3S7FA

Structural basis of substrate methylation and inhibition of smyd2
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
429
structure length
429
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-lysine methyltransferase SMYD2
publication title Structural Basis of Substrate Methylation and Inhibition of SMYD2.
pubmed doi rcsb
source organism Homo sapiens
total genus 152
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3s7fA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s7fA01
4I9EA 4XI0A 1H3IA 3AS4A 1ZBPA 3IHXA 4U0SA 3SW9A 4UI9J 3MV2B 4O6FA 5F6KC 5A6CA 2XGOA 3MA5A 4BT9A 4RG9A 3R9AB 2R3AA 4I2ZA 3EDTB 3K5KA 1TJCA 4I2WA 3CVPA 4JDSA 3FPDA 5JJ7A 3QDNA 4HOQA 3NF1A 5JJ0A 4GYYA 4WUYA 3QOUA 1PC2A 3IEGA 3Q15A 3UPVA 3OS5A 1KT1A 4G23A 3RQ4A 4J8FA 1WAO1 2J9QA 5F59A 3CK7A 4WNDA 3MO0A 5G04C 4QEOA 4G1TA 1MVXA 2LNIA 2C0LA 4U0ZA 4H7XA 4N3CA 5FJYA 2O8JA 3N71A 5EX0A 2LSUA 3LKUA 4MI0A 3KD7A 3AS8A 4N3BA 4KYOB 2C2LA 2KCLA 5JJ6A 1E96B 4O30A 4QENA 4XI9A 2PQRA 3CKCA 4A1SA 5M72A 2FO7A 2P58C 2XGSA 3JYSA 3OXFA 4N2QA 4U04A 4NVQA 4YNPA 4QEPA 4GPKA 4BTBA 4UI9K 4CGVA 4HOTA 4I1AA 1HZ4A 3ZGQA 1XNFA 1MT6A 5JINA 4Z4PA 3M54A 3RAYA 2UY1B 4RG6A 1ML9A 4IJDA 3PE3A 5LCWJ 4GYWA 4GA2A 2VQ2A 5ARFA 3LYAA 3ASGA 3HYMB 5AYWD 3SWCA 3S7JA 5D0QD 2L6JA 4N3AA 3OPEA 3RJVA 5EX3A 4XIFA 3S8PA 4AY6A 3CBOA 2IGQA 4ABNA 3VV0A 3S7BA 3QWWA 3VTXA 4UQXA 4KBQA 1A17A 4I9CA 1QZ2A 3LY8A 4GZ5A 1MUFA 2W5YA 4JLGA 4E47A 1YA0A 4BT8A 3CVQA 1Y8MA 3F9YA 4UQZA 4NQ0A 2Y4UA 3CVLA 4J0UA 3U4TA 2KCVA 3UUXA 4UI9C 1NA3A 4RZ0A 5LSXA 4J7FA 3Q47B 3ZHEB 2YQ8A 3M53A 3KMAA 5CPRB 3RO2A 1ZU2A 3RU0A 2LSVA 2QFCA 5KJMA 4JL0A 3ZPJA 3CKBA 2BUGA 4BWRA 1ZKKA 4UQYA 3WXXA 5HI7A 4YNMA 4KXKB 5KJKA 3OXGA 2WPVA 1MVHA 4H7YA 3Q49B 3QKYA 3TGOA 2XEVA 3RJWA 2MHKA 4J8EA 1HH8A 2HO1A 3M5AA 1IHGA 1W3BA 1QQEA 2FF4A 3F9WA 5FZSA 3PDNA 5TH7A 3AS5A 2WQHA 3OOIA 5HQ8A 4GCNA 2AVPA 4YVOA 3LCAA 3DB5A 2UY1A 2F69A 3M57A 3TG5A 4JA9A 4YPEA 2C0MA 4LEUA 4G25A 4BTAA 3GYZA 3GZ2A 2DBAA 2HR2A 2KATA 2XCCA 3BO5A 4JA7A 3KS2A 4C1QA 2JV0A 1NZNA 2XCBA 2XGMA 3Q5MA 5FZQA 3FFLA 4JHRA 1WM5A 2VYIA 3BEEA 3CVNA 1O9SA 3M58A 2PZIA 4U0UA 3K9IA 3RIBA 3CBPA 4AIFA 1IYGA 4F3VA 1N6CA 5DIZA 2VSYA 5T0MA 3MV3B 3F9ZA 3SZ7A 3ASFA 5LCWC 1N6AA 3LPZA 4J8OA 2V5FA 4J7IA 2Q7FA 3LY9A 4J83A 2GW1A 3KMTA 1HXIA 4I17A 5G05J 1P5QA 4APOA 5TEGA 3ZFWA 2FBNA 2VGXB 3CV0A 3E4BA 3M56A 5JJTA 4GYOA 3KMJA 2RFIA 3ZHEA 3CBMA 3CEQA 3SF4A 5KJLA 4GCOA 4GZ6A 5FZRA 4YPUA 5CCMA 2HYZA 4GA1A 3EP0A 5G05C 5BNWA 3LY7A 3ZN3A 3OXLA 4W9RA 4N5CA 5F6LA 3TAXA 4BUPA 4HOUA 4WNEA 3F9XA 5AYFA 4FMUA 3FP3A 5EKQD 2OOEA 3QWPA 2W5ZA 2PL2A 1FCHA 5BT1A 4CDRA 2R5SA 5C1DA 3RO3A 4G24A 2IFUA 3TG4A 5CHEE 2JLBA 4ME2A 3MKRA 2NC9A 2IF4A 4Y6CA 1KLXA 1B89A 5FTPA 5T0KA 3VUZA 5G04J 4YPAA 4Y6WA 5BW8C 5TTFA 3DALA 3HNAA 4IN3B 2Y4TA 3ASHA 2KCKA 1ELWA 3KAEA 4U07A 4EQFA 2QPWA 3O48A 4WNGA 1KT0A 4GA0A 4N39A 5EG2A 1OUVA 3ASDA 3ULQA 4J8DA 4GZ3A 4LDGA 5ARGA 4B94A 3UQ3A 4WNFA 4N2SA 2BQZA 2VGYA 4NRHB 3Q4AB 2I6HA 3VTYA 1N3JA 5T5GA 4H12A 3MO2A 4I51A 4HOSA 3PE4A 4AM9A 3GZ1A 3GW4A 3U3WA 5D0OD 3URZA 3CK9A 4IJ8A 5KJNA 3RKVA 3ESKA 2KC7A 2VGXA 2FI7A 3FWVA 4G2VA 1ELRA 3M59A 5CCLA 2E2EA 3S7DA 2UWJG 4MI5A 5A7DB 3S7FA 5LSZA 5FT9A 3CK8A 4YVQC 4CGWA 1NA0A 1PEGA 2G46A 4AU7A 2YHCA 3QWVA 5F5EA 5DBKA 4YNDA 4AY5A 4HORA 2FEZA 5JHNA 2VSNA 4G26A 2PQNA 5JIYA 4NJ5A 2XPIA 3MEKA 1XQHA 3MO5A 2ONDA 3M55A
chains in the Genus database with same CATH superfamily
