MA 1NA0A 4U0ZA 2VGXA 3F9YA 3ZFWA 3S7JA 3UQ3A 5EG2A 2VGXB 3ZPJA 2V5FA 1XQHA 3BO5A 3QKYA 2GW1A 5JIYA 4G24A 4G23A 2XCBA 3PE3A 2XEVA 3GZ2A 4G26A 5JJ7A 5BW8C 3VV0A 5LCWC 4J0UA 3M59A 4APOA 4B94A 2HR2A 3MO5A 3RKVA 2WQHA 3M5AA 3F9XA 5C1DA 1QZ2A 3QWWA 4LEUA 5G05C 3SZ7A 4AY6A 3FFLA 4I2WA 2R3AA 2XGMA 3S7DA 4H7XA 5M72A 3DALA 2OOEA 4U07A 3IHXA 3M58A 4NJ5A 2PL2A 2UWJG 1Y8MA 4E47A 3CEQA 4MI0A 2JLBA 3TAXA
chains in the Genus database with same CATH superfamily
4A63B 4GCNA 2P9UG 1D9SA 3MV3B 5B1AE 2GRMA 3ZRHA 1KZOA 4PDXA 3TWTA 5HQ8A 4JC8A 2FEZA 3G2UA 1JWGA 2EQXA 3QC1A 5AYFA 3TXMA 1Q2ZA 2IO3C 5JINA 3GW4A 4ANVA 1K3ZD 3JQ0A 3FTSA 2KCLA 2EIME 4NRHB 3LPZA 1UW4B 5EIDA 4JDSA 1NA3A 1SA5A 2OEWA 5D0QD 2HO1A 2AXUA 2AVPA 1ZU2A 5F59A 1G3NB 2ONDA 3KAEA 4WWNA 2ZIRA 4FLBA 4JHJA 5JJTA 2WXJA 3JUIA 2Y1LE 2XPYA 4Z68A 4L1BA 4IULA 5CBNA 3PH0C 2Y4TA 3V31A 3DSTA 3PZDA 1AWCB 2AXVA 3PVLA 1OWNA 1SW6A 4GTMA 2R03A 3VLFA 3ASDA 4MLPA 1MQSA 4XX5A 2QPWA 1DNPA 3DSUA 1N3JA 2WXHA 2CG3A 2XPIA 4N3AA 4AVXA 4WNEA 3T5XA 1K8KG 4IJDA 3AS4A 2KCKA 2VQ2A 4KXKB 3CBPA 4UI9C 3W9FA 1L5JA 2EIJE 4GZ5A 4ATGA 3L9TA 4GTOA 1N95A 3DSSA 1TN6A 4F6RD 3HHMA 3LY8A 4G11A 4PS8A 4YDOA 2NC9A 1EPUA 4YPAA 1PC2A 2WXPA 2P9NG 2QYUA 4UUCA 4N2QA 4ABNA 2NXPA 3M54A 4HNAD 1BI8B 1LD8A 1YMPA 3EUVA 2VSOE 2E0IA 3R7QA 2WM9A 1HG5A 3SGHA 3SFXA 4U8VD 5BXUA 4KVMA 5CECB 3RIBA 4OVUA 3FTWA 3HYMB 3PEUB 2FBNA 4WUYA 3MCXA 4TXQA 1KT1A 3SQVA 4DI3A 3UT4A 3AG3E 1UG3A 2QYJA 2VTBB 1YYHA 1WY6A 4K5CA 4F3VA 3PEVB 1HXIA 1SZ9A 3RO2A 4Z4PA 1MHQA 5F5EA 4JW1A 2A5EA 5EILA 3TGOA 2MYOA 4W9RA 4I17A 4I1MA 3L13A 4U0UA 3PNTB 3U3WA 5JHAA 3B7SA 2JEKA 3PUJA 4PH4B 3CKCA 3N71A 1DCEA 3I3NA 2X6KA 4DX7D 4HOSA 4EZJA 2F69A 2P9KG 1IQUA 3AJIA 4GTSA 3TWWA 3ASGA 3FUIA 2I6HA 2R2LA 2XENA 1H2UA 2L6JA 3UUXA 3ULEG 3BG1B 4YPUA 4GA0A 4R7LA 4XKCA 5LSZA 3EHQA 3MA5A 4DK5A 2VGEA 3MKQB 3FTYA 3B7TA 5KNHD 4UWFA 4AXHA 4I51A 4B89A 5CRVA 5ENSD 3UTMA 4HOUA 3FTXA 2WPVA 2BQZA 3ULQA 1P5QA 3PS6A 3DRAA 3R9AB 3CBOA 1NP7A 3LVQE 4GTPA 4AJWA 1ZB1A 4UWGA 1OXJA 4U63A 4CDMA 1PAQA 5ENNA 5BV1A 5CCMA 2MHKA 3DWLG 4GYOA 4GU5A 2C2LA 3FY4A 2DYRE 4MKTA 4J8EA 4C0MA 4RG9A 1QQEA 3QWPA 3CK7A 3CHSA 4GB9A 4BTAA 3OS5A 1TNYA 5EX0A 4OAUC 1TEZA 3ZU7B 4UQZA 3M55A 3FUEA 5CRUA 3D9LA 1HX8A 4XIFA 3EU5A 4AU7A 2KC7A 4B0ZA 1O1SA 4D10C 4IRUA 3RRMB 4FP7A 4GPMA 1AP7A 3ZGQA 3M56A 4A3VA 3FU0A 2QZAA 1YCSB 5AYWD 3UIOC 1SZAA 4FU3A 3FUKA 3QWVA 4AP2A 3SNXA 2Y69E 3UI2A 1QNFA 3LY7A 2WXKA 3OXFA 1ELWA 2IOLA 4FLHA 2XHEA 3FWVA 2XCCA 3NF1A 4HS2A 4O6FA 5FINA 3CVNA 5FQ6A 2DVWA 1KLXA 2GRQB 5T0MA 3MZLB 1WDYA 4MS6A 4U0ZA 2VGXA 3SY2A 2H6IA 3S7JA 5EG2A 1UN8A 2VGXB 3ZPJA 3NAWA 3D3MA 3PZ2A 3HRAA 2LO6A 1UJJA 4EECA 2H6FA 2F0YA 3L82A 5IY5E 1N0QA 5BW8C 3VV0A 2RKKA 5LCWC 4J0UA 3V2XA 3ULYA 2KZTA 3TWQA 3ZXPA 4B94A 3MO5A 3RKVA 4FHJA 2NYJA 3M5AA 3SZ7A 1V54E 5BPPA 4HBDA 3ZYLA 1Y6IA 4H7XA 3DSVA 5M72A 4DLQA 5AQAA 2PL2A 2CHXA 4E47A 4DRXE 4MI0A 1N4PA 4OVVA 4BETA 1H0AA 5AQ9A 3FUDA 2UY1B 1TJCA 2JV0A 5ENPD 3NQPA 3MJWA 3EHNA 3EHMA 4GMLA 1E8XA 2I2OA 3NB2A 3QOUA 3FU5A 3IEGA 4L23A 2WXIA 1H2VC 2LNIA 3BEEA 3ZYMA 2PNNA 5EX3A 3CKBA 3ASHA 2J9QA 1OCOE 3ENEA 3Q15A 3URZA 4XI0A 3IV0A 3FTZA 3ZNGA 3APCA 3D9OA 3CQGB 1LF8A 4C9BB 4LNBA 3FUMA 5ARFA 4JVSA 5ARGA 2VSXE 2C0MA 5KJLA 1MX2A 1IYGA 1PY1A 4AEZC 3ZHEA 5TTFA 4C48B 3G2VA 2CHZA 4CEMA 4Q96A 1MX6A 3EDTB 4HVBA 1NZNA 2XZTG 4FHKA 1A5EA 2GRLA 5ANLA 1BD8A 5AJLA 2Y3AA 2IQCA 2R02A 2BUGA 4EBAA 4U7EB 5J08A 3SW9A 3HNAA 3PRZA 5ENOD 3CLJA 2R5SA 3MO0A 4KBQA 2PZIA 4ILGA 3Q73A 3ABKE 3W9GA 1H6KA 4J8FA 4V3IA 2L0TB 3F9WA 4J8YA 1EDUA 4I2ZA 5CHEE 4EZKA 3LVRE 4P29A 3KS2A 4GZ3A 2RFMA 4I1AA 2WMOA 4Q94A 4QQIA 1IHBA 2BF0X 4A1GA 4WNDA 3TXNA 4LDGA 4I6EA 1N94A 3TG5A 4N39A 2IO2C 3CVVA 3SFZA 2HYZA 3TWSA 4MI5A 1OY3D 5FZRA 1UJKA 4FADA 5FZQA 2PM6A 3LCAA 1TNZA 4KZ0A 3RO3A 4ZFHA 1MT6A 5AENA 1WAO1 3CV0A 1FVHA 4GZDA 3APDA 3IHVA 4XI9A 1MVXA 2OVFA 4DUIA 2AJAA 4OYSA 1O9SA 2A5UA 2J49A 4QEPA 2OEVA 2WVIA 2DWZA 4DLOA 1PEGA 4YNPA 1ZBPA 5BNWA 3TG4A 2V4HC 5G2NA 3SI5A 3ZYKA 1MX4A 4MRUA 3LJ3A 3I4RB 2YINA 3C3OA 4E85A 3FU6A 4DPRA 2QY7A 3EIJA 5ANRA 5JMND 1NI1A 5EYLA 1N6AA 3F9ZA 2DIWA 3B7UX 4UWHA 4BSZB 5D66A 2F8YA 4IN3B 4NURA 3B7RL 5CMWA 2MOWA 5KNGA 4ANXA 4F7AA 4CGVA 4QEOA 5T3RA 3UXGA 4G1TA 1U3DA 1ZKKA 4JA9A 1N6CA 5FQ4A 2ILRA 3HG0D 4U8HA 4EBAG 2XRZA 3MGBA 3PZ1A 5JJ0A 3MV2B 2X38A 2FO7A 3RRUA 2VYIA 3UT8A 3L16A 4J8DA 3R7RA 3JUEA 1E96B 4BESA 3LDZA 2W5YA 5AARA 3R9MA 1FVFA 1RZ4A 2IY0C 3ASFA 3I5PA 4U0SA 5KJKA 3UM2A 3E32A 4E6HA 4U8YD 3E4BA 3D9NA 4I43A 2AWIA 4G25A 2GGFA 2CG2A 3GYZA 1IKND 5JA4D 2WXFA 2XEEA 4KYOB 2AXZA 2R17C 3OAWA 3TWUA 5KCMA 1N54A 3T9KA 4O1OA 5ENTD 3Q5MA 3SD5A 1IQRA 1SQMA 3WG7E 2YHCA 4U95D 5EYPF 3VUZA 2GRPB 3DPDA 2RFAA 5EIBE 3C3RA 5DBKA 3E34A 2J8SD 3SF4A 2V0PA 1D8EA 3DXKG 4AM9A 3UKUG 3UKRG 3MX3A 3VTYA 3FH5A 5A7DB 3UM1A 3F9YA 1N4SA 3IKOB 1XQHA 4L7TA 3QKYA 3QAQA 2IOSA 5FWQA 1MYOA 3F6QA 2DZNA 4G24A 3T8MA 2EILE 4YDYA 2XEVA 3GZ2A 5T8IA 2X6JA 3D9JA 2HR2A 2X6FA 3QWWA 1HF8A 3B7BA 2XPZA 2XGMA 2R3AA 3FDHA 3DALA 2OOEA 3IHXA 4NJ5A 1H19A 2UWJG 2J09A 4U96D 1NL4A 3CEQA 3I4GA 3V79K 3HVEA 2OVBA 4GA1A 3D9HA 5KJMA 4XE0A 3OXGA 3D9PA 4IJ8A 3LKUA 1N4QA 4Q69A 5G04C 2LAHA 2V5QC 2XQ0A 3EU9A 4FJZA 3JXJA 5LCWJ 2QFCA 4J83A 3ZXSA 4I6GA 2WQ7A 5G55A 3J5PA 4HRLA 3JXIA 3O4ZA 2C0LA 2F8XK 3Q7FA 5CEAA 2X6IA 2BEDA 4BX9A 4GCOA 3QDNA 4WWPA 4GZCA 1ELRA 2RD0A 4KVOA 4DI4A 3CVWA 5CEDB 4GMRA 4FJYA 4X8QA 4RSYA 3RJWA 2VSNA 3ZN3A 4GA2A 3UM0A 4PS7A 5CPRB 1OWOA 4XKBA 3CBMA 4B93B 3CVPA 4BT9A 3ISMC 3TL5A 3DPYA 3HXFA 1BPOA 3MKRA 3RSEG 3TJPA 2LXLA 3ZYQA 4N3CA 4NIKA 4UQXA 3UMVA 1ELKA 3V2OA 4ANWA 2ETBA 2BKKB 2YQ8A 3IHYA 2HE0A 4ILHB 3E33A 2DBAA 3Q9UC 5TH7A 5FQ8A 4YVQC 2YNQA 3RJVA 3U64A 1BLXB 