4U0SA 4O6FA 5A6CA 3DPDA 3R9AB 1H19A 2I1KA 3EDTB 3K5KA 2XZDG 2GRNB 5KNHD 5FQ6A 3UX4A 3IEGA 4B8AA 1Z3YA 5ENQD 5ITZF 5AIJA 4J8FA 4MRUA 4CRWA 3CHRA 4FLBA 3B7UX 2C0LA 4Q96A 4H7XA 3FHEA 4EZLA 3T5VA 5EX0A 3LKUA 1IQRA 3D9LA 2LAIA 5JJ6A 2NSZA 3SY2A 3CKCA 2X6JA 3E34A 3UI2A 2CG2A 2P58C 3JYSA 3OXFA 5KBAA 3HIZA 4N2QA 4QQIA 4BTBA 4CGVA 2QY7A 2J4BA 1HZ4A 1U3DA 3Q73A 4HLEA 4ATGA 4I6JA 3RRMB 3I3NA 3M54A 3FEXA 2IOSA 1A5EA 2VGEA 3MKQA 2A4ZA 3BQOA 5LCWJ 1MHQA 3NOGD 4XE0A 2XZTG 5AENA 4HRLA 4MKTA 3ZW3A 3FUNA 5KCMA 3C5RA 3CHSA 3DEPA 1TNOA 2L6JA 1OCZE 3SFZA 3E32A 2IQCA 4XIFA 4AY6A 2IGQA 4G11A 4F6RD 4ABNA 3J5PA 2L0IA 5EYPF 4CDMA 3QWWA 3LS8A 3D9JA 4GMLA 3B7RL 4GU5A 1MUFA 3LY8A 2WXPA 4GZ5A 4U8HA 4M3OA 4E47A 3Q9UC 3PZ3A 4TRQA 4BT8A 3TWXA 3F9YA 4JVSA 2Y4UA 1U2VG 2WXOA 2KCVA 3UUXA 4UI9C 3ULEG 5LSXA 2OVFA 4J7FA 1U3CA 4CCAA 4DX6D 3ZIMA 1ZU2A 4GTPA 2H6IA 2QFCA 5KJMA 3JXIA 4GTTA 3ZPJA 1H2TC 1ZKKA 3WXXA 2X6HA 2P9IG 1MVHA 2VSOE 3UT8A 1N52A 3Q49B 3UTMA 3CVWA 4KVMA 1N4PA 4J8EA 4RVBA 1HH8A 5EN5D 1UN9A 4J8YA 2MOWA 3FDHA 4U7EB 3VLFA 3DWLG 2IOLA 4U96D 2R2LA 3W9GA 4G25A 3EHMA 2DBAA 3FUDA 1GW6A 4JA7A 4C1QA 1NZNA 3FFLA 4JHRA 1PAQA 2KBXA 1WM5A 1N4SA 5HRYA 2PZIA 2I1JA 2XENA 3EHQA 3RIBA 1UJJA 3L16A 5AJLA 4F1PA 3ASNE 5DIZA 3ABLE 1MQSA 5G55A 5H7PA 3PZ1A 5T0MA 4GZCA 2GRRB 4J7IA 3D9PA 5EILA 3I4RB 4LRZA 4YDWA 2FULA 4J83A 5FQ7A 4M7CA 2IU1A 3BG1B 3LVQE 1P5QA 1DC2A 5TEGA 3ZFWA 2M63A 3ZHEA 4JB8P 3CEQA 3UM0A 3SF4A 4YPUA 2HYZA 2VTBA 3QB2A 2MRIA 3LY7A 3ZN3A 3T8KA 4N5CA 4K0RA 3HDXA 4WNEA 3D9IA 1LD7A 2OOEA 1D8DA 3HG0D 1OWMA 4P29A 4JC8A 1N11A 5BT1A 3OTNA 4G24A 2IFUA 2JLBA 2NC9A 2IF4A 3DALA 4FA6A 4CYMD 2AW6A 1OWNA 4A63B 3JQ1A 3FH7A 2X6FA 2QPWA 4KT6B 2EIME 5JMND 2WMNA 3FUKA 1WDYA 1KT0A 3RK6A 2KXPC 3QJZA 3ASDA 1SW6A 3ULQA 4G8KA 1UW4B 1DCEA 4BETA 5HKPA 4N2SA 5FINA 4TUUA 2VGYA 2LXLA 3Q4AB 4U95D 4HOSA 3PE4A 3DSWA 5KJNA 1FT2A 5JHAA 3TWSA 4JEUA 2KC7A 4KVOA 4BSXA 5BV0A 1SVXA 1OWOA 4G2VA 1YYHA 2J49A 2E2EA 1E7UA 3S7FA 3RAUA 4BY6A 5FT9A 4YVQC 4B93B 2GGFA 3Q75A 5B1BE 4DJAA 3QWVA 4LCTA 2X6KA 4U63A 3ABME 2LXMA 2WXGA 2FEZA 3PNLB 5JHNA 3AAAC 2VSNA 3V31A 5JIYA 4NJ5A 4DI3A 3MEKA 3M55A 2AXZA 4EBAA 3IHXA 3HXDA 3SW9A 3U64A 4UI9J 4HLLA 3MV2B 3TWVA 2XGOA 4BT9A 3FTYA 4KMOA 2R17C 3DSTA 3CVPA 1NP7A 1UG3A 1FVFA 5JJ7A 2Y69E 2QYUA 3APCA 5ENTD 3DEOA 3TWUA 1HU3A 4HFGA 4GYYA 2P9LG 3QOUA 1PC2A 4NACA 4LNBA 5CBNA 4U8VD 1OCRE 3ZYMA 4G23A 4BFRA 1WAO1 3V79K 4WNDA 3AG4E 2LAHA 4LNGA 3L22A 3PZ4A 4U0ZA 4N3CA 3CQGB 1D9SA 2OEWA 2ZU6B 2WXKA 4N3BA 5AN8A 2XPYA 1E96B 1K1AA 4XI9A 4QFVA 5CECB 3EIQC 4GZDA 4DX2A 4LSZE 2FO1E 2GROB 4U04A 5BPPA 4NVQA 3TWTA 4PS8A 3EIJA 3ISMC 2A5UA 4AOFA 2BTDA 1BI7B 4AXHA 4IJDA 4L7TA 1K3ZD 1UN8A 4GYWA 4OVUA 2VQ2A 3RRNB 2CFUA 1HX8A 5ARFA 2F8XK 3ASGA 1O1TA 2J09A 3HYMB 3ABKE 1X5BA 3L17A 3S7JA 4AEZC 5D0QD 2IEJA 1O1RA 3ZNGA 3FU6A 2XEEA 3KSQA 4OYSA 2QYJA 3TJPA 1N95A 2P9UG 1NI1A 1O1SA 4KBQA 3JXJA 5D2MC 4FULA 3CVQA 2RFAA 1OWLA 4EZJA 2WXNA 1NA3A 4RZ0A 3ASOE 5ANLA 4UWKA 3ZHEB 1S0PA 2WXMA 3DSUA 3RO2A 4J6IA 3CKBA 4FHKA 2BUGA 5AQ9A 3HHMA 2P2CP 2L0TB 4FHJA 3MJWA 4A55A 3TL5A 1BU9A 5KJKA 2WPVA 4IYPA 4AJWA 2XEVA 4CZ2D 2MHKA 1IHGA 1TN8A 3F9WA 3PZDA 3FY4A 4DX5D 4GCNA 2QC9A 1BI8B 3R7RA 2AVPA 1RZ4A 2UY1A 5LP0A 2WXHA 3TG5A 3ZYQA 4YPEA 3CIAA 1HO8A 3GZ2A 2KATA 4AVXA 1UOHA 3FTSA 3ONLA 4YDYA 3BO5A 1KPSB 1JCRA 5LOZA 1LD8A 2XGMA 4GMJA 4RLYA 4K5CA 3BEEA 3EU5A 3I5PA 1O9SA 3V30A 3HXFA 4XKBA 3ESLA 4IRUA 4F3VA 2YNQA 3MV3B 3ASFA 2V5FA 4WAFA 1YCSB 1QNFA 5C2YA 4MBGA 2WXFA 3SBSA 3UM3A 3JUEA 1E7VA 4V3IA 3SQVA 5IY5E 2GRLA 1XGWA 2L9BA 5G05J 3UT4A 3CV0A 4GYOA 3KMJA 3HRAA 2LO6A 1G3NB 2V4HC 4L1BA 4GCOA 3E37A 3D9NA 4GA1A 1H2UA 4APFA 1RW2A 1TN7A 4W9RA 1IQUA 3GZSA 5AYFA 3L6AA 3O4ZA 1MZCA 2ETAA 4FMUA 3FP3A 5EKQD 3U9WA 2CG3A 3APFA 4NIKA 3FTZA 2PNNA 4E85A 4CT0A 3T8MA 2R5SA 5C1DA 4WWOA 5T4YA 3TG4A 2L6BA 4GTRA 1HF8A 3R7QA 4LUNU 4L9PA 4Y6CA 1KLXA 5FTPA 1QBQA 2P9SG 5T0KA 3VUZA 4YPAA 3CSTA 4Y6WA 5TTFA 2XS1A 4IN3B 1JWGA 4I6GA 4HVBA 3NZUA 3KAEA 4K5BA 4IULA 1OCCE 3P2BA 4ACKA 5HS0A 4ANXA 3FTVA 2P9NG 2H6HA 4N39A 3SHFA 1OUVA 1Z6TA 4ANUA 3AG3E 3B7TA 3JCKC 1IXVA 5EIBE 4HNAD 2BQZA 4NRHB 4OAUC 1N3JA 2J8SD 1H6OA 4H12A 3MO2A 5CMWA 3EJNA 4AM9A 1V54E 2RFMA 5D0OD 1TNZA 3LVRE 3UM2A 2KM4A 2IY0C 2VGXA 1E8WA 4DK5A 3TXMA 4EPZA 2V4LA 1ELRA 1IKND 1N0RA 2R03A 2EIJE 4B89A 2XS8A 1FT1A 3UXGA 5CCLA 1N9AA 4FJYA 5AQAA 2GRPB 4F1SA 4NURA 3E30A 3ULYA 4CGWA 3ZYLA 1PEGA 2G46A 2HE0A 2ZGGA 4C0EA 2R05A 1DNPA 4RQIA 2BKKB 5DBKA 4HORA 2J07A 1H6PA 2E0IA 3DSXA 2XPIA 2IONA 4N5QA 1XQHA 2ONDA 4EHMA 1PY1A 3E33A 3AS4A 3UM1A 1ZBPA 5F6KC 1HG2A 1KZPA 2R3AA 1X81A 4JDSA 3FPDA 3PZ2A 4JEHA 3UT7A 3QDNA 4HOQA 3APDA 3CHOA 4DLOA 1DVPA 4WUYA 3SGHA 3Q15A 4DUIA 3OS5A 4OAVB 4EZKA 5E75A 1KT1A 4GTSA 4YDEA 1EPUA 5T3RA 5G04C 2CHZA 4A3VA 4G1TA 4QEOA 2ZIRA 5FJYA 1FPPA 1Z3XA 4MI0A 3AG1E 4KYOB 4HBDA 4QENA 4XZ4A 2WXQA 4O1PA 2PQRA 4GB9A 2B6CA 4A1SA 1SZ9A 4PUCA 3MZLB 3DPYA 5AAOA 3C3OA 2X3MA 4QEPA 4HOTA 4I1AA 2DYSE 2DYRE 3FEYA 1XNFA 2J08A 5JINA 4UUCA 3ZUVB 4Z4PA 4C9BB 3Q78A 3RAYA 4J8SA 2XQ0A 2UY1B 2XHEA 3CVVA 1OXJA 4PH4B 2F8YA 2F37A 3BU8A 2ILRA 2WB2A 2KZTA 3QAQA 3D9MA 4BX9A 3LYAA 2XPZA 1DCQA 1JCQA 5AYWD 4XEIG 3SWCA 4N3AA 3OPEA 2OV8A 3DBSA 3MKQB 1H6KA 3S8PA 3CBOA 4ZFHA 4GTOA 3VTXA 5CMYA 5G2NA 4HXIA 1A17A 4I9CA 1QZ2A 4JLGA 1TN6A 1YA0A 5AQBA 4CT4A 1Y8MA 5JA4D 1JUQA 2MYOA 3CHQA 3CVLA 3SD5A 2XEHA 3U4TA 3L13A 4I6EA 2NYJA 2RKKA 3NB2A 4BESA 3Q47B 3D9OA 3KMAA 1OY3D 4FC8A 3RU0A 1K1BA 3G2TA 4GPMA 3DXMG 4F7AA 4BWRA 5HI7A 4YNMA 4KXKB 3NQPA 2I9CA 3OXGA 3ONKA 4WWNA 3L9TA 3QKYA 5EDSA 4ILIA 5ENPD 3RJWA 4ATZD 3T5XA 2HO1A 3M5AA 1W3BA 3AG2E 3ZRHA 5FZSA 3OOIA 2R02A 1LTXA 2DWZA 2AWIA 3FULA 4YVOA 4HI9A 5EIDA 4DI4A 3DB5A 5LX8A 2F69A 3PUKA 3FUIA 2ZGDA 4JA9A 4ACLA 4LEUA 2C0MA 3HXCA 5CRVA 4CDNA 5JHBA 4GTVA 2HR2A 2XCCA 2Y3AA 2CHXA 1JPLA 3KS2A 2JV0A 3UMVA 2XCBA 3CVXA 3Q5MA 1JWFA 3QK0A 3PEVB 4E6HA 3EHNA 1N94A 3MGBA 2PM7A 3M58A 3CBPA 3SBTB 5CBOA 4URKA 4Q69A 1S70B 1Q2ZA 4PS3A 3P1UA 2GRQB 3LPZA 4J8OA 3U66A 2Q7FA 3AJIA 3RRUA 3KMTA 1WG0A 4APOA 1H2VC 1INZA 1HG5A 2A5EA 2VGXB 4ILGA 3E4BA 3WG7E 3CLJA 5B3SE 2IO2C 2RFIA 3FU0A 1SA4A 5BNWA 3G2SA 5F6LA 3OXLA 3TAXA 4B0ZA 4HOUA 5CEAA 5ENSD 2RG8A 2YINA 4YDOA 3QWPA 1LF8A 4LNUD 4TV3A 3PH0C 2W5ZA 4XKCA 1FCHA 5AARA 3L54A 1HS6A 2VTBB 1O5MA 4G8LA 4R7LA 3JUIA 4ME2A 2WVIA 4JZYA 4RSYA 1B89A 5G04J 4DX7D 3CGHA 1KZOA 3ENEA 1SQMA 3HVEA 3HNAA 2Y4TA 3ASHA 1N54A 2LUHA 1BPOA 2WXLA 1ELWA 3SO8A 1E8YA 4U07A 2BEDA 4EQFA 2WQ6A 3EUVA 3O48A 1FVHA 4L23A 4WNGA 3FTWA 5FQ4A 4D10C 2AJAA 5EG2A 4GAAA 1BLXB 4BERA 2ETBA 4EBAG 4JHJA 5FWQA 3DSVA 4B94A 3UQ3A 1Z5SC 3LXUX 1ELKA 3UKUG 3MYVA 2I6HA 1E8XA 1TEZA 5T5GA 3CR3A 4I51A 4F53A 3ZVVA 1TNBA 3GZ1A 3BG0B 3AU4A 2J4DA 2V0PA 5B1AE 2IJGX 3CK9A 4IJ8A 3RKVA 3ESKA 3PEUB 1MJ0A 4UWGA 4KZCA 3B13A 3JQ0A 3ZXPA 2ZXWE 1TNYA 3ZU7B 1MYOA 3PRZA 1TR4A 4C48B 3S7DA 2UWJG 4MI5A 2IO3C 3B95A 5LSZA 4HI8A 3J5QB 1TYQG 3IBEA 4UWFA 3V2XA 2DZNA 3IKOB 4MLPA 5F5EA 3CHMA 3IV0A 3FH5A 3RSEG 3ZYKA 3DSSA 4G26A 2PQNA 2KZTB 3EU9A 1S64A 3NBNB 3UIPC 4AU7A 3MO5A 3UIOC 3ML9A 4I9EA 4XI0A 1H3IA 3QNKA 5BUZA 4TXPA 3HXEA 3MA5A 4RG9A 3EHRA 4I2ZA 3TWRA 1TJCA 1EDUA 4I2WA 1N4RA 3IHYA 3LEWA 3D9KA 4BX8A 3NF1A 5JJ0A 5AQ7A 3UPVA 2VJ8A 4JW1A 3RQ4A 4GMRA 1TJFA 1NL4A 2J9QA 5F59A 1VDYA 3CK7A 3MO0A 4FJZA 1MVXA 2LNIA 4LERA 2O8JA 3Q79A 3KSLA 3N71A 2LSUA 3SFYA 4Z68A 3R9MA 3SI5A 5AJDA 3KD7A 3AS8A 3Q9NC 4A3TA 2C2LA 2KCLA 3G2UA 3PREA 4O30A 1H0AA 1JCSA 4FP7A 3PUJA 1UJKA 4O60A 4GTQA 5M72A 2FO7A 2XGSA 3F6QA 4YNPA 4GPKA 4UI9K 2F0YA 3Q7FA 3QC1A 4HQDA 4DPRA 2I2OA 3ZGQA 1Y6IA 4AV7A 4C0MA 1MT6A 2EIKE 1NFIE 1V55E 4ANWA 4JHKA 1IHBA 4O1OA 4ZHBA 2X6IA 3DRAA 4RG6A 1ML9A 4I1OB 3PE3A 4HS2A 4PDXA 3G2VA 3FUEA 2CFZA 1HE8A 1D8EA 4KZ0A 4GA2A 2OVBA 3SNXA 3FTXA 3MX3A 4X8QA 4OVVA 3KEAA 4L2YA 3RJVA 3LDZA 4MS6A 5EX3A 3TXNA 5ENRD 4HRMB 3VV0A 3S7BA 4JPSA 4UQXA 4K5AB 4BEPA 2WQ7A 3Q7AA 4PS7A 2W5YA 5E76A 3D3MA 3VLEA 4DRXE 2JABA 4CEMA 2VSXE 4UQZA 4NQ0A 3VLDA 1K8KG 4J0UA 5EYLA 2V8SE 3FUHA 3ZXSA 2AXUA 2GRMA 4XX5A 5J08A 1WY6A 2YQ8A 3M53A 3ZKJA 5CPRB 2Y1LE 3C72A 3L08A 2LSVA 3SFXA 4JL0A 3V2OA 4FU3A 2WXIA 4UQYA 4ANVA 4GTMA 4TXQA 2DIWA 4L2LA 4TXRA 4H7YA 3TGOA 2RD0A 1MX6A 2AXVA 2YHEA 1QQEA 2FF4A 4A1GA 3LJNA 3PDNA 5TH7A 3AS5A 5A23A 2WQHA 2DVWA 5HQ8A 3FUJA 3LCAA 3HVEB 3M57A 1N0QA 4BTAA 3GYZA 3PNTB 2WXJA 5FQ8A 2P9PG 1ZB1A 2P9KG 1OCOE 3AU5A 3NZSA 1YMPA 2JEKA 5ENOD 3FH8A 5FZQA 3ZEFA 4UWLA 2VYIA 4BSZB 3I4GA 3C98A 3CVNA 2WXRA 4WWPA 3C3RA 3PS6A 2NXPA 4U0UA 3K9IA 4I43A 4J7WA 4Q94A 5CEDB 4AIFA 1IYGA 3UKRG 1N6CA 2VSYA 1MX4A 3IXEA 1SZAA 3F9ZA 3SZ7A 5LCWC 1N6AA 3LY9A 2GW1A 4JXTA 1HXIA 4I17A 