3ABLE 5CERB 2I1KA 3U4TA 3M53A 3KMAA 2WXGA 1E90A 4YPEA 2A4ZA 2WXOA 4KT6B 1BI7B 1OCRE 3AU4A 1Z3XA 2KZTB 2OV8A 3Q4AB 5TEGA 3LY9A 4UI9K 4TUMA 1N11A 2VGYA 2FULA 2LAIA 2X3MA 4HOTA 4J8OA 4JLGA 3DSXA 1Z3YA 2WMNA 4B8AA 2WXMA 3D9IA 2BKGA 1QYMA 2EINE 4WWOA 3SO8A 5KBAA 3HIZA 2E2EA 1HO8A 3AG1E 3DSWA 1IHGA 1W3BA 2J4DA 4N2SA 1UOHA 1WG0A 3HXCA 3L08A 4GYWA 4HORA 3DBSA 1TYQG 1E8ZA 4BEPA 1JCRA 5H7PA 4HB5A 1ML9A 2LSUA 5G05J 3PDNA 4FULA 3T8KA 3CVUA 4YDWA 5LP0A 2H6HA 1DCQA 2Y4UA 4ATZD 4CT0A 3CR3A 2XGOA 2J07A 3RK6A 4OAVB 4A1SA 4LUNU 1MZCA 2XS1A 3C72A 3S2AA 4M7CA 4UWKA 1NFIE 3ZKJA 3ZHEB 5B3SE 5AN8A 3NZUA 1OUVA 3Q79A 1TN7A 4DJAA 3O48A 1LTXA 1TJFA 3FEYA 3NBNB 3L22A 3S8PA 1Z5SC 3RRNB 3UM3A 2R59A 3Q7AA 5T0KA 2M63A 4BTBA 4I6JA 3ML9A 3LXUX 2XGSA 3CHOA 4K5BA 3ESLA 3OOIA 2ZXWE 4U04A 2IF4A 1YA0A 3KD7A 4HI9A 4H7YA 1N9AA 4CCAA 4K5AB 2I1JA 3VTXA 5FJYA 3WXXA 1XGWA 1JCSA 4Y6WA 3FTUA 1TNBA 4O60A 4LSZE 3HXDA 5F6LA 5T4YA 5A23A 1EYHA 1H3IA 2W5ZA 1X5BA 5ENQD 1HZ4A 3FULA 2GRNB 5J90A 3LS8A 4FA6A 3D9MA 4WNGA 4UI9J 2OCCE 2YHEA 3CIAA 4KZCA 1SA4A 3IBEA 5FIOA 4TRQA 4HQDA 2BTDA 2P2CP 1OWMA 3FPDA 2KXPC 3FHEA 3UX4A 3TWXA 4N5CA 3CGHA 2XEHA 2ZGDA 2XZDG 4TXPA 2P9SG 3U9WA 4JZYA 3CVQA 4LCTA 3L17A 3AU5A 3GZ1A 3AS8A 4EPZA 1UN9A 4AOFA 1O1RA 4CYMD 2KATA 2KM4A 2P9IG 5DIZA 5AQBA 3Q75A 3E37A 1O1TA 3Q9NC 2PQRA 2L0IA 4DX2A 2ETAA 5HI7A 3SFYA 3C98A 4XEIG 3FUFA 5JHNA 4YVOA 2DYSE 1KT0A 1HU3A 1B89A 3SHFA 5AIJA 3DXMG 4HFGA 1MVHA 4C1QA 1XNFA 3FU3A 4JEUA 4CDRA 4WNFA 5D2MC 3S7BA 3T5VA 1E7UA 2G46A 3SBSA 2O8JA 3DEOA 2B6CA 1BU9A 4BFRA 4CT4A 4JB8P 3PNLB 2HM8A 4L9PA 2ZISA 4HI8A 4DX1A 4L2YA 5JHBA 3RAUA 2GW1A 1S63A 4O1PA 2J4BA 2XCBA 4JXTA 1U2VG 3LEWA 2B0OE 3P1UA 1H2TC 5E76A 4RVBA 4KMOA 3Q78A 2JABA 2WQHA 3D9KA 3KEZA 5C1DA 1QZ2A 4LEUA 2EIKE 3ZEFA 4I2WA 1HG2A 3S7DA 3JQ1A 3M58A 3KSQA 1U3CA 1Y8MA 4N5QA 3U66A 2WQ6A 2AW6A 2IU1A 4GMJA 3TAXA 3QK0A 5BXOA 2GROB 2PM7A 3JCKC 5AAOA 3FUJA 4FC8A 5HS0A 5ENRD 3NOCD 1K1AA 4AV7A 1GW6A 2WB2A 3BU8A 4K03A 4CRWA 3EP0A 1A17A 4YNMA 1SVXA 5LX8A 5B1BE 3UIPC 4JA7A 2NSZA 2VTBA 3NOGD 4G8LA 4APFA 4HXIA 4MBGA 3UPVA 3ASNE 1TNUA 4I9EA 5HKPA 3CK8A 2LSVA 2P9PG 4LERA 5FQ7A 2RFIA 1FPPA 2LUHA 4A3TA 4J7FA 4QFVA 3DB5A 5BUZA 3J5QB 2Q7FA 3CSFA 3CSTA 4H12A 5G04J 2IJGX 3HXBA 4GPKA 3C5RA 3KMJA 3G2SA 2DCPA 3FH7A 2FO1E 5KWDA 1FCHA 2LXMA 1LD7A 4TV3A 4F1SA 1Z6TA 3MEKA 3ESKA 5CCLA 1KPSB 3OPEA 4G2VA 5F6KC 3ZUVB 4AIFA 1HH8A 2H6GA 3MKQA 1INZA 3AG4E 5FZSA 2ETCA 3FEXA 1K1BA 1D8DA 4LG6A 5ITZF 5EN5D 3BG0B 3RQ4A 3CHPA 4ZHBA 1WM5A 4I9CA 1JUQA 3CK9A 3HVEB 2P58C 4AY5A 3PZ4A 4RG6A 3TWRA 2XRYA 4XZ4A 5EKQD 5HRYA 2I9CA 4NVQA 4ME2A 1JCQA 3HXEA 4BWRA 5AQ7A 2QC9A 5CMYA 3ZW3A 3EIQC 3FUHA 2L6BA 1H6OA 3MO2A 5E75A 5FT9A 4F53A 4GTQA 2FF4A 5BV0A 1OCZE 1KZPA 1S64A 4YNDA 2X6HA 4C0EA 4GAAA 4F1PA 2V8SE 4B8CB 1JPLA 5LSXA 3X2QE 4CDNA 3OXLA 3APFA 3E30A 3V30A 1TNOA 4ANUA 4N3BA 2Y0BG 4EHMA 2KCVA 3M57A 3CVXA 3PREA 1DC2A 1S70B 3Q49B 1HS6A 2IFUA 3AS5A 4JHRA 2J08A 1O5MA 3RU0A 3UINC 4ACLA 4EZLA 3AG2E 1OCCE 3CQCB 1HE8A 4IYPA 2R05A 3EJNA 3MYVA 5D0OD 3KMTA 1TN8A 4J7IA 3ML8A 4NACA 5BT1A 3LYAA 3K9IA 3ASOE 3GZSA 5CBOA 1MUFA 1N52A 2GRRB 1X81A 2IGQA 5LFAA 3OTNA 1MJ0A 4A55A 4HRMB 4HLEA 1IXVA 2CFUA 3BUAA 1QBQA 2P9LG 2V4LA 1EF1C 3ZIMA 3DEPA 1V55E 3ZVVA 3PZ3A 3UT7A 3QARA 2L9BA 2ZGGA 3B95A 3FH8A 1OT8A 3K5KA 3ONKA 1RW2A 4BSXA 3RAYA 4JL0A 1E7VA 4J7WA 4DX6D 4GYYA 2ZU6B 4Y6CA 5FTPA 2WXRA 2IEJA 4PS3A 3FUNA 5AJDA 4EQFA 4BT8A 3QNKA 5JJ6A 3PE4A 3CHMA 3JYSA 3VLEA 1FT2A 2IONA 3KSLA 2MRIA 2DZOA 2FI7A 4G8KA 1HFAA 4BY6A 1E8WA 3FP3A 1OWPA 1N4RA 2WXLA 1TR4A 1JWFA 4J8SA 4JHKA 3CVLA 3HDXA 3L6AA 1S0PA 2PQNA 2UY1A 4GZ6A 3VLDA 4TUUA 4HOQA 4K0RA 4HLLA 4FMUA 2WXQA 5C2YA 4UWLA 2VJ8A 1FT1A 2CFZA 3LJNA 4NQ0A 3IXEA 1OWLA 4L2LA 4ACKA 3S7FA 4BUPA 4BX8A 2RG8A 4O30A 3L54A 4JD2G 4QENA 4M3OA 2VSYA 4GTVA 3AAAC 1H6PA 4RZ0A 3G2WA 3PUKA 1VDYA 4TXRA 4GTRA 4UQYA 4CGWA 4LNGA 4HRNA 3C3QA 4URKA 4I1OB 2F37A 3KEAA 4LNUD 5A6CA 3QB2A 4CZ2D 3FTVA 3ONLA 2WXNA 5T5GA 4LRZA 3Q47B 3NZSA 4J6IA 4DX5D 3ABME 4WAFA 5KJNA 3SWCA 4BERA 4RLYA 1NA0A 3ZFWA 3UQ3A 2V5FA 3BO5A 4PUCA 5JIYA 4G23A 2XS8A 4JEHA 3PE3A 4G26A 3EHRA 5JJ7A 3B13A 4JPSA 3M59A 4APOA 2CHWA 3F9XA 3BQOA 1DVPA 1E8YA 4RQIA 3TWVA 5G05C 4AY6A 3CVYA 3FFLA 5EDSA 4YDEA 3CHQA 3G2TA 5LOZA 3QJZA 4U07A 3SBTB 3P2BA 4GTTA 3CHRA 2KBXA 1N0RA 2JLBA 4ILIA
chains in the Genus database with same CATH topology
4GCNA 4GA1A 3MV3B 2PM7A 3JCKC 4XE0A 3OXGA 2GRMA 4OVVA 3ZRHA 3D9PA 3FUJA 5KJMA 4FC8A 4IJ8A 3LKUA 4PDXA 1H0AA 3FUDA 4AV7A 5HQ8A 4Q69A 2UY1B 1GW6A 1TJCA 2FEZA 4JC8A 3G2UA 1JWGA 2EQXA 3QC1A 5G04C 2WB2A 2LAHA 2XQ0A 4K03A 3NQPA 3TXMA 3MJWA 5AYFA 5JINA 3EHNA 3GW4A 4ANVA 1A17A 3EHMA 4CRWA 3EP0A 4FJZA 4GMLA 4YNMA 1E8XA 5LCWJ 2QFCA 2I2OA 4J83A 3ZXSA 3JQ0A 3FTSA 3QOUA 4I6GA 3FU5A 3IEGA 5LX8A 5G55A 2KCLA 2WQ7A 4L23A 2WXIA 1H2VC 4NRHB 2LNIA 3LPZA 1UW4B 3BEEA 3ZYMA 3O4ZA 4JDSA 2C0LA 1NA3A 5EX3A 3CKBA 3ASHA 2J9QA 2X6IA 5D0QD 3ENEA 3Q15A 2HO1A 2AXUA 4JA7A 4BX9A 4GCOA 3QDNA 4WWPA 2AVPA 2NSZA 3URZA 4XI0A 2VTBA 3IV0A 3FTZA 4GZCA 4APFA 1ELRA 2RD0A 1ZU2A 3APCA 3D9OA 4KVOA 3CQGB 4HXIA 3UPVA 4DI4A 4I9EA 3CVWA 5F59A 3CK8A 1LF8A 2LSVA 4FJYA 4C9BB 3FUMA 2ONDA 3KAEA 4LERA 4WWNA 4RSYA 5FQ7A 3RJWA 2VSNA 5ARFA 3ZN3A 4JVSA 2RFIA 4GA2A 4FLBA 4PS7A 5ARGA 4JHJA 5JJTA 5CPRB 2VSXE 1OWOA 4XKBA 3CBMA 2C0MA 2WXJA 4A3TA 4J7FA 3JUIA 4QFVA 5KJLA 5BUZA 3CVPA 1IYGA 3DB5A 1PY1A 2XPYA 4L1BA 4IULA 2Q7FA 4BT9A 3CSFA 3CSTA 3PH0C 3TL5A 4H12A 2Y4TA 4AEZC 3ZHEA 5G04J 5TTFA 1BPOA 2IJGX 3MKRA 3G2VA 2CHZA 4GPKA 3PZDA 4CEMA 3TJPA 4Q96A 3ZYQA 2AXVA 4N3CA 3EDTB 3PVLA 4HVBA 1NZNA 1OWNA 4UQXA 3VLFA 3KMJA 3ASDA 4MLPA 1ELKA 1MQSA 3UMVA 4XX5A 2QPWA 3G2SA 4ANWA 1DNPA 1N3JA 2WXHA 2CG3A 