5J90A 3QARA 2FBNA 3M56A 5JJTA 2DZOA 3CBMA 1HFAA 3CQCB 5KJLA 1AWCB 3OAWA 4GZ6A 1OWPA 3FTUA 5FZRA 5T8IA 5CCMA 3EP0A 5G05C 1TNUA 4BUPA 2B0OE 3F9XA 5CRUA 2CHWA 5ENNA 4K03A 2QZAA 3C3QA 5KWDA 1QYMA 2ZISA 3CHPA 2PL2A 3B7BA 3DXKG 4CDRA 2ETCA 3RO3A 4DLQA 1L5JA 1OT8A 5CHEE 3KEZA 4AP2A 3MKRA 3UINC 2OCCE 5BW8C 2EINE 3IHVA 3CVYA 5KNGA 2KCKA 4FLHA 3TWWA 3L82A 3CSFA 3TWQA 4TUMA 5FIOA 2XRZA 2DCPA 3X2QE 4B8CB 3MCXA 3LJ3A 5CERB 2X38A 3S2AA 2H6FA 3FUMA 4GA0A 5LFAA 4DX1A 4HB5A 4EECA 2HM8A 1EYHA 4J8DA 4GZ3A 4LDGA 5ARGA 4WNFA 3W9FA 4FADA 3VTYA 2PM6A 5D66A 3CVUA 1S63A 5BV1A 3BUAA 2Y0BG 1EF1C 2WMOA 3T9KA 2OEVA 3GW4A 3U3WA 2XRYA 1SA5A 1BD8A 2H6GA 3FU3A 3URZA 1AP7A 2FI7A 1E8ZA 3FWVA 3G2WA 3M59A 3NAWA 4ILHB 5A7DB 1E90A 3ML8A 3B7SA 4LG6A 3CK8A 2BF0X 5ANRA 5BXOA 1NA0A 2WM9A 2V5QC 2YHCA 4JD2G 2R59A 1MX2A 3NOCD 2BKGA 4U8YD 2EQXA 4YNDA 2EILE 4AY5A 1N4QA 3FUFA 4UWHA 5BXUA 3HXBA 3FU5A 4HRNA 3PVLA 4I1MA 3D9HA
chains in the Genus database with same CATH topology
1PY1A 2AXZA 4EBAA 3ML9A 4I9EA 4XI0A 1H3IA 3AS4A 1ZBPA 3IHXA 3QNKA 4U0SA 5BUZA 3SW9A 3U64A 4UI9J 3MV2B 4O6FA 5F6KC 5A6CA 2XGOA 3DPDA 1HG2A 3MA5A 4BT9A 3FTYA 4RG9A 3R9AB 2R3AA 1H19A 4I2ZA 2I1KA 3EDTB 4KMOA 3K5KA 2R17C 1TJCA 1EDUA 4I2WA 3CVPA 1NP7A 1UG3A 4JDSA 1FVFA 3FPDA 5FQ6A 5JJ7A 3UX4A 4JEHA 3APCA 3IHYA 3LEWA 3D9KA 3QDNA 4HOQA 3UT7A 3NF1A 3APDA 4BX8A 5JJ0A 1HU3A 3CHOA 1DVPA 4GYYA 4HFGA 4WUYA 3SGHA 3QOUA 1PC2A 4DLOA 4NACA 3IEGA 3Q15A 3UPVA 3OS5A 4B8AA 2VJ8A 4JW1A 4EZKA 5E75A 1Z3YA 1KT1A 3ZYMA 5AIJA 4G23A 3RQ4A 1TJFA 4BFRA 4J8FA 4MRUA 1WAO1 2J9QA 5F59A 1VDYA 3CK7A 4CRWA 1EPUA 3CHRA 4WNDA 5T3RA 2LAHA 3MO0A 4FJZA 5G04C 2CHZA 3L22A 4A3VA 4FLBA 4G1TA 2LNIA 2C0LA 3B7UX 4Q96A 4H7XA 4U0ZA 1MVXA 4N3CA 3FHEA 4LERA 5FJYA 3CVVA 4EZLA 3CQGB 2O8JA 3N71A 1Z3XA 3T5VA 5EX0A 2LSUA 3SI5A 3LKUA 1IQRA 4MI0A 2ZU6B 5AJDA 3KD7A 3D9LA 3AS8A 2WXKA 4A3TA 4N3BA 2LAIA 4KYOB 2C2LA 2KCLA 3G2UA 2XPYA 5JJ6A 1E96B 2NSZA 3PREA 4O30A 4QENA 1H0AA 4XZ4A 4FP7A 4XI9A 2WXQA 4QFVA 2PQRA 3CKCA 3EIQC 3PUJA 1UJKA 4GZDA 4GB9A 2X6JA 4A1SA 5M72A 1SZ9A 2CG2A 2FO7A 2P58C 2XGSA 3JYSA 3OXFA 4PUCA 3MZLB 3HIZA 4N2QA 4U04A 5BPPA 4NVQA 2X3MA 4YNPA 4QEPA 4GPKA 4BTBA 4UI9K 4CGVA 2QY7A 3QC1A 4HOTA 4DPRA 2J4BA 4I1AA 1HZ4A 4PS8A 1U3DA 4HLEA 3EIJA 4ATGA 2I2OA 3ZGQA 4I6JA 3FEYA 1Y6IA 2A5UA 1XNFA 2J08A 4AV7A 4C0MA 1MT6A 5JINA 3RRMB 4Z4PA 3I3NA 4C9BB 4AOFA 3M54A 3FEXA 3RAYA 4ANWA 2BTDA 4JHKA 2IOSA 4J8SA 2XQ0A 4AXHA 2UY1B 2X6IA 2XHEA 3MKQA 4I1OB 2A4ZA 4RG6A 3PE3A 4HS2A 4PH4B 4L7TA 5LCWJ 1MHQA 4PDXA 3G2VA 1UN8A 3FUEA 2CFZA 4XE0A 1HE8A 4GYWA 5AENA 2ILRA 4GA2A 2KZTA 4KZ0A 4OVUA 2WB2A 3QAQA 2OVBA 2VQ2A 4MKTA 3D9MA 3RRNB 3ZW3A 3FUNA 4BX9A 2CFUA 1HX8A 5ARFA 3LYAA 5KCMA 3ASGA 3SNXA 3CHSA 2XPZA 2J09A 1ML9A 3FTXA 3HYMB 1X5BA 5AYWD 3L17A 3SWCA 3S7JA 4AEZC 5D0QD 2L6JA 3MX3A 4N3AA 3OPEA 2OV8A 4OVVA 3DBSA 3MKQB 3SFZA 3FU6A 4L2YA 3RJVA 3LDZA 2IQCA 4MS6A 5EX3A 1H6KA 4XIFA 3TXNA 3S8PA 4AY6A 3CBOA 2IGQA 4G11A 4OYSA 4ABNA 3VV0A 3TJPA 2L0IA 3S7BA 4CDMA 3QWWA 4JPSA 3LS8A 4UQXA 3VTXA 3D9JA 4GMLA 3B7RL 5CMYA 5G2NA 4HXIA 4KBQA 4GU5A 2WQ7A 1A17A 4I9CA 1QZ2A 3LY8A 2WXPA 4GZ5A 4PS7A 4U8HA 4M3OA 1MUFA 2W5YA 4JLGA 5E76A 4E47A 3D3MA 3VLEA 4FULA 4CEMA 1YA0A 4CT4A 4TRQA 4BT8A 3CVQA 1Y8MA 1JUQA 3F9YA 4I1MA 2VSXE 1OWLA 4UQZA 4NQ0A 3VLDA 4EZJA 4JVSA 3CHQA 2WXNA 2Y4UA 3CVLA 2WXOA 4J0UA 3SD5A 2V8SE 2KCVA 3FUHA 3L13A 4I6EA 3U4TA 4UI9C 2AXUA 3UUXA 3ZXSA 1NA3A 4RZ0A 2GRMA 5LSXA 2OVFA 4J7FA 4XX5A 5J08A 1U3CA 5ANLA 4UWKA 1WY6A 3Q47B 2YQ8A 3ZHEB 4CCAA 3M53A 3D9OA 3KMAA 5CPRB 1S0PA 3ZIMA 2WXMA 4FC8A 3RO2A 1ZU2A 3RU0A 3G2TA 4J6IA 3L08A 2LSVA 2QFCA 5KJMA 4JL0A 3ZPJA 3CKBA 4F7AA 1H2TC 4FHKA 2BUGA 4BWRA 4FU3A 2WXIA 2IONA 4UQYA 3WXXA 1ZKKA 3HHMA 2X6HA 2L0TB 4FHJA 5HI7A 3MJWA 4ANVA 4YNMA 4KXKB 4A55A 2DIWA 3NQPA 2I9CA 4L2LA 3TL5A 5KJKA 3OXGA 2WPVA 3ONKA 4IYPA 4WWNA 1MVHA 2VSOE 3UT8A 1N52A 4H7YA 3Q49B 4YPEA 3QKYA 5EDSA 3CVWA 4AJWA 4ILIA 3TGOA 2XEVA 4KVMA 3RJWA 2MHKA 4J8EA 4RVBA 3T5XA 2RD0A 1HH8A 2HO1A 3M5AA 1IHGA 1W3BA 2AXVA 