2DCPA 2YQ8A 3FH7A 3IHYA 2XPIA 4FHKA 4N3AA 2GRLA 4ILHB 2DBAA 4AVXA 5TH7A 4WNEA 5FQ8A 5ANLA 3T5XA 4YVQC 2YNQA 3AS4A 5AJLA 4IJDA 2Y3AA 2IQCA 3RJVA 3U64A 2BUGA 4EBAA 2KCKA 2VQ2A 4KXKB 3CBPA 2I1KA 4UI9C 1FCHA 1L5JA 4TV3A 4GZ5A 3U4TA 3M53A 3KMAA 2WXGA 4ATGA 4F1SA 3PRZA 5J08A 3HNAA 1E90A 4YPEA 1Z6TA 2A4ZA 2R5SA 2WXOA 3CLJA 3MEKA 4KT6B 3MO0A 3ESKA 4KBQA 5CCLA 3HHMA 3AU4A 1Z3XA 3OPEA 2PZIA 4G2VA 5F6KC 4ILGA 3LY8A 4AIFA 2KZTB 1HH8A 2OV8A 4G11A 4PS8A 3Q4AB 5TEGA 1H6KA 4J8FA 3LY9A 4V3IA 3MKQA 2L0TB 2NC9A 4UI9K 1EPUA 3F9WA 1EDUA 4YPAA 4I2ZA 1INZA 5CHEE 5FZSA 4EZKA 2VGYA 1PC2A 3LVRE 2FULA 2LAIA 2WXPA 3FEXA 2X3MA 3KS2A 4P29A 4GZ3A 4I1AA 4HOTA 4J8OA 4JLGA 2WMOA 4Q94A 3BG0B 4N2QA 2BF0X 4A1GA 4ABNA 3RQ4A 4WNDA 2NXPA 1Z3YA 2WMNA 3M54A 3TXNA 4B8AA 3CHPA 1WM5A 2VSOE 4I9CA 1JUQA 3CK9A 3HVEB 2WXMA 4LDGA 2P58C 4AY5A 4RG6A 2E0IA 3D9IA 4GMJA 2XRYA 4I6EA 4WWOA 4XZ4A 3HIZA 5EKQD 2E2EA 3R7QA 3TG5A 1HO8A 2I9CA 4N39A 2WM9A 4NVQA 3CVVA 4ME2A 1IHGA 1HG5A 1W3BA 2J4DA 3SGHA 3SFZA 4N2SA 2HYZA 3L08A 4KVMA 4GYWA 4MI5A 5FZRA 4BWRA 1UJKA 5CMYA 4FADA 4HORA 3ZW3A 5FZQA 3RIBA 3EIQC 4OVUA 3LCAA 3FTWA 3FUHA 3DBSA 4KZ0A 3MO2A 3HYMB 5E75A 5FT9A 4F53A 2FF4A 5BV0A 3RO3A 3PEUB 2FBNA 4YNDA 2X6HA 1E8ZA 4WUYA 3MCXA 4C0EA 4GAAA 1ML9A 1MT6A 2LSUA 5G05J 2V8SE 5AENA 1WAO1 1KT1A 3CV0A 4B8CB 1FVHA 1JPLA 3PDNA 5LSXA 4FULA 4GZDA 4DI3A 3CVUA 3UT4A 5LP0A 4CDNA 1UG3A 2VTBB 3OXLA 1WY6A 3APFA 3APDA 3IHVA 3PEVB 4F3VA 4XI9A 1HXIA 2Y4UA 1SZ9A 1MVXA 2OVFA 3RO2A 2JV0A 4CT0A 4Z4PA 3CR3A 4ANUA 4OYSA 2XGOA 4N3BA 1O9SA 1MHQA 5F5EA 2KCVA 2A5UA 4JW1A 3M57A 3TGOA 3CVXA 3PREA 2J07A 2J49A 3Q49B 4W9RA 3RK6A 4QEPA 1HS6A 2WVIA 4A1SA 4I17A 4LUNU 4DLOA 3S2AA 4I1MA 3L13A 1PEGA 4UWKA 2IFUA 4YNPA 3AS5A 4JHRA 2J08A 4U0UA 3RU0A 3ZHEB 1ZBPA 4ACLA 4EZLA 3PNTB 3NZUA 1OUVA 3CQCB 3U3WA 5BNWA 1HE8A 3TG4A 4IYPA 5JHAA 3B7SA 2JEKA 3PUJA 4PH4B 3EJNA 4DJAA 3CKCA 3N71A 3O48A 3I3NA 3SI5A 2X6KA 3MYVA 5G2NA 3ZYKA 1TJFA 3FEYA 4MRUA 3LJ3A 3I4RB 3L22A 2YINA 5D0OD 3S8PA 4HOSA 3RRNB 3KMTA 4J7IA 3ML8A 4NACA 5BT1A 3LYAA 2R59A 3K9IA 3GZSA 4E85A 5T0KA 2M63A 4BTBA 4EZJA 1MUFA 1N52A 3FU6A 4DPRA 2F69A 1IQUA 4I6JA 3ML9A 2QY7A 3ASGA 3EIJA 5LFAA 2IGQA 5ANRA 3OTNA 3FUIA 2I6HA 4A55A 3LXUX 4HLEA 2XGSA 3CHOA 3ESLA 2CFUA 3OOIA 1H2UA 2L6JA 4U04A 3UUXA 1N6AA 3F9ZA 2V4LA 1EF1C 3BG1B 2DIWA 3B7UX 4UWHA 2IF4A 3ZIMA 3ZVVA 4YPUA 4GA0A 3UT7A 1YA0A 3KD7A 4R7LA 3QARA 4XKCA 4H7YA 5LSZA 2L9BA 4IN3B 4CCAA 4NURA 3B7RL 3MA5A 5CMWA 4DK5A 2I1JA 3VTXA 3FH8A 3MKQB 2MOWA 4ANXA 4F7AA 3ONKA 3FTYA 4CGVA 3K5KA 3B7TA 5FJYA 4QEOA 5T3RA 4UWFA 3WXXA 4AXHA 4BSXA 1XGWA 4I51A 4B89A 3RAYA 4Y6WA 3FTUA 4JL0A 1E7VA 4G1TA 4HOUA 1U3DA 3FTXA 4GYYA 1ZKKA 4JA9A 5T4YA 1N6CA 2WPVA 5F6LA 2BQZA 2ZU6B 5A23A 1EYHA 3ULQA 1P5QA 4Y6CA 5FTPA 2WXRA 4PS3A 3FUNA 3PS6A 5AJDA 4EQFA 1H3IA 4BT8A 3R9AB 3QNKA 5JJ6A 3CBOA 2W5ZA 1X5BA 5FQ4A 1NP7A 3PE4A 2ILRA 3CHMA 3LVQE 4U8HA 1HZ4A 4EBAG 3FULA 3JYSA 2XRZA 5J90A 3MGBA 3LS8A 4FA6A 3D9MA 3VLEA 4AJWA 4WNGA 4UI9J 5JJ0A 3MV2B 2IONA 2X38A 2FO7A 2MRIA 4UWGA 3RRUA 4U63A 2FI7A 2YHEA 4CDMA 1PAQA 3CIAA 5ENNA 4KZCA 2VYIA 5BV1A 1HFAA 3IBEA 5CCMA 3UT8A 2MHKA 4BY6A 4TRQA 1E8WA 3FP3A 3L16A 1OWPA 4GYOA 4J8DA 3R7RA 4GU5A 2BTDA 1E96B 2C2LA 2WXLA 1OWMA 1JWFA 4J8SA 3FY4A 3FPDA 4MKTA 4J8EA 3FHEA 3LDZA 4C0MA 2W5YA 4JHKA 4RG9A 3UX4A 1QQEA 1FVFA 3QWPA 3CVLA 3HDXA 3L6AA 1S0PA 2PQNA 2UY1A 3CK7A 4GZ6A 4N5CA 3ASFA 3CGHA 3I5PA 3CHSA 4U0SA 3VLDA 5KJKA 4GB9A 4TUUA 4HOQA 4K0RA 4BTAA 3OS5A 4FMUA 3U9WA 4JZYA 2WXQA 4E6HA 5EX0A 5C2YA 1TEZA 4UWLA 2VJ8A 3CVQA 2CFZA 4LCTA 4UQZA 3E4BA 3L17A 3M55A 3D9NA 3AU5A 3GZ1A 4I43A 3AS8A 3FUEA 4EPZA 1UN9A 4NQ0A 4AOFA 3D9LA 2KATA 1HX8A 1OWLA 4L2LA 2AWIA 4G25A 4ACKA 2KM4A 4XIFA 5DIZA 3S7FA 2GGFA 4AU7A 2CG2A 2KC7A 4BUPA 4B0ZA 3GYZA 2RG8A 4BX8A 4D10C 4O30A 4IRUA 2PQRA 3RRMB 3L54A 2L0IA 4QENA 2WXFA 4FP7A 5HI7A 4M3OA 2VSYA 4KYOB 3C98A 2AXZA 2R17C 3OAWA 3ZGQA 3FUFA 1N54A 5KCMA 3G2WA 3PUKA 4YVOA 3M56A 4RZ0A 5JHNA 1KT0A 1HU3A 1VDYA 3FU0A 4A3VA 1B89A 3SW9A 3SHFA 4UQYA 4CGWA 3Q5MA 5AIJA 5AYWD 1SZAA 4HFGA 1MVHA 4FU3A 3SD5A 1IQRA 1SQMA 3FUKA 3QWVA 4C1QA 4AP2A 3SNXA 4URKA 1XNFA 2YHCA 3FU3A 4I1OB 4JEUA 3VUZA 4CDRA 1QNFA 4WNFA 3LY7A 3S7BA 3T5VA 2WXKA 3OXFA 1E7UA 2G46A 1ELWA 3DPDA 2IOLA 3QB2A 5A6CA 3FTVA 3ONLA 4FLHA 2WXNA 2XHEA 3FWVA 2XCCA 3NF1A 4HS2A 4O6FA 5T5GA 5DBKA 3SBSA 4LRZA 2O8JA 3CVNA 5FQ6A 3Q47B 3SF4A 3NZSA 2V0PA 4BFRA 4CT4A 1KLXA 4J6IA 4AM9A 3MX3A 3VTYA 4WAFA 3PNLB 2HM8A 3FH5A 4ILIA 5A7DB 5KJNA 1NA0A 3MZLB 4MS6A 5T0MA 4U0ZA 2VGXA 3F9YA 3ZFWA 3S7JA 3UQ3A 5EG2A 1UN8A 2VGXB 3ZPJA 2V5FA 3IKOB 4L2YA 5JHBA 1XQHA 3BO5A 3D3MA 4L7TA 3QKYA 3QAQA 2IOSA 4PUCA 5FWQA 2GW1A 5JIYA 2LO6A 1UJJA 4EECA 4G24A 2J4BA 4G23A 3T8MA 4JEHA 2XCBA 3PE3A 4JXTA 2XEVA 3GZ2A 4G26A 5JJ7A 3LEWA 5T8IA 5BW8C 2X6JA 3VV0A 3P1UA 1H2TC 3B13A 5LCWC 5E76A 4J0UA 4JPSA 4RVBA 3M59A 4APOA 3SWCA 2KZTA 3D9JA 2HR2A 4B94A 4KMOA 3MO5A 3RKVA 2CHWA 4FHJA 3KEZA 2WQHA 3D9KA 2X6FA 3M5AA 3F9XA 5C1DA 1DVPA 1E8YA 1QZ2A 3QWWA 1HF8A 4LEUA 5G05C 3SZ7A 3ZEFA 4AY6A 3CVYA 3FFLA 4I2WA 5EDSA 2XPZA 1HG2A 2XGMA 3S7DA 5BPPA 2R3AA 3ZYLA 1Y6IA 4H7XA 5M72A 3CHQA 3FDHA 3G2TA 3QJZA 2OOEA 5LOZA 4U07A 4DLQA 3JQ1A 3DALA 3IHXA 3M58A 4NJ5A 1H19A 2PL2A 2UWJG 3SBTB 2CHXA 1U3CA 3P2BA 2J09A 3CHRA 1Y8MA 3U66A 2WQ6A 4E47A 2AW6A 3CEQA 2IU1A 4MI0A 3I4GA 3HVEA 2JLBA 2PM6A 3TAXA 2OVBA 3QK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GCN A;  4GA1 A;  3MV3 B;  5KJM A;  3OXG A;  4IJ8 A;  3LKU A;  5HQ8 A;  2UY1 B;  1TJC A;  5G04 C;  2FEZ A;  2JV0 A;  5AYF A;  5JIN A;  3GW4 A;  3EP0 A;  1A17 A;  4YNM A;  5LCW J;  2QFC A;  4J83 A;  3QOU A;  3IEG A;  2KCL A;  4NRH B;  2LNI A;  3LPZ A;  3BEE A;  4JDS A;  2C0L A;  1NA3 A;  