1UN9A 3ZRHA 2YHEA 1QQEA 2FF4A 3F9WA 3PZDA 4A1GA 5FZSA 3PDNA 5TH7A 3AS5A 5A23A 2WQHA 3FY4A 3OOIA 5HQ8A 2AWIA 4GCNA 3FULA 2AVPA 3FUJA 3R7RA 4YVOA 2MOWA 3FDHA 3LCAA 3HVEB 2UY1A 4DI4A 3DB5A 3VLFA 5LP0A 5LX8A 2WXHA 2F69A 2IOLA 3TG5A 3PUKA 3M57A 3FUIA 4JA9A 3ZYQA 3CIAA 4ACLA 2C0MA 4LEUA 4G25A 1HO8A 3GYZA 3EHMA 3GZ2A 3PNTB 2WXJA 4BTAA 4CDNA 5JHBA 5FQ8A 2DBAA 3FUDA 2HR2A 2KATA 2XCCA 4AVXA 2Y3AA 2CHXA 3FTSA 1GW6A 3ONLA 3AU5A 3NZSA 3BO5A 1JPLA 4JA7A 3KS2A 5LOZA 2JEKA 4C1QA 2JV0A 3UMVA 1NZNA 2XCBA 2XGMA 3CVXA 3Q5MA 3FH8A 5FZQA 3FFLA 1JWFA 4GMJA 4JHRA 3QK0A 3PEVB 1PAQA 4UWLA 3ZEFA 1WM5A 4E6HA 2VYIA 3EHNA 3BEEA 3I4GA 3MGBA 3C98A 3CVNA 3I5PA 2PM7A 1O9SA 2WXRA 4WWPA 3M58A 2PZIA 2NXPA 3PS6A 4U0UA 2I1JA 3K9IA 3RIBA 4I43A 1UJJA 3L16A 4Q94A 3CBPA 4AIFA 3SBTB 4XKBA 1IYGA 3ESLA 5AJLA 4URKA 4IRUA 4F3VA 4Q69A 1N6CA 5DIZA 1MQSA 2VSYA 5G55A 4PS3A 3P1UA 2YNQA 5T0MA 1SZAA 3MV3B 3F9ZA 3SZ7A 3ASFA 4GZCA 5LCWC 1N6AA 3LPZA 4J8OA 3U66A 2V5FA 4WAFA 3D9PA 2Q7FA 4J7IA 3LY9A 3RRUA 1QNFA 3I4RB 5C2YA 4LRZA 2FULA 2WXFA 3SBSA 4J83A 1E7VA 2GW1A 5FQ7A 4V3IA 2IU1A 4JXTA 3KMTA 3BG1B 1HXIA 2GRLA 3LVQE 1XGWA 4I17A 2L9BA 1P5QA 1H2VC 5G05J 4APOA 5J90A 1INZA 3QARA 1HG5A 5TEGA 3ZFWA 2FBNA 2M63A 2VGXB 3UT4A 4ILGA 3CV0A 3E4BA 3M56A 5JJTA 4GYOA 3KMJA 3CLJA 2LO6A 2RFIA 3ZHEA 3CBMA 3CEQA 1HFAA 3CQCB 4L1BA 3SF4A 5KJLA 4GCOA 3OAWA 4GZ6A 1OWPA 3FTUA 5FZRA 4YPUA 3D9NA 5T8IA 5CCMA 2HYZA 4GA1A 1H2UA 3FU0A 4APFA 5G05C 3QB2A 2VTBA 2MRIA 5BNWA 3G2SA 3LY7A 3ZN3A 3OXLA 4W9RA 4N5CA 5F6LA 1IQUA 4K0RA 3TAXA 4BUPA 3HDXA 3GZSA 4B0ZA 4HOUA 4WNEA 3F9XA 5AYFA 3L6AA 2RG8A 2YINA 3O4ZA 2CHWA 5ENNA 4FMUA 3D9IA 3FP3A 5EKQD 4K03A 2OOEA 3U9WA 2CG3A 1LF8A 3APFA 3QWPA 1OWMA 3FTZA 4P29A 4TV3A 3PH0C 2W5ZA 3CHPA 4JC8A 2PL2A 4XKCA 4CT0A 4E85A 1FCHA 3T8MA 5BT1A 4CDRA 3OTNA 2R5SA 3L54A 1HS6A 2VTBB 5C1DA 3RO3A 4G24A 4WWOA 2IFUA 4DLQA 1L5JA 4R7LA 5T4YA 3TG4A 4QEOA 3JUIA 1HF8A 5CHEE 3R7QA 2JLBA 4LUNU 3KEZA 4ME2A 2WVIA 4AP2A 3MKRA 4JZYA 2NC9A 2IF4A 4RSYA 4Y6CA 1KLXA 1B89A 5FTPA 5T0KA 3VUZA 5G04J 4YPAA 3CSTA 3CGHA 4Y6WA 5BW8C 3ENEA 1SQMA 5TTFA 3DALA 4FA6A 3HVEA 3HNAA 3IHVA 3CVYA 4IN3B 2Y4TA 3ASHA 2AW6A 1JWGA 2KCKA 1N54A 4I6GA 1BPOA 2WXLA 1ELWA 4FLHA 1OWNA 3NZUA 4HVBA 3JQ1A 3CSFA 3FH7A 1E8YA 3KAEA 4U07A 2X6FA 4EQFA 2WQ6A 2QPWA 4IULA 2XRZA 3O48A 1FVHA 2DCPA 4KT6B 4L23A 3P2BA 4B8CB 3MCXA 3LJ3A 4ACKA 4WNGA 3EP0A 2WMNA 3FTWA 3FUKA 4ANXA 3FTVA 2X38A 3S2AA 5FQ4A 1KT0A 3FUMA 4D10C 3RK6A 4GA0A 4N39A 5LFAA 5EG2A 4GAAA 3SHFA 3QJZA 1OUVA 1Z6TA 4ANUA 4EECA 2HM8A 4EBAG 1EYHA 3ASDA 3B7TA 3JCKC 4JHJA 3ULQA 4J8DA 4GZ3A 1UW4B 4IJDA 5FWQA 4LDGA 5ARGA 4B94A 4WNFA 3UQ3A 4N2SA 4TUUA 3LXUX 4FADA 1ELKA 2BQZA 2VGYA 3MYVA 3Q4AB 2I6HA 4NRHB 2PM6A 3VTYA 3CVUA 1N3JA 5BV1A 1E8XA 1TEZA 5T5GA 4H12A 3MO2A 5CMWA 3CR3A 3EJNA 1EF1C 4I51A 4F53A 2WMOA 4HOSA 3PE4A 3ZVVA 4AM9A 3GZ1A 3BG0B 3GW4A 3AU4A 3U3WA 2XRYA 2J4DA 5D0OD 3LVRE 2V0PA 3FU3A 3URZA 2IJGX 2KM4A 3CK9A 4IJ8A 5KJNA 5JHAA 3RKVA 3ESKA 3PEUB 4JEUA 2KC7A 2VGXA 4UWGA 2FI7A 4KVOA 1E8WA 4KZCA 4BSXA 3B13A 5BV0A 4DK5A 1E8ZA 3FWVA 3TXMA 4EPZA 2V4LA 1OWOA 3JQ0A 1ELRA 4G2VA 3G2WA 4B89A 3M59A 2J49A 5CCLA 3PRZA 2E2EA 3S7DA 2UWJG 4MI5A 4ILHB 5A7DB 1E90A 1E7UA 4FJYA 3S7FA 3ML8A 5LSZA 3B7SA 4BY6A 5FT9A 3CK8A 2BF0X 4F1SA 4NURA 4YVQC 4CGWA 3ZYLA 5ANRA 1NA0A 2WM9A 2GGFA 1PEGA 2G46A 3IBEA 4AU7A 4UWFA 4DJAA 2YHCA 3QWVA 4LCTA 4C0EA 3IKOB 2X6KA 2R59A 4U63A 4MLPA 1DNPA 5F5EA 2WXGA 3CHMA 3IV0A 3FH5A 2EQXA 5DBKA 4YNDA 4AY5A 3ZYKA 4HORA 2J07A 2FEZA 3PNLB 5JHNA 3FUFA 2VSNA 4G26A 2PQNA 4UWHA 5JIYA 4NJ5A 2KZTB 3FU5A 3PVLA 2E0IA 2XPIA 4DI3A 3MEKA 1XQHA 3MO5A 2ONDA 3M55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I9E A;  4XI0 A;  1H3I A;  3AS4 A;  1ZBP A;  3IHX A;  4U0S A;  3SW9 A;  4UI9 J;  3MV2 B;  4O6F A;  5F6K C;  5A6C A;  2XGO A;  3MA5 A;  4BT9 A;  4RG9 A;  3R9A B;  2R3A A;  4I2Z A;  3EDT B;  3K5K A;  1TJC A;  4I2W A;  3CVP A;  4JDS A;  3FPD A;  5JJ7 A;  3QDN A;  4HOQ A;  3NF1 A;  5JJ0 A;  4GYY A;  4WUY A;  3QOU A;  1PC2 