5EX3 A;  3CKB A;  3ASH A;  2J9Q A;  5D0Q D;  3Q15 A;  2HO1 A;  4JA7 A;  4GCO A;  3QDN A;  2AVP A;  3URZ A;  4XI0 A;  1ELR A;  1ZU2 A;  3UPV A;  4I9E A;  5F59 A;  3CK8 A;  2LSV A;  2OND A;  3KAE A;  3RJW A;  2VSN A;  5ARF A;  3ZN3 A;  2RFI A;  4GA2 A;  5ARG A;  5CPR B;  5JJT A;  3CBM A;  2C0M A;  4J7F A;  3DB5 A;  5KJL A;  3CVP A;  1IYG A;  4BT9 A;  2Q7F A;  4H12 A;  2Y4T A;  3ZHE A;  5G04 J;  5TTF A;  3MKR A;  4GPK A;  4N3C A;  3EDT B;  1NZN A;  4UQX A;  3KMJ A;  3ASD A;  2QPW A;  1N3J A;  2YQ8 A;  2XPI A;  4N3A A;  2DBA A;  5TH7 A;  4WNE A;  4YVQ C;  4IJD A;  3AS4 A;  3RJV A;  2BUG A;  2KCK A;  2VQ2 A;  4KXK B;  3CBP A;  4UI9 C;  1FCH A;  3U4T A;  4GZ5 A;  3M53 A;  3KMA A;  3SW9 A;  3HNA A;  4YPE A;  2R5S A;  3MEK A;  3MO0 A;  3ESK A;  4KBQ A;  5CCL A;  3OPE A;  4G2V A;  2PZI A;  5F6K C;  3LY8 A;  4AIF A;  1HH8 A;  3Q4A B;  5TEG A;  4J8F A;  3LY9 A;  2NC9 A;  4UI9 K;  3F9W A;  4YPA A;  4I2Z A;  5CHE E;  5FZS A;  2VGY A;  1PC2 A;  3KS2 A;  4GZ3 A;  4I1A A;  4HOT A;  4J8O A;  4JLG A;  4N2Q A;  4ABN A;  3RQ4 A;  4WND A;  3M54 A;  1WM5 A;  4I9C A;  3CK9 A;  4LDG A;  2P58 C;  4AY5 A;  4RG6 A;  5EKQ D;  2E2E A;  3TG5 A;  4N39 A;  4NVQ A;  4ME2 A;  1IHG A;  1W3B A;  4N2S A;  2HYZ A;  4GYW A;  4MI5 A;  5FZR A;  4BWR A;  4HOR A;  5FZQ A;  3RIB A;  3LCA A;  3MO2 A;  3HYM B;  5FT9 A;  2FF4 A;  3RO3 A;  2FBN A;  4YND A;  4WUY A;  1ML9 A;  1MT6 A;  2LSU A;  5G05 J;  1WAO 1;  1KT1 A;  3CV0 A;  3PDN A;  5LSX A;  3OXL A;  4F3V A;  4XI9 A;  1HXI A;  2Y4U A;  1MVX A;  3RO2 A;  4Z4P A;  2XGO A;  4N3B A;  1O9S A;  5F5E A;  2KCV A;  3M57 A;  3TGO A;  3Q49 B;  4W9R A;  4QEP A;  4A1S A;  4I17 A;  1PEG A;  2IFU A;  4YNP A;  3AS5 A;  4JHR A;  4U0U A;  3RU0 A;  3ZHE B;  1ZBP A;  1OUV A;  3U3W A;  5BNW A;  3TG4 A;  3CKC A;  3N71 A;  3O48 A;  5D0O D;  3S8P A;  4HOS A;  3KMT A;  4J7I A;  5BT1 A;  3LYA A;  3K9I A;  5T0K A;  4BTB A;  1MUF A;  2F69 A;  3ASG A;  2IGQ A;  2I6H A;  2XGS A;  3OOI A;  2L6J A;  4U04 A;  3UUX A;  1N6A A;  3F9Z A;  2IF4 A;  4YPU A;  4GA0 A;  1YA0 A;  3KD7 A;  4H7Y A;  5LSZ A;  4IN3 B;  3MA5 A;  3VTX A;  4QEO A;  4CGV A;  3K5K A;  5FJY A;  3WXX A;  4I51 A;  3RAY A;  4Y6W A;  4JL0 A;  4G1T A;  4HOU A;  4GYY A;  5F6L A;  1ZKK A;  4JA9 A;  1N6C A;  2WPV A;  2BQZ A;  3ULQ A;  1P5Q A;  4Y6C A;  5FTP A;  4EQF A;  1H3I A;  4BT8 A;  3R9A B;  3CBO A;  5JJ6 A;  2W5Z A;  3PE4 A;  1HZ4 A;  3JYS A;  4WNG A;  4UI9 J;  5JJ0 A;  3MV2 B;  2FO7 A;  2FI7 A;  2VYI A;  5CCM A;  2MHK A;  3FP3 A;  4GYO A;  4J8D A;  2C2L A;  1E96 B;  3FPD A;  4J8E A;  2W5Y A;  4RG9 A;  1QQE A;  3QWP A;  3CVL A;  2UY1 A;  2PQN A;  3CK7 A;  4GZ6 A;  4N5C A;  3ASF A;  4U0S A;  5KJK A;  4HOQ A;  4BTA A;  3OS5 A;  4FMU A;  5EX0 A;  3CVQ A;  4UQZ A;  3E4B A;  3M55 A;  3GZ1 A;  3AS8 A;  4NQ0 A;  2KAT A;  4G25 A;  4XIF A;  5DIZ A;  3S7F A;  4AU7 A;  2KC7 A;  4BUP A;  3GYZ A;  4O30 A;  2PQR A;  4QEN A;  5HI7 A;  2VSY A;  4KYO B;  3ZGQ A;  4RZ0 A;  5JHN A;  3M56 A;  4YVO A;  1KT0 A;  1B89 A;  4UQY A;  4CGW A;  3Q5M A;  5AYW D;  1MVH A;  3QWV A;  4C1Q A;  1XNF A;  2YHC A;  3VUZ A;  4CDR A;  4WNF A;  3LY7 A;  3S7B A;  3OXF A;  2G46 A;  1ELW A;  5A6C A;  3NF1 A;  3FWV A;  2XCC A;  5T5G A;  4O6F A;  5DBK A;  2O8J A;  3CVN A;  3Q47 B;  3SF4 A;  1KLX A;  4AM9 A;  3VTY A;  5KJN A;  3SWC A;  5A7D B;  5T0M A;  1NA0 A;  4U0Z A;  2VGX A;  3F9Y A;  3ZFW A;  3S7J A;  3UQ3 A;  5EG2 A;  2VGX B;  3ZPJ A;  2V5F A;  1XQH A;  3BO5 A;  3QKY A;  2GW1 A;  5JIY A;  4G24 A;  4G23 A;  2XCB A;  3PE3 A;  2XEV A;  3GZ2 A;  4G26 A;  5JJ7 A;  5BW8 C;  3VV0 A;  5LCW C;  4J0U A;  3M59 A;  4APO A;  4B94 A;  2HR2 A;  3MO5 A;  3RKV A;  2WQH A;  3M5A A;  3F9X A;  5C1D A;  1QZ2 A;  3QWW A;  4LEU A;  5G05 C;  3SZ7 A;  4AY6 A;  3FFL A;  4I2W A;  2R3A A;  2XGM A;  3S7D A;  4H7X A;  5M72 A;  3DAL A;  2OOE A;  4U07 A;  3IHX A;  3M58 A;  4NJ5 A;  2PL2 A;  2UWJ G;  1Y8M A;  4E47 A;  3CEQ A;  4MI0 A;  2JLB A;  3TAX A; 
#chains in the Genus database with same CATH topology
 4A63 B;  4GCN A;  2P9U G;  1D9S A;  3MV3 B;  5B1A E;  2GRM A;  3ZRH A;  1KZO A;  4PDX A;  3TWT A;  5HQ8 A;  4JC8 A;  2FEZ A;  3G2U A;  1JWG A;  2EQX A;  3QC1 A;  5AYF A;  3TXM A;  1Q2Z A;  2IO3 C;  5JIN A;  3GW4 A;  4ANV A;  1K3Z D;  3JQ0 A;  3FTS A;  2KCL A;  2EIM E;  4NRH B;  3LPZ A;  1UW4 B;  5EID A;  4JDS A;  1NA3 A;  1SA5 A;  2OEW A;  5D0Q D;  2HO1 A;  2AXU A;  2AVP A;  1ZU2 A;  5F59 A;  1G3N B;  2OND A;  3KAE A;  4WWN A;  2ZIR A;  4FLB A;  4JHJ A;  5JJT A;  2WXJ A;  3JUI A;  2Y1L E;  2XPY A;  4Z68 A;  4L1B A;  4IUL A;  5CBN A;  3PH0 C;  2Y4T A;  3V31 A;  3DST A;  3PZD A;  1AWC B;  2AXV A;  3PVL A;  1OWN A;  1SW6 A;  4GTM A;  2R03 A;  3VLF A;  3ASD A;  4MLP A;  1MQS A;  4XX5 A;  2QPW A;  1DNP A;  3DSU A;  1N3J A;  2WXH A;  2CG3 A;  2XPI A;  4N3A A;  4AVX A;  4WNE A;  3T5X A;  1K8K G;  4IJD A;  3AS4 A;  2KCK A;  2VQ2 A;  4KXK B;  3CBP A;  4UI9 C;  3W9F A;  1L5J A;  2EIJ E;  4GZ5 A;  4ATG A;  3L9T A;  4GTO A;  1N95 A;  3DSS A;  1TN6 A;  4F6R D;  3HHM A;  3LY8 A;  4G11 A;  4PS8 A;  4YDO A;  2NC9 A;  1EPU A;  4YPA A;  1PC2 A;  2WXP A;  2P9N G;  2QYU A;  4UUC A;  4N2Q A;  4ABN A;  2NXP A;  3M54 A;  4HNA D;  1BI8 B;  1LD8 A;  1YMP A;  3EUV A;  2VSO E;  2E0I A;  3R7Q A;  2WM9 A;  1HG5 A;  3SGH A;  3SFX A;  4U8V D;  5BXU A;  4KVM A;  5CEC B;  3RIB A;  4OVU A;  3FTW A;  3HYM B;  3PEU B;  2FBN A;  4WUY A;  3MCX A;  4TXQ A;  1KT1 A;  3SQV A;  4DI3 A;  3UT4 A;  3AG3 E;  1UG3 A;  2QYJ A;  2VTB B;  1YYH A;  1WY6 A;  4K5C A;  4F3V A;  3PEV B;  1HXI A;  1SZ9 A;  3RO2 A;  4Z4P A;  1MHQ A;  5F5E A;  4JW1 A;  2A5E A;  5EIL A;  3TGO A;  2MYO A;  4W9R A;  4I17 A;  4I1M A;  3L13 A;  4U0U A;  3PNT B;  3U3W A;  5JHA A;  3B7S A;  2JEK A;  3PUJ A;  4PH4 B;  3CKC A;  3N71 A;  1DCE A;  3I3N A;  2X6K A;  4DX7 D;  4HOS A;  4EZJ A;  2F69 A;  2P9K G;  1IQU A;  3AJI A;  4GTS A;  3TWW A;  3ASG A;  3FUI A;  2I6H A;  2R2L A;  2XEN A;  1H2U A;  2L6J A;  3UUX A;  3ULE G;  3BG1 B;  4YPU A;  4GA0 A;  4R7L A;  4XKC A;  5LSZ A;  3EHQ A;  3MA5 A;  4DK5 A;  2VGE A;  3MKQ B;  3FTY A;  3B7T A;  5KNH D;  4UWF A;  4AXH A;  4I51 A;  4B89 A;  5CRV A;  5ENS D;  3UTM A;  4HOU A;  3FTX A;  2WPV A;  2BQZ A;  3ULQ A;  1P5Q A;  3PS6 A;  3DRA A;  3R9A B;  3CBO A;  1NP7 A;  3LVQ E;  4GTP A;  4AJW A;  1ZB1 A;  4UWG A;  1OXJ A;  4U63 A;  4CDM A;  1PAQ A;  5ENN A;  5BV1 A;  5CCM A;  2MHK A;  3DWL G;  4GYO A;  4GU5 A;  2C2L A;  3FY4 A;  2DYR E;  4MKT A;  4J8E A;  4C0M A;  4RG9 A;  1QQE A;  3QWP A;  3CK7 A;  3CHS A;  4GB9 A;  4BTA A;  3OS5 A;  1TNY A;  5EX0 A;  4OAU C;  1TEZ A;  3ZU7 B;  4UQZ A;  3M55 A;  3FUE A;  5CRU A;  3D9L A;  1HX8 A;  4XIF A;  3EU5 A;  4AU7 A;  2KC7 A;  4B0Z A;  1O1S A;  4D10 C;  4IRU A;  3RRM B;  4FP7 A;  4GPM A;  1AP7 A;  3ZGQ A;  3M56 A;  4A3V A;  3FU0 A;  2QZA A;  1YCS B;  5AYW D;  3UIO C;  1SZA A;  4FU3 A;  3FUK A;  3QWV A;  4AP2 A;  3SNX A;  2Y69 E;  3UI2 A;  1QNF A;  3LY7 A;  2WXK A;  3OXF A;  1ELW A;  2IOL A;  4FLH A;  2XHE A;  3FWV A;  2XCC A;  3NF1 A;  4HS2 A;  4O6F A;  5FIN A;  3CVN A;  5FQ6 A;  2DVW A;  1KLX A;  2GRQ B;  5T0M A;  3MZL B;  1WDY A;  4MS6 A;  4U0Z A;  2VGX A;  3SY2 A;  2H6I A;  3S7J A;  5EG2 A;  1UN8 A;  2VGX B;  3ZPJ A;  3NAW A;  3D3M A;  3PZ2 A;  3HRA A;  2LO6 A;  1UJJ A;  4EEC A;  2H6F A;  2F0Y A;  3L82 A;  5IY5 E;  1N0Q A;  5BW8 C;  3VV0 A;  2RKK A;  5LCW C;  4J0U A;  3V2X A;  3ULY A;  2KZT A;  3TWQ A;  3ZXP A;  4B94 A;  3MO5 A;  3RKV A;  4FHJ A;  2NYJ A;  3M5A A;  3SZ7 A;  1V54 E;  5BPP A;  4HBD A;  3ZYL A;  1Y6I A;  4H7X A;  3DSV A;  5M72 A;  4DLQ A;  5AQA A;  2PL2 A;  2CHX A;  4E47 A;  4DRX E;  4MI0 A;  1N4P A;  4OVV A;  4BET A;  1H0A A;  5AQ9 A;  3FUD A;  2UY1 B;  1TJC A;  2JV0 A;  5ENP D;  3NQP A;  3MJW A;  3EHN A;  3EHM A;  4GML A;  1E8X A;  2I2O A;  3NB2 A;  3QOU A;  3FU5 A;  3IEG A;  4L23 A;  2WXI A;  1H2V C;  2LNI A;  3BEE A;  3ZYM A;  2PNN A;  5EX3 A;  3CKB A;  3ASH A;  2J9Q A;  1OCO E;  3ENE A;  3Q15 A;  3URZ A;  4XI0 A;  3IV0 A;  3FTZ A;  3ZNG A;  3APC A;  3D9O A;  3CQG B;  1LF8 A;  4C9B B;  4LNB A;  3FUM A;  5ARF A;  4JVS A;  5ARG A;  2VSX E;  2C0M A;  5KJL A;  1MX2 A;  1IYG A;  1PY1 A;  4AEZ C;  3ZHE A;  5TTF A;  4C48 B;  3G2V A;  2CHZ A;  4CEM A;  4Q96 A;  1MX6 A;  3EDT B;  4HVB A;  1NZN A;  2XZT G;  4FHK A;  1A5E A;  2GRL A;  5ANL A;  1BD8 A;  5AJL A;  2Y3A A;  2IQC A;  2R02 A;  2BUG A;  4EBA A;  4U7E B;  5J08 A;  3SW9 A;  3HNA A;  3PRZ A;  5ENO D;  3CLJ A;  2R5S A;  3MO0 A;  4KBQ A;  2PZI A;  4ILG A;  3Q73 A;  3ABK E;  3W9G A;  1H6K A;  4J8F A;  4V3I A;  2L0T B;  3F9W A;  4J8Y A;  1EDU A;  4I2Z A;  5CHE E;  4EZK A;  3LVR E;  4P29 A;  3KS2 A;  4GZ3 A;  2RFM A;  4I1A A;  2WMO A;  4Q94 A;  4QQI A;  1IHB A;  2BF0 X;  4A1G A;  4WND A;  3TXN A;  4LDG A;  4I6E A;  1N94 A;  3TG5 A;  4N39 A;  2IO2 C;  3CVV A;  3SFZ A;  2HYZ A;  3TWS A;  4MI5 A;  1OY3 D;  5FZR A;  1UJK A;  4FAD A;  5FZQ A;  2PM6 A;  3LCA A;  1TNZ A;  4KZ0 A;  3RO3 A;  4ZFH A;  1MT6 A;  5AEN A;  1WAO 1;  3CV0 A;  1FVH A;  4GZD A;  3APD A;  3IHV A;  4XI9 A;  1MVX A;  2OVF A;  4DUI A;  2AJA A;  4OYS A;  1O9S A;  2A5U A;  2J49 A;  4QEP A;  2OEV A;  2WVI A;  2DWZ A;  4DLO A;  1PEG A;  4YNP A;  1ZBP A;  5BNW A;  3TG4 A;  2V4H C;  5G2N A;  3SI5 A;  3ZYK A;  1MX4 A;  4MRU A;  3LJ3 A;  3I4R B;  2YIN A;  3C3O A;  4E85 A;  3FU6 A;  4DPR A;  2QY7 A;  3EIJ A;  5ANR A;  5JMN D;  1NI1 A;  5EYL A;  1N6A A;  3F9Z A;  2DIW A;  3B7U X;  4UWH A;  4BSZ B;  5D66 A;  2F8Y A;  4IN3 B;  4NUR A;  3B7R L;  5CMW A;  2MOW A;  5KNG A;  4ANX A;  4F7A A;  4CGV A;  4QEO A;  5T3R A;  3UXG A;  4G1T A;  1U3D A;  1ZKK A;  4JA9 A;  1N6C A;  5FQ4 A;  2ILR A;  3HG0 D;  4U8H A;  4EBA G;  2XRZ A;  3MGB A;  3PZ1 A;  5JJ0 A;  3MV2 B;  2X38 A;  2FO7 A;  3RRU A;  2VYI A;  3UT8 A;  3L16 A;  4J8D A;  3R7R A;  3JUE A;  1E96 B;  4BES A;  3LDZ A;  2W5Y A;  5AAR A;  3R9M A;  1FVF A;  1RZ4 A;  2IY0 C;  3ASF A;  3I5P A;  4U0S A;  5KJK A;  3UM2 A;  3E32 A;  4E6H A;  4U8Y D;  3E4B A;  3D9N A;  4I43 A;  2AWI A;  4G25 A;  2GGF A;  2CG2 A;  3GYZ A;  1IKN D;  5JA4 D;  2WXF A;  2XEE A;  4KYO B;  2AXZ A;  2R17 C;  3OAW A;  3TWU A;  5KCM A;  1N54 A;  3T9K A;  4O1O A;  5ENT D;  3Q5M A;  3SD5 A;  1IQR A;  1SQM A;  3WG7 E;  2YHC A;  4U95 D;  5EYP F;  3VUZ A;  2GRP B;  3DPD A;  2RFA A;  5EIB E;  3C3R A;  5DBK A;  3E34 A;  2J8S D;  3SF4 A;  2V0P A;  1D8E A;  3DXK G;  4AM9 A;  3UKU G;  3UKR G;  3MX3 A;  3VTY A;  3FH5 A;  5A7D B;  3UM1 A;  3F9Y A;  1N4S A;  3IKO B;  1XQH A;  4L7T A;  3QKY A;  3QAQ A;  2IOS A;  5FWQ A;  1MYO A;  3F6Q A;  2DZN A;  4G24 A;  3T8M A;  2EIL E;  4YDY A;  2XEV A;  3GZ2 A;  5T8I A;  2X6J A;  3D9J A;  2HR2 A;  2X6F A;  3QWW A;  1HF8 A;  3B7B A;  2XPZ A;  2XGM A;  2R3A A;  3FDH A;  3DAL A;  2OOE A;  3IHX A;  4NJ5 A;  1H19 A;  2UWJ G;  2J09 A;  4U96 D;  1NL4 A;  3CEQ A;  3I4G A;  3V79 K;  3HVE A;  2OVB A;  4GA1 A;  3D9H A;  5KJM A;  4XE0 A;  3OXG A;  3D9P A;  4IJ8 A;  3LKU A;  1N4Q A;  4Q69 A;  5G04 C;  2LAH A;  2V5Q C;  2XQ0 A;  3EU9 A;  4FJZ A;  3JXJ A;  5LCW J;  2QFC A;  4J83 A;  3ZXS A;  4I6G A;  2WQ7 A;  5G55 A;  3J5P A;  4HRL A;  3JXI A;  3O4Z A;  2C0L A;  2F8X K;  3Q7F A;  5CEA A;  2X6I A;  2BED A;  4BX9 A;  4GCO A;  3QDN A;  4WWP A;  4GZC A;  1ELR A;  2RD0 A;  4KVO