A;  3IEG A;  3Q15 A;  3UPV A;  3OS5 A;  1KT1 A;  4G23 A;  3RQ4 A;  4J8F A;  1WAO 1;  2J9Q A;  5F59 A;  3CK7 A;  4WND A;  3MO0 A;  5G04 C;  4QEO A;  4G1T A;  1MVX A;  2LNI A;  2C0L A;  4U0Z A;  4H7X A;  4N3C A;  5FJY A;  2O8J A;  3N71 A;  5EX0 A;  2LSU A;  3LKU A;  4MI0 A;  3KD7 A;  3AS8 A;  4N3B A;  4KYO B;  2C2L A;  2KCL A;  5JJ6 A;  1E96 B;  4O30 A;  4QEN A;  4XI9 A;  2PQR A;  3CKC A;  4A1S A;  5M72 A;  2FO7 A;  2P58 C;  2XGS A;  3JYS A;  3OXF A;  4N2Q A;  4U04 A;  4NVQ A;  4YNP A;  4QEP A;  4GPK A;  4BTB A;  4UI9 K;  4CGV A;  4HOT A;  4I1A A;  1HZ4 A;  3ZGQ A;  1XNF A;  1MT6 A;  5JIN A;  4Z4P A;  3M54 A;  3RAY A;  2UY1 B;  4RG6 A;  1ML9 A;  4IJD A;  3PE3 A;  5LCW J;  4GYW A;  4GA2 A;  2VQ2 A;  5ARF A;  3LYA A;  3ASG A;  3HYM B;  5AYW D;  3SWC A;  3S7J A;  5D0Q D;  2L6J A;  4N3A A;  3OPE A;  3RJV A;  5EX3 A;  4XIF A;  3S8P A;  4AY6 A;  3CBO A;  2IGQ A;  4ABN A;  3VV0 A;  3S7B A;  3QWW A;  3VTX A;  4UQX A;  4KBQ A;  1A17 A;  4I9C A;  1QZ2 A;  3LY8 A;  4GZ5 A;  1MUF A;  2W5Y A;  4JLG A;  4E47 A;  1YA0 A;  4BT8 A;  3CVQ A;  1Y8M A;  3F9Y A;  4UQZ A;  4NQ0 A;  2Y4U A;  3CVL A;  4J0U A;  3U4T A;  2KCV A;  3UUX A;  4UI9 C;  1NA3 A;  4RZ0 A;  5LSX A;  4J7F A;  3Q47 B;  3ZHE B;  2YQ8 A;  3M53 A;  3KMA A;  5CPR B;  3RO2 A;  1ZU2 A;  3RU0 A;  2LSV A;  2QFC A;  5KJM A;  4JL0 A;  3ZPJ A;  3CKB A;  2BUG A;  4BWR A;  1ZKK A;  4UQY A;  3WXX A;  5HI7 A;  4YNM A;  4KXK B;  5KJK A;  3OXG A;  2WPV A;  1MVH A;  4H7Y A;  3Q49 B;  3QKY A;  3TGO A;  2XEV A;  3RJW A;  2MHK A;  4J8E A;  1HH8 A;  2HO1 A;  3M5A A;  1IHG A;  1W3B A;  1QQE A;  2FF4 A;  3F9W A;  5FZS A;  3PDN A;  5TH7 A;  3AS5 A;  2WQH A;  3OOI A;  5HQ8 A;  4GCN A;  2AVP A;  4YVO A;  3LCA A;  3DB5 A;  2UY1 A;  2F69 A;  3M57 A;  3TG5 A;  4JA9 A;  4YPE A;  2C0M A;  4LEU A;  4G25 A;  4BTA A;  3GYZ A;  3GZ2 A;  2DBA A;  2HR2 A;  2KAT A;  2XCC A;  3BO5 A;  4JA7 A;  3KS2 A;  4C1Q A;  2JV0 A;  1NZN A;  2XCB A;  2XGM A;  3Q5M A;  5FZQ A;  3FFL A;  4JHR A;  1WM5 A;  2VYI A;  3BEE A;  3CVN A;  1O9S A;  3M58 A;  2PZI A;  4U0U A;  3K9I A;  3RIB A;  3CBP A;  4AIF A;  1IYG A;  4F3V A;  1N6C A;  5DIZ A;  2VSY A;  5T0M A;  3MV3 B;  3F9Z A;  3SZ7 A;  3ASF A;  5LCW C;  1N6A A;  3LPZ A;  4J8O A;  2V5F A;  4J7I A;  2Q7F A;  3LY9 A;  4J83 A;  2GW1 A;  3KMT A;  1HXI A;  4I17 A;  5G05 J;  1P5Q A;  4APO A;  5TEG A;  3ZFW A;  2FBN A;  2VGX B;  3CV0 A;  3E4B A;  3M56 A;  5JJT A;  4GYO A;  3KMJ A;  2RFI A;  3ZHE A;  3CBM A;  3CEQ A;  3SF4 A;  5KJL A;  4GCO A;  4GZ6 A;  5FZR A;  4YPU A;  5CCM A;  2HYZ A;  4GA1 A;  3EP0 A;  5G05 C;  5BNW A;  3LY7 A;  3ZN3 A;  3OXL A;  4W9R A;  4N5C A;  5F6L A;  3TAX A;  4BUP A;  4HOU A;  4WNE A;  3F9X A;  5AYF A;  4FMU A;  3FP3 A;  5EKQ D;  2OOE A;  3QWP A;  2W5Z A;  2PL2 A;  1FCH A;  5BT1 A;  4CDR A;  2R5S A;  5C1D A;  3RO3 A;  4G24 A;  2IFU A;  3TG4 A;  5CHE E;  2JLB A;  4ME2 A;  3MKR A;  2NC9 A;  2IF4 A;  4Y6C A;  1KLX A;  1B89 A;  5FTP A;  5T0K A;  3VUZ A;  5G04 J;  4YPA A;  4Y6W A;  5BW8 C;  5TTF A;  3DAL A;  3HNA A;  4IN3 B;  2Y4T A;  3ASH A;  2KCK A;  1ELW A;  3KAE A;  4U07 A;  4EQF A;  2QPW A;  3O48 A;  4WNG A;  1KT0 A;  4GA0 A;  4N39 A;  5EG2 A;  1OUV A;  3ASD A;  3ULQ A;  4J8D A;  4GZ3 A;  4LDG A;  5ARG A;  4B94 A;  3UQ3 A;  4WNF A;  4N2S A;  2BQZ A;  2VGY A;  4NRH B;  3Q4A B;  2I6H A;  3VTY A;  1N3J A;  5T5G A;  4H12 A;  3MO2 A;  4I51 A;  4HOS A;  3PE4 A;  4AM9 A;  3GZ1 A;  3GW4 A;  3U3W A;  5D0O D;  3URZ A;  3CK9 A;  4IJ8 A;  5KJN A;  3RKV A;  3ESK A;  2KC7 A;  2VGX A;  2FI7 A;  3FWV A;  4G2V A;  1ELR A;  3M59 A;  5CCL A;  2E2E A;  3S7D A;  2UWJ G;  4MI5 A;  5A7D B;  3S7F A;  5LSZ A;  5FT9 A;  3CK8 A;  4YVQ C;  4CGW A;  1NA0 A;  1PEG A;  2G46 A;  4AU7 A;  2YHC A;  3QWV A;  5F5E A;  5DBK A;  4YND A;  4AY5 A;  4HOR A;  2FEZ A;  5JHN A;  2VSN A;  4G26 A;  2PQN A;  5JIY A;  4NJ5 A;  2XPI A;  3MEK A;  1XQH A;  3MO5 A;  2OND A;  3M55 A; 
#chains in the Genus database with same CATH topology