A;  4DI4 A;  3CVW A;  5CED B;  4GMR A;  4FJY A;  4X8Q A;  4RSY A;  3RJW A;  2VSN A;  3ZN3 A;  4GA2 A;  3UM0 A;  4PS7 A;  5CPR B;  1OWO A;  4XKB A;  3CBM A;  4B93 B;  3CVP A;  4BT9 A;  3ISM C;  3TL5 A;  3DPY A;  3HXF A;  1BPO A;  3MKR A;  3RSE G;  3TJP A;  2LXL A;  3ZYQ A;  4N3C A;  4NIK A;  4UQX A;  3UMV A;  1ELK A;  3V2O A;  4ANW A;  2ETB A;  2BKK B;  2YQ8 A;  3IHY A;  2HE0 A;  4ILH B;  3E33 A;  2DBA A;  3Q9U C;  5TH7 A;  5FQ8 A;  4YVQ C;  2YNQ A;  3RJV A;  3U64 A;  1BLX B;  3ABL E;  5CER B;  2I1K A;  3U4T A;  3M53 A;  3KMA A;  2WXG A;  1E90 A;  4YPE A;  2A4Z A;  2WXO A;  4KT6 B;  1BI7 B;  1OCR E;  3AU4 A;  1Z3X A;  2KZT B;  2OV8 A;  3Q4A B;  5TEG A;  3LY9 A;  4UI9 K;  4TUM A;  1N11 A;  2VGY A;  2FUL A;  2LAI A;  2X3M A;  4HOT A;  4J8O A;  4JLG A;  3DSX A;  1Z3Y A;  2WMN A;  4B8A A;  2WXM A;  3D9I A;  2BKG A;  1QYM A;  2EIN E;  4WWO A;  3SO8 A;  5KBA A;  3HIZ A;  2E2E A;  1HO8 A;  3AG1 E;  3DSW A;  1IHG A;  1W3B A;  2J4D A;  4N2S A;  1UOH A;  1WG0 A;  3HXC A;  3L08 A;  4GYW A;  4HOR A;  3DBS A;  1TYQ G;  1E8Z A;  4BEP A;  1JCR A;  5H7P A;  4HB5 A;  1ML9 A;  2LSU A;  5G05 J;  3PDN A;  4FUL A;  3T8K A;  3CVU A;  4YDW A;  5LP0 A;  2H6H A;  1DCQ A;  2Y4U A;  4ATZ D;  4CT0 A;  3CR3 A;  2XGO A;  2J07 A;  3RK6 A;  4OAV B;  4A1S A;  4LUN U;  1MZC A;  2XS1 A;  3C72 A;  3S2A A;  4M7C A;  4UWK A;  1NFI E;  3ZKJ A;  3ZHE B;  5B3S E;  5AN8 A;  3NZU A;  1OUV A;  3Q79 A;  1TN7 A;  4DJA A;  3O48 A;  1LTX A;  1TJF A;  3FEY A;  3NBN B;  3L22 A;  3S8P A;  1Z5S C;  3RRN B;  3UM3 A;  2R59 A;  3Q7A A;  5T0K A;  2M63 A;  4BTB A;  4I6J A;  3ML9 A;  3LXU X;  2XGS A;  3CHO A;  4K5B A;  3ESL A;  3OOI A;  2ZXW E;  4U04 A;  2IF4 A;  1YA0 A;  3KD7 A;  4HI9 A;  4H7Y A;  1N9A A;  4CCA A;  4K5A B;  2I1J A;  3VTX A;  5FJY A;  3WXX A;  1XGW A;  1JCS A;  4Y6W A;  3FTU A;  1TNB A;  4O60 A;  4LSZ E;  3HXD A;  5F6L A;  5T4Y A;  5A23 A;  1EYH A;  1H3I A;  2W5Z A;  1X5B A;  5ENQ D;  1HZ4 A;  3FUL A;  2GRN B;  5J90 A;  3LS8 A;  4FA6 A;  3D9M A;  4WNG A;  4UI9 J;  2OCC E;  2YHE A;  3CIA A;  4KZC A;  1SA4 A;  3IBE A;  5FIO A;  4TRQ A;  4HQD A;  2BTD A;  2P2C P;  1OWM A;  3FPD A;  2KXP C;  3FHE A;  3UX4 A;  3TWX A;  4N5C A;  3CGH A;  2XEH A;  2ZGD A;  2XZD G;  4TXP A;  2P9S G;  3U9W A;  4JZY A;  3CVQ A;  4LCT A;  3L17 A;  3AU5 A;  3GZ1 A;  3AS8 A;  4EPZ A;  1UN9 A;  4AOF A;  1O1R A;  4CYM D;  2KAT A;  2KM4 A;  2P9I G;  5DIZ A;  5AQB A;  3Q75 A;  3E37 A;  1O1T A;  3Q9N C;  2PQR A;  2L0I A;  4DX2 A;  2ETA A;  5HI7 A;  3SFY A;  3C98 A;  4XEI G;  3FUF A;  5JHN A;  4YVO A;  2DYS E;  1KT0 A;  1HU3 A;  1B89 A;  3SHF A;  5AIJ A;  3DXM G;  4HFG A;  1MVH A;  4C1Q A;  1XNF A;  3FU3 A;  4JEU A;  4CDR A;  4WNF A;  5D2M C;  3S7B A;  3T5V A;  1E7U A;  2G46 A;  3SBS A;  2O8J A;  3DEO A;  2B6C A;  1BU9 A;  4BFR A;  4CT4 A;  4JB8 P;  3PNL B;  2HM8 A;  4L9P A;  2ZIS A;  4HI8 A;  4DX1 A;  4L2Y A;  5JHB A;  3RAU A;  2GW1 A;  1S63 A;  4O1P A;  2J4B A;  2XCB A;  4JXT A;  1U2V G;  3LEW A;  2B0O E;  3P1U A;  1H2T C;  5E76 A;  4RVB A;  4KMO A;  3Q78 A;  2JAB A;  2WQH A;  3D9K A;  3KEZ A;  5C1D A;  1QZ2 A;  4LEU A;  2EIK E;  3ZEF A;  4I2W A;  1HG2 A;  3S7D A;  3JQ1 A;  3M58 A;  3KSQ A;  1U3C A;  1Y8M A;  4N5Q A;  3U66 A;  2WQ6 A;  2AW6 A;  2IU1 A;  4GMJ A;  3TAX A;  3QK0 A;  5BXO A;  2GRO B;  2PM7 A;  3JCK C;  5AAO A;  3FUJ A;  4FC8 A;  5HS0 A;  5ENR D;  3NOC D;  1K1A A;  4AV7 A;  1GW6 A;  2WB2 A;  3BU8 A;  4K03 A;  4CRW A;  3EP0 A;  1A17 A;  4YNM A;  1SVX A;  5LX8 A;  5B1B E;  3UIP C;  4JA7 A;  2NSZ A;  2VTB A;  3NOG D;  4G8L A;  4APF A;  4HXI A;  4MBG A;  3UPV A;  3ASN E;  1TNU A;  4I9E A;  5HKP A;  3CK8 A;  2LSV A;  2P9P G;  4LER A;  5FQ7 A;  2RFI A;  1FPP A;  2LUH A;  4A3T A;  4J7F A;  4QFV A;  3DB5 A;  5BUZ A;  3J5Q B;  2Q7F A;  3CSF A;  3CST A;  4H12 A;  5G04 J;  2IJG X;  3HXB A;  4GPK A;  3C5R A;  3KMJ A;  3G2S A;  2DCP A;  3FH7 A;  2FO1 E;  5KWD A;  1FCH A;  2LXM A;  1LD7 A;  4TV3 A;  4F1S A;  1Z6T A;  3MEK A;  3ESK A;  5CCL A;  1KPS B;  3OPE A;  4G2V A;  5F6K C;  3ZUV B;  4AIF A;  1HH8 A;  2H6G A;  3MKQ A;  1INZ A;  3AG4 E;  5FZS A;  2ETC A;  3FEX A;  1K1B A;  1D8D A;  4LG6 A;  5ITZ F;  5EN5 D;  3BG0 B;  3RQ4 A;  3CHP A;  4ZHB A;  1WM5 A;  4I9C A;  1JUQ A;  3CK9 A;  3HVE B;  2P58 C;  4AY5 A;  3PZ4 A;  4RG6 A;  3TWR A;  2XRY A;  4XZ4 A;  5EKQ D;  5HRY A;  2I9C A;  4NVQ A;  4ME2 A;  1JCQ A;  3HXE A;  4BWR A;  5AQ7 A;  2QC9 A;  5CMY A;  3ZW3 A;  3EIQ C;  3FUH A;  2L6B A;  1H6O A;  3MO2 A;  5E75 A;  5FT9 A;  4F53 A;  4GTQ A;  2FF4 A;  5BV0 A;  1OCZ E;  1KZP A;  1S64 A;  4YND A;  2X6H A;  4C0E A;  4GAA A;  4F1P A;  2V8S E;  4B8C B;  1JPL A;  5LSX A;  3X2Q E;  4CDN A;  3OXL A;  3APF A;  3E30 A;  3V30 A;  1TNO A;  4ANU A;  4N3B A;  2Y0B G;  4EHM A;  2KCV A;  3M57 A;  3CVX A;  3PRE A;  1DC2 A;  1S70 B;  3Q49 B;  1HS6 A;  2IFU A;  3AS5 A;  4JHR A;  2J08 A;  1O5M A;  3RU0 A;  3UIN C;  4ACL A;  4EZL A;  3AG2 E;  1OCC E;  3CQC B;  1HE8 A;  4IYP A;  2R05 A;  3EJN A;  3MYV A;  5D0O D;  3KMT A;  1TN8 A;  4J7I A;  3ML8 A;  4NAC A;  5BT1 A;  3LYA A;  3K9I A;  3ASO E;  3GZS A;  5CBO A;  1MUF A;  1N52 A;  2GRR B;  1X81 A;  2IGQ A;  5LFA A;  3OTN A;  1MJ0 A;  4A55 A;  4HRM B;  4HLE A;  1IXV A;  2CFU A;  3BUA A;  1QBQ A;  2P9L G;  2V4L A;  1EF1 C;  3ZIM A;  3DEP A;  1V55 E;  3ZVV A;  3PZ3 A;  3UT7 A;  3QAR A;  2L9B A;  2ZGG A;  3B95 A;  3FH8 A;  1OT8 A;  3K5K A;  3ONK A;  1RW2 A;  4BSX A;  3RAY A;  4JL0 A;  1E7V A;  4J7W A;  4DX6 D;  4GYY A;  2ZU6 B;  4Y6C A;  5FTP A;  2WXR A;  2IEJ A;  4PS3 A;  3FUN A;  5AJD A;  4EQF A;  4BT8 A;  3QNK A;  5JJ6 A;  3PE4 A;  3CHM A;  3JYS A;  3VLE A;  1FT2 A;  2ION A;  3KSL A;  2MRI A;  2DZO A;  2FI7 A;  4G8K A;  1HFA A;  4BY6 A;  1E8W A;  3FP3 A;  1OWP A;  1N4R A;  2WXL A;  1TR4 A;  1JWF A;  4J8S A;  4JHK A;  3CVL A;  3HDX A;  3L6A A;  1S0P A;  2PQN A;  2UY1 A;  4GZ6 A;  3VLD A;  4TUU A;  4HOQ A;  4K0R A;  4HLL A;  4FMU A;  2WXQ A;  5C2Y A;  4UWL A;  2VJ8 A;  1FT1 A;  2CFZ A;  3LJN A;  4NQ0 A;  3IXE A;  1OWL A;  4L2L A;  4ACK A;  3S7F A;  4BUP A;  4BX8 A;  2RG8 A;  4O30 A;  3L54 A;  4JD2 G;  4QEN A;  4M3O A;  2VSY A;  4GTV A;  3AAA C;  1H6P A;  4RZ0 A;  3G2W A;  3PUK A;  1VDY A;  4TXR A;  4GTR A;  4UQY A;  4CGW A;  4LNG A;  4HRN A;  3C3Q A;  4URK A;  4I1O B;  2F37 A;  3KEA A;  4LNU D;  5A6C A;  3QB2 A;  4CZ2 D;  3FTV A;  3ONL A;  2WXN A;  5T5G A;  4LRZ A;  3Q47 B;  3NZS A;  4J6I A;  4DX5 D;  3ABM E;  4WAF A;  5KJN A;  3SWC A;  4BER A;  4RLY A;  1NA0 A;  3ZFW A;  3UQ3 A;  2V5F A;  3BO5 A;  4PUC A;  5JIY A;  4G23 A;  2XS8 A;  4JEH A;  3PE3 A;  4G26 A;  3EHR A;  5JJ7 A;  3B13 A;  4JPS A;  3M59 A;  4APO A;  2CHW A;  3F9X A;  3BQO A;  1DVP A;  1E8Y A;  4RQI A;  3TWV A;  5G05 C;  4AY6 A;  3CVY A;  3FFL A;  5EDS A;  4YDE A;  3CHQ A;  3G2T A;  5LOZ A;  3QJZ A;  4U07 A;  3SBT B;  3P2B A;  4GTT A;  3CHR A;  2KBX A;  1N0R A;  2JLB A;  4ILI A; 
#chains in the Genus database with same CATH homology
 4GCN A;  4GA1 A;  3MV3 B;  2PM7 A;  3JCK C;  4XE0 A;  3OXG A;  2GRM A;  4OVV A;  3ZRH A;  3D9P A;  3FUJ A;  5KJM A;  4FC8 A;  4IJ8 A;  3LKU A;  4PDX A;  1H0A A;  3FUD A;  4AV7 A;  5HQ8 A;  4Q69 A;  2UY1 B;  1GW6 A;  1TJC A;  2FEZ A;  4JC8 A;  3G2U A;  1JWG A;  2EQX A;  3QC1 A;  5G04 C;  2WB2 A;  2LAH A;  2XQ0 A;  4K03 A;  3NQP A;  3TXM A;  3MJW A;  5AYF A;  5JIN A;  3EHN A;  3GW4 A;  4ANV A;  1A17 A;  3EHM A;  4CRW A;  3EP0 A;  4FJZ A;  4GML A;  4YNM A;  1E8X A;  5LCW J;  2QFC A;  2I2O A;  4J83 A;  3ZXS A;  3JQ0 A;  3FTS A;  3QOU A;  4I6G A;  3FU5 A;  3IEG A;  5LX8 A;  5G55 A;  2KCL A;  2WQ7 A;  4L23 A;  2WXI A;  1H2V C;  4NRH B;  2LNI A;  3LPZ A;  1UW4 B;  3BEE A;  3ZYM A;  3O4Z A;  4JDS A;  2C0L A;  1NA3 A;  5EX3 A;  3CKB A;  3ASH A;  2J9Q A;  2X6I A;  5D0Q D;  3ENE A;  3Q15 A;  2HO1 A;  2AXU A;  4JA7 A;  4BX9 A;  4GCO A;  3QDN A;  4WWP A;  2AVP A;  2NSZ A;  3URZ A;  4XI0 A;  2VTB A;  3IV0 A;  3FTZ A;  4GZC A;  4APF A;  1ELR A;  2RD0 A;  1ZU2 A;  3APC A;  3D9O A;  4KVO A;  3CQG B;  4HXI A;  3UPV A;  4DI4 A;  4I9E A;  3CVW A;  5F59 A;  3CK8 A;  1LF8 A;  2LSV A;  4FJY A;  4C9B B;  3FUM A;  2OND A;  3KAE A;  4LER A;  4WWN A;  4RSY A;  5FQ7 A;  3RJW A;  2VSN A;  5ARF A;  3ZN3 A;  4JVS A;  2RFI A;  4GA2 A;  4FLB A;  4PS7 A;  5ARG A;  4JHJ A;  5JJT A;  5CPR B;  2VSX E;  1OWO A;  4XKB A;  3CBM A;  2C0M A;  2WXJ A;  4A3T A;  4J7F A;  3JUI A;  4QFV A;  5KJL A;  5BUZ A;  3CVP A;  1IYG A;  3DB5 A;  1PY1 A;  2XPY A;  4L1B A;  4IUL A;  2Q7F A;  4BT9 A;  3CSF A;  3CST A;  3PH0 C;  3TL5 A;  4H12 A;  2Y4T A;  4AEZ C;  3ZHE A;  5G04 J;  5TTF A;  1BPO A;  2IJG X;  3MKR A;  3G2V A;  2CHZ A;  4GPK A;  3PZD A;  4CEM A;  3TJP A;  4Q96 A;  3ZYQ A;  2AXV A;  4N3C A;  3EDT B;  3PVL A;  4HVB A;  1NZN A;  1OWN A;  4UQX A;  3VLF A;  3KMJ A;  3ASD A;  4MLP A;  1ELK A;  1MQS A;  3UMV A;  4XX5 A;  2QPW A;  3G2S A;  4ANW A;  1DNP A;  1N3J A;  2WXH A;  2CG3 A;  2DCP A;  2YQ8 A;  3FH7 A;  3IHY A;  2XPI A;  4FHK A;  4N3A A;  2GRL A;  4ILH B;  2DBA A;  4AVX A;  5TH7 A;  4WNE A;  5FQ8 A;  5ANL A;  3T5X A;  4YVQ C;  2YNQ A;  3AS4 A;  5AJL A;  4IJD A;  2Y3A A;  2IQC A;  3RJV A;  3U64 A;  2BUG A;  4EBA A;  2KCK A;  2VQ2 A;  4KXK B;  3CBP A;  2I1K A;  4UI9 C;  1FCH A;  1L5J A;  4TV3 A;  4GZ5 A;  3U4T A;  3M53 A;  3KMA A;  2WXG A;  4ATG A;  4F1S A;  3PRZ A;  5J08 A;  3HNA A;  1E90 A;  4YPE A;  1Z6T A;  2A4Z A;  2R5S A;  2WXO A;  3CLJ A;  3MEK A;  4KT6 B;  3MO0 A;  3ESK A;  4KBQ A;  5CCL A;  3HHM A;  3AU4 A;  1Z3X A;  3OPE A;  2PZI A;  4G2V A;  5F6K C;  4ILG A;  3LY8 A;  4AIF A;  2KZT B;  1HH8 A;  2OV8 A;  4G11 A;  4PS8 A;  3Q4A B;  5TEG A;  1H6K A;  4J8F A;  3LY9 A;  4V3I A;  3MKQ A;  2L0T B;  2NC9 A;  4UI9 K;  1EPU A;  3F9W A;  1EDU A;  4YPA A;  4I2Z A;  1INZ A;  5CHE E;  5FZS A;  4EZK A;  2VGY A;  1PC2 A;  3LVR E;  2FUL A;  2LAI A;  2WXP A;  3FEX A;  2X3M A;  3KS2 A;  4P29 A;  4GZ3 A;  4I1A A;  4HOT A;  4J8O A;  4JLG A;  2WMO A;  4Q94 A;  3BG0 B;  4N2Q A;  2BF0 X;  4A1G A;  4ABN A;  3RQ4 A;  4WND A;  2NXP A;  1Z3Y A;  2WMN A;  3M54 A;  3TXN A;  4B8A A;  3CHP A;  1WM5 A;  2VSO E;  4I9C A;  1JUQ A;  3CK9 A;  3HVE B;  2WXM A;  4LDG A;  2P58 C;  4AY5 A;  4RG6 A;  2E0I A;  3D9I A;  4GMJ A;  2XRY A;  4I6E A;  4WWO A;  4XZ4 A;  3HIZ A;  5EKQ D;  2E2E A;  3R7Q A;  3TG5 A;  1HO8 A;  2I9C A;  4N39 A;  2WM9 A;  4NVQ A;  3CVV A;  4ME2 A;  1IHG A;  1HG5 A;  1W3B A;  2J4D A;  3SGH A;  3SFZ A;  4N2S A;  2HYZ A;  3L08 A;  4KVM A;  4GYW A;  4MI5 A;  5FZR A;  4BWR A;  1UJK A;  5CMY A;  4FAD A;  4HOR A;  3ZW3 A;  5FZQ A;  3RIB A;  3EIQ C;  4OVU A;  3LCA A;  3FTW A;  3FUH A;  3DBS A;  4KZ0 A;  3MO2 A;  3HYM B;  5E75 A;  5FT9 A;  4F53 A;  2FF4 A;  5BV0 A;  3RO3 A;  3PEU B;  2FBN A;  4YND A;  2X6H A;  1E8Z A;  4WUY A;  3MCX A;  4C0E A;  4GAA A;  1ML9 A;  1MT6 A;  2LSU A;  5G05 J;  2V8S E;  5AEN A;  1WAO 1;  1KT1 A;  3CV0 A;  4B8C B;  1FVH A;  1JPL A;  3PDN A;  5LSX A;  4FUL A;  4GZD A;  4DI3 A;  3CVU A;  3UT4 A;  5LP0 A;  4CDN A;  1UG3 A;  2VTB B;  3OXL A;  1WY6 A;  3APF A;  3APD A;  3IHV A;  3PEV B;  4F3V A;  4XI9 A;  1HXI A;  2Y4U A;  1SZ9 A;  1MVX A;  2OVF A;  3RO2 A;  2JV0 A;  4CT0 A;  4Z4P A;  3CR3 A;  4ANU A;  4OYS A;  2XGO A;  4N3B A;  1O9S A;  1MHQ A;  5F5E A;  2KCV A;  2A5U A;  