 4U0S A;  4O6F A;  5A6C A;  3DPD A;  3R9A B;  1H19 A;  2I1K A;  3EDT B;  3K5K A;  2XZD G;  2GRN B;  5KNH D;  5FQ6 A;  3UX4 A;  3IEG A;  4B8A A;  1Z3Y A;  5ENQ D;  5ITZ F;  5AIJ A;  4J8F A;  4MRU A;  4CRW A;  3CHR A;  4FLB A;  3B7U X;  2C0L A;  4Q96 A;  4H7X A;  3FHE A;  4EZL A;  3T5V A;  5EX0 A;  3LKU A;  1IQR A;  3D9L A;  2LAI A;  5JJ6 A;  2NSZ A;  3SY2 A;  3CKC A;  2X6J A;  3E34 A;  3UI2 A;  2CG2 A;  2P58 C;  3JYS A;  3OXF A;  5KBA A;  3HIZ A;  4N2Q A;  4QQI A;  4BTB A;  4CGV A;  2QY7 A;  2J4B A;  1HZ4 A;  1U3D A;  3Q73 A;  4HLE A;  4ATG A;  4I6J A;  3RRM B;  3I3N A;  3M54 A;  3FEX A;  2IOS A;  1A5E A;  2VGE A;  3MKQ A;  2A4Z A;  3BQO A;  5LCW J;  1MHQ A;  3NOG D;  4XE0 A;  2XZT G;  5AEN A;  4HRL A;  4MKT A;  3ZW3 A;  3FUN A;  5KCM A;  3C5R A;  3CHS A;  3DEP A;  1TNO A;  2L6J A;  1OCZ E;  3SFZ A;  3E32 A;  2IQC A;  4XIF A;  4AY6 A;  2IGQ A;  4G11 A;  4F6R D;  4ABN A;  3J5P A;  2L0I A;  5EYP F;  4CDM A;  3QWW A;  3LS8 A;  3D9J A;  4GML A;  3B7R L;  4GU5 A;  1MUF A;  3LY8 A;  2WXP A;  4GZ5 A;  4U8H A;  4M3O A;  4E47 A;  3Q9U C;  3PZ3 A;  4TRQ A;  4BT8 A;  3TWX A;  3F9Y A;  4JVS A;  2Y4U A;  1U2V G;  2WXO A;  2KCV A;  3UUX A;  4UI9 C;  3ULE G;  5LSX A;  2OVF A;  4J7F A;  1U3C A;  4CCA A;  4DX6 D;  3ZIM A;  1ZU2 A;  4GTP A;  2H6I A;  2QFC A;  5KJM A;  3JXI A;  4GTT A;  3ZPJ A;  1H2T C;  1ZKK A;  3WXX A;  2X6H A;  2P9I G;  1MVH A;  2VSO E;  3UT8 A;  1N52 A;  3Q49 B;  3UTM A;  3CVW A;  4KVM A;  1N4P A;  4J8E A;  4RVB A;  1HH8 A;  5EN5 D;  1UN9 A;  4J8Y A;  2MOW A;  3FDH A;  4U7E B;  3VLF A;  3DWL G;  2IOL A;  4U96 D;  2R2L A;  3W9G A;  4G25 A;  3EHM A;  2DBA A;  3FUD A;  1GW6 A;  4JA7 A;  4C1Q A;  1NZN A;  3FFL A;  4JHR A;  1PAQ A;  2KBX A;  1WM5 A;  1N4S A;  5HRY A;  2PZI A;  2I1J A;  2XEN A;  3EHQ A;  3RIB A;  1UJJ A;  3L16 A;  5AJL A;  4F1P A;  3ASN E;  5DIZ A;  3ABL E;  1MQS A;  5G55 A;  5H7P A;  3PZ1 A;  5T0M A;  4GZC A;  2GRR B;  4J7I A;  3D9P A;  5EIL A;  3I4R B;  4LRZ A;  4YDW A;  2FUL A;  4J83 A;  5FQ7 A;  4M7C A;  2IU1 A;  3BG1 B;  3LVQ E;  1P5Q A;  1DC2 A;  5TEG A;  3ZFW A;  2M63 A;  3ZHE A;  4JB8 P;  3CEQ A;  3UM0 A;  3SF4 A;  4YPU A;  2HYZ A;  2VTB A;  3QB2 A;  2MRI A;  3LY7 A;  3ZN3 A;  3T8K A;  4N5C A;  4K0R A;  3HDX A;  4WNE A;  3D9I A;  1LD7 A;  2OOE A;  1D8D A;  3HG0 D;  1OWM A;  4P29 A;  4JC8 A;  1N11 A;  5BT1 A;  3OTN A;  4G24 A;  2IFU A;  2JLB A;  2NC9 A;  2IF4 A;  3DAL A;  4FA6 A;  4CYM D;  2AW6 A;  1OWN A;  4A63 B;  3JQ1 A;  3FH7 A;  2X6F A;  2QPW A;  4KT6 B;  2EIM E;  5JMN D;  2WMN A;  3FUK A;  1WDY A;  1KT0 A;  3RK6 A;  2KXP C;  3QJZ A;  3ASD A;  1SW6 A;  3ULQ A;  4G8K A;  1UW4 B;  1DCE A;  4BET A;  5HKP A;  4N2S A;  5FIN A;  4TUU A;  2VGY A;  2LXL A;  3Q4A B;  4U95 D;  4HOS A;  3PE4 A;  3DSW A;  5KJN A;  1FT2 A;  5JHA A;  3TWS A;  4JEU A;  2KC7 A;  4KVO A;  4BSX A;  5BV0 A;  1SVX A;  1OWO A;  4G2V A;  1YYH A;  2J49 A;  2E2E A;  1E7U A;  3S7F A;  3RAU A;  4BY6 A;  5FT9 A;  4YVQ C;  4B93 B;  2GGF A;  3Q75 A;  5B1B E;  4DJA A;  3QWV A;  4LCT A;  2X6K A;  4U63 A;  3ABM E;  2LXM A;  2WXG A;  2FEZ A;  3PNL B;  5JHN A;  3AAA C;  2VSN A;  3V31 A;  5JIY A;  4NJ5 A;  4DI3 A;  3MEK A;  3M55 A;  2AXZ A;  4EBA A;  3IHX A;  3HXD A;  3SW9 A;  3U64 A;  4UI9 J;  4HLL A;  3MV2 B;  3TWV A;  2XGO A;  4BT9 A;  3FTY A;  4KMO A;  2R17 C;  3DST A;  3CVP A;  1NP7 A;  1UG3 A;  1FVF A;  5JJ7 A;  2Y69 E;  2QYU A;  3APC A;  5ENT D;  3DEO A;  3TWU A;  1HU3 A;  4HFG A;  4GYY A;  2P9L G;  3QOU A;  1PC2 A;  4NAC A;  4LNB A;  5CBN A;  4U8V D;  1OCR E;  3ZYM A;  4G23 A;  4BFR A;  1WAO 1;  3V79 K;  4WND A;  3AG4 E;  2LAH A;  4LNG A;  3L22 A;  3PZ4 A;  4U0Z A;  4N3C A;  3CQG B;  1D9S A;  2OEW A;  2ZU6 B;  2WXK A;  4N3B A;  5AN8 A;  2XPY A;  1E96 B;  1K1A A;  4XI9 A;  4QFV A;  5CEC B;  3EIQ C;  4GZD A;  4DX2 A;  4LSZ E;  2FO1 E;  2GRO B;  4U04 A;  5BPP A;  4NVQ A;  3TWT A;  4PS8 A;  3EIJ A;  3ISM C;  2A5U A;  4AOF A;  2BTD A;  1BI7 B;  4AXH