4JW1 A;  3M57 A;  3TGO A;  3CVX A;  3PRE A;  2J07 A;  2J49 A;  3Q49 B;  4W9R A;  3RK6 A;  4QEP A;  1HS6 A;  2WVI A;  4A1S A;  4I17 A;  4LUN U;  4DLO A;  3S2A A;  4I1M A;  3L13 A;  1PEG A;  4UWK A;  2IFU A;  4YNP A;  3AS5 A;  4JHR A;  2J08 A;  4U0U A;  3RU0 A;  3ZHE B;  1ZBP A;  4ACL A;  4EZL A;  3PNT B;  3NZU A;  1OUV A;  3CQC B;  3U3W A;  5BNW A;  1HE8 A;  3TG4 A;  4IYP A;  5JHA A;  3B7S A;  2JEK A;  3PUJ A;  4PH4 B;  3EJN A;  4DJA A;  3CKC A;  3N71 A;  3O48 A;  3I3N A;  3SI5 A;  2X6K A;  3MYV A;  5G2N A;  3ZYK A;  1TJF A;  3FEY A;  4MRU A;  3LJ3 A;  3I4R B;  3L22 A;  2YIN A;  5D0O D;  3S8P A;  4HOS A;  3RRN B;  3KMT A;  4J7I A;  3ML8 A;  4NAC A;  5BT1 A;  3LYA A;  2R59 A;  3K9I A;  3GZS A;  4E85 A;  5T0K A;  2M63 A;  4BTB A;  4EZJ A;  1MUF A;  1N52 A;  3FU6 A;  4DPR A;  2F69 A;  1IQU A;  4I6J A;  3ML9 A;  2QY7 A;  3ASG A;  3EIJ A;  5LFA A;  2IGQ A;  5ANR A;  3OTN A;  3FUI A;  2I6H A;  4A55 A;  3LXU X;  4HLE A;  2XGS A;  3CHO A;  3ESL A;  2CFU A;  3OOI A;  1H2U A;  2L6J A;  4U04 A;  3UUX A;  1N6A A;  3F9Z A;  2V4L A;  1EF1 C;  3BG1 B;  2DIW A;  3B7U X;  4UWH A;  2IF4 A;  3ZIM A;  3ZVV A;  4YPU A;  4GA0 A;  3UT7 A;  1YA0 A;  3KD7 A;  4R7L A;  3QAR A;  4XKC A;  4H7Y A;  5LSZ A;  2L9B A;  4IN3 B;  4CCA A;  4NUR A;  3B7R L;  3MA5 A;  5CMW A;  4DK5 A;  2I1J A;  3VTX A;  3FH8 A;  3MKQ B;  2MOW A;  4ANX A;  4F7A A;  3ONK A;  3FTY A;  4CGV A;  3K5K A;  3B7T A;  5FJY A;  4QEO A;  5T3R A;  4UWF A;  3WXX A;  4AXH A;  4BSX A;  1XGW A;  4I51 A;  4B89 A;  3RAY A;  4Y6W A;  3FTU A;  4JL0 A;  1E7V A;  4G1T A;  4HOU A;  1U3D A;  3FTX A;  4GYY A;  1ZKK A;  4JA9 A;  5T4Y A;  1N6C A;  2WPV A;  5F6L A;  2BQZ A;  2ZU6 B;  5A23 A;  1EYH A;  3ULQ A;  1P5Q A;  4Y6C A;  5FTP A;  2WXR A;  4PS3 A;  3FUN A;  3PS6 A;  5AJD A;  4EQF A;  1H3I A;  4BT8 A;  3R9A B;  3QNK A;  5JJ6 A;  3CBO A;  2W5Z A;  1X5B A;  5FQ4 A;  1NP7 A;  3PE4 A;  2ILR A;  3CHM A;  3LVQ E;  4U8H A;  1HZ4 A;  4EBA G;  3FUL A;  3JYS A;  2XRZ A;  5J90 A;  3MGB A;  3LS8 A;  4FA6 A;  3D9M A;  3VLE A;  4AJW A;  4WNG A;  4UI9 J;  5JJ0 A;  3MV2 B;  2ION A;  2X38 A;  2FO7 A;  2MRI A;  4UWG A;  3RRU A;  4U63 A;  2FI7 A;  2YHE A;  4CDM A;  1PAQ A;  3CIA A;  5ENN A;  4KZC A;  2VYI A;  5BV1 A;  1HFA A;  3IBE A;  5CCM A;  3UT8 A;  2MHK A;  4BY6 A;  4TRQ A;  1E8W A;  3FP3 A;  3L16 A;  1OWP A;  4GYO A;  4J8D A;  3R7R A;  4GU5 A;  2BTD A;  1E96 B;  2C2L A;  2WXL A;  1OWM A;  1JWF A;  4J8S A;  3FY4 A;  3FPD A;  4MKT A;  4J8E A;  3FHE A;  3LDZ A;  4C0M A;  2W5Y A;  4JHK A;  4RG9 A;  3UX4 A;  1QQE A;  1FVF A;  3QWP A;  3CVL A;  3HDX A;  3L6A A;  1S0P A;  2PQN A;  2UY1 A;  3CK7 A;  4GZ6 A;  4N5C A;  3ASF A;  3CGH A;  3I5P A;  3CHS A;  4U0S A;  3VLD A;  5KJK A;  4GB9 A;  4TUU A;  4HOQ A;  4K0R A;  4BTA A;  3OS5 A;  4FMU A;  3U9W A;  4JZY A;  2WXQ A;  4E6H A;  5EX0 A;  5C2Y A;  1TEZ A;  4UWL A;  2VJ8 A;  3CVQ A;  2CFZ A;  4LCT A;  4UQZ A;  3E4B A;  3L17 A;  3M55 A;  3D9N A;  3AU5 A;  3GZ1 A;  4I43 A;  3AS8 A;  3FUE A;  4EPZ A;  1UN9 A;  4NQ0 A;  4AOF A;  3D9L A;  2KAT A;  1HX8 A;  1OWL A;  4L2L A;  2AWI A;  4G25 A;  4ACK A;  2KM4 A;  4XIF A;  5DIZ A;  3S7F A;  2GGF A;  4AU7 A;  2CG2 A;  2KC7 A;  4BUP A;  4B0Z A;  3GYZ A;  2RG8 A;  4BX8 A;  4D10 C;  4O30 A;  4IRU A;  2PQR A;  3RRM B;  3L54 A;  2L0I A;  4QEN A;  2WXF A;  4FP7 A;  5HI7 A;  4M3O A;  2VSY A;  4KYO B;  3C98 A;  2AXZ A;  2R17 C;  3OAW A;  3ZGQ A;  3FUF A;  1N54 A;  5KCM A;  3G2W A;  3PUK A;  4YVO A;  3M56 A;  4RZ0 A;  5JHN A;  1KT0 A;  1HU3 A;  1VDY A;  3FU0 A;  4A3V A;  1B89 A;  3SW9 A;  3SHF A;  4UQY A;  4CGW A;  3Q5M A;  5AIJ A;  5AYW D;  1SZA A;  4HFG A;  1MVH A;  4FU3 A;  3SD5 A;  1IQR A;  1SQM A;  3FUK A;  3QWV A;  4C1Q A;  4AP2 A;  3SNX A;  4URK A;  1XNF A;  2YHC A;  3FU3 A;  4I1O B;  4JEU A;  3VUZ A;  4CDR A;  1QNF A;  4WNF A;  3LY7 A;  3S7B A;  3T5V A;  2WXK A;  3OXF A;  1E7U A;  2G46 A;  1ELW A;  3DPD A;  2IOL A;  3QB2 A;  5A6C A;  3FTV A;  3ONL A;  4FLH A;  2WXN A;  2XHE A;  3FWV A;  2XCC A;  3NF1 A;  4HS2 A;  4O6F A;  5T5G A;  5DBK A;  3SBS A;  4LRZ A;  2O8J A;  3CVN A;  5FQ6 A;  3Q47 B;  3SF4 A;  3NZS A;  2V0P A;  4BFR A;  4CT4 A;  1KLX A;  4J6I A;  4AM9 A;  3MX3 A;  3VTY A;  4WAF A;  3PNL B;  2HM8 A;  3FH5 A;  4ILI A;  5A7D B;  5KJN A;  1NA0 A;  3MZL B;  4MS6 A;  5T0M A;  4U0Z A;  2VGX A;  3F9Y A;  3ZFW A;  3S7J A;  3UQ3 A;  5EG2 A;  1UN8 A;  2VGX B;  3ZPJ A;  2V5F A;  3IKO B;  4L2Y A;  5JHB A;  1XQH A;  3BO5 A;  3D3M A;  4L7T A;  3QKY A;  3QAQ A;  2IOS A;  4PUC A;  5FWQ A;  2GW1 A;  5JIY A;  2LO6 A;  1UJJ A;  4EEC A;  4G24 A;  2J4B A;  4G23 A;  3T8M A;  4JEH A;  2XCB A;  3PE3 A;  4JXT A;  2XEV A;  3GZ2 A;  4G26 A;  5JJ7 A;  3LEW A;  5T8I A;  5BW8 C;  2X6J A;  3VV0 A;  3P1U A;  1H2T C;  3B13 A;  5LCW C;  5E76 A;  4J0U A;  4JPS A;  4RVB A;  3M59 A;  4APO A;  3SWC A;  2KZT A;  3D9J A;  2HR2 A;  4B94 A;  4KMO A;  3MO5 A;  3RKV A;  2CHW A;  4FHJ A;  3KEZ A;  2WQH A;  3D9K A;  2X6F A;  3M5A A;  3F9X A;  5C1D A;  1DVP A;  1E8Y A;  1QZ2 A;  3QWW A;  1HF8 A;  4LEU A;  5G05 C;  3SZ7 A;  3ZEF A;  4AY6 A;  3CVY A;  3FFL A;  4I2W A;  5EDS A;  2XPZ A;  1HG2 A;  2XGM A;  3S7D A;  5BPP A;  2R3A A;  3ZYL A;  1Y6I A;  4H7X A;  5M72 A;  3CHQ A;  3FDH A;  3G2T A;  3QJZ A;  2OOE A;  5LOZ A;  4U07 A;  4DLQ A;  3JQ1 A;  3DAL A;  3IHX A;  3M58 A;  4NJ5 A;  1H19 A;  2PL2 A;  2UWJ G;  3SBT B;  2CHX A;  1U3C A;  3P2B A;  2J09 A;  3CHR A;  1Y8M A;  3U66 A;  2WQ6 A;  4E47 A;  2AW6 A;  3CEQ A;  2IU1 A;  4MI0 A;  3I4G A;  3HVE A;  2JLB A;  2PM6 A;  3TAX A;  2OVB A;  3QK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...