A;  4IJD A;  4L7T A;  1K3Z D;  1UN8 A;  4GYW A;  4OVU A;  2VQ2 A;  3RRN B;  2CFU A;  1HX8 A;  5ARF A;  2F8X K;  3ASG A;  1O1T A;  2J09 A;  3HYM B;  3ABK E;  1X5B A;  3L17 A;  3S7J A;  4AEZ C;  5D0Q D;  2IEJ A;  1O1R A;  3ZNG A;  3FU6 A;  2XEE A;  3KSQ A;  4OYS A;  2QYJ A;  3TJP A;  1N95 A;  2P9U G;  1NI1 A;  1O1S A;  4KBQ A;  3JXJ A;  5D2M C;  4FUL A;  3CVQ A;  2RFA A;  1OWL A;  4EZJ A;  2WXN A;  1NA3 A;  4RZ0 A;  3ASO E;  5ANL A;  4UWK A;  3ZHE B;  1S0P A;  2WXM A;  3DSU A;  3RO2 A;  4J6I A;  3CKB A;  4FHK A;  2BUG A;  5AQ9 A;  3HHM A;  2P2C P;  2L0T B;  4FHJ A;  3MJW A;  4A55 A;  3TL5 A;  1BU9 A;  5KJK A;  2WPV A;  4IYP A;  4AJW A;  2XEV A;  4CZ2 D;  2MHK A;  1IHG A;  1TN8 A;  3F9W A;  3PZD A;  3FY4 A;  4DX5 D;  4GCN A;  2QC9 A;  1BI8 B;  3R7R A;  2AVP A;  1RZ4 A;  2UY1 A;  5LP0 A;  2WXH A;  3TG5 A;  3ZYQ A;  4YPE A;  3CIA A;  1HO8 A;  3GZ2 A;  2KAT A;  4AVX A;  1UOH A;  3FTS A;  3ONL A;  4YDY A;  3BO5 A;  1KPS B;  1JCR A;  5LOZ A;  1LD8 A;  2XGM A;  4GMJ A;  4RLY A;  4K5C A;  3BEE A;  3EU5 A;  3I5P A;  1O9S A;  3V30 A;  3HXF A;  4XKB A;  3ESL A;  4IRU A;  4F3V A;  2YNQ A;  3MV3 B;  3ASF A;  2V5F A;  4WAF A;  1YCS B;  1QNF A;  5C2Y A;  4MBG A;  2WXF A;  3SBS A;  3UM3 A;  3JUE A;  1E7V A;  4V3I A;  3SQV A;  5IY5 E;  2GRL A;  1XGW A;  2L9B A;  5G05 J;  3UT4 A;  3CV0 A;  4GYO A;  3KMJ A;  3HRA A;  2LO6 A;  1G3N B;  2V4H C;  4L1B A;  4GCO A;  3E37 A;  3D9N A;  4GA1 A;  1H2U A;  4APF A;  1RW2 A;  1TN7 A;  4W9R A;  1IQU A;  3GZS A;  5AYF A;  3L6A A;  3O4Z A;  1MZC A;  2ETA A;  4FMU A;  3FP3 A;  5EKQ D;  3U9W A;  2CG3 A;  3APF A;  4NIK A;  3FTZ A;  2PNN A;  4E85 A;  4CT0 A;  3T8M A;  2R5S A;  5C1D A;  4WWO A;  5T4Y A;  3TG4 A;  2L6B A;  4GTR A;  1HF8 A;  3R7Q A;  4LUN U;  4L9P A;  4Y6C A;  1KLX A;  5FTP A;  1QBQ A;  2P9S G;  5T0K A;  3VUZ A;  4YPA A;  3CST A;  4Y6W A;  5TTF A;  2XS1 A;  4IN3 B;  1JWG A;  4I6G A;  4HVB A;  3NZU A;  3KAE A;  4K5B A;  4IUL A;  1OCC E;  3P2B A;  4ACK A;  5HS0 A;  4ANX A;  3FTV A;  2P9N G;  2H6H A;  4N39 A;  3SHF A;  1OUV A;  1Z6T A;  4ANU A;  3AG3 E;  3B7T A;  3JCK C;  1IXV A;  5EIB E;  4HNA D;  2BQZ A;  4NRH B;  4OAU C;  1N3J A;  2J8S D;  1H6O A;  4H12 A;  3MO2 A;  5CMW A;  3EJN A;  4AM9 A;  1V54 E;  2RFM A;  5D0O D;  1TNZ A;  3LVR E;  3UM2 A;  2KM4 A;  2IY0 C;  2VGX A;  1E8W A;  4DK5 A;  3TXM A;  4EPZ A;  2V4L A;  1ELR A;  1IKN D;  1N0R A;  2R03 A;  2EIJ E;  4B89 A;  2XS8 A;  1FT1 A;  3UXG A;  5CCL A;  1N9A A;  4FJY A;  5AQA A;  2GRP B;  4F1S A;  4NUR A;  3E30 A;  3ULY A;  4CGW A;  3ZYL A;  1PEG A;  2G46 A;  2HE0 A;  2ZGG A;  4C0E A;  2R05 A;  1DNP A;  4RQI A;  2BKK B;  5DBK A;  4HOR A;  2J07 A;  1H6P A;  2E0I A;  3DSX A;  2XPI A;  2ION A;  4N5Q A;  1XQH A;  2OND A;  4EHM A;  1PY1 A;  3E33 A;  3AS4 A;  3UM1 A;  1ZBP A;  5F6K C;  1HG2 A;  1KZP A;  2R3A A;  1X81 A;  4JDS A;  3FPD A;  3PZ2 A;  4JEH A;  3UT7 A;  3QDN A;  4HOQ A;  3APD A;  3CHO A;  4DLO A;  1DVP A;  4WUY A;  3SGH A;  3Q15 A;  4DUI A;  3OS5 A;  4OAV B;  4EZK A;  5E75 A;  1KT1 A;  4GTS A;  4YDE A;  1EPU A;  5T3R A;  5G04 C;  2CHZ A;  4A3V A;  4G1T A;  4QEO A;  2ZIR A;  5FJY A;  1FPP A;  1Z3X A;  4MI0 A;  3AG1 E;  4KYO B;  4HBD A;  4QEN A;  4XZ4 A;  2WXQ A;  4O1P A;  2PQR A;  4GB9 A;  2B6C A;  4A1S A;  1SZ9 A;  4PUC A;  3MZL B;  3DPY A;  5AAO A;  3C3O A;  2X3M A;  4QEP A;  4HOT A;  4I1A A;  2DYS E;  2DYR E;  3FEY A;  1XNF A;  2J08 A;  5JIN A;  4UUC A;  3ZUV B;  4Z4P A;  4C9B B;  3Q78 A;  3RAY A;  4J8S A;  2XQ0 A;  2UY1 B;  2XHE A;  3CVV A;  1OXJ A;  4PH4 B;  2F8Y A;  2F37 A;  3BU8 A;  2ILR A;  2WB2 A;  2KZT A;  3QAQ A;  3D9M A;  4BX9 A;  3LYA A;  2XPZ A;  1DCQ A;  1JCQ A;  5AYW D;  4XEI G;  3SWC A;  4N3A A;  3OPE A;  2OV8 A;  3DBS A;  3MKQ B;  1H6K A;  3S8P A;  3CBO A;  4ZFH A;  4GTO A;  3VTX A;  5CMY A;  5G2N A;  4HXI A;  1A17 A;  4I9C A;  1QZ2 A;  4JLG A;  1TN6 A;  1YA0 A;  5AQB A;  4CT4 A;  1Y8M A;  5JA4 D;  1JUQ A;  2MYO A;  3CHQ A;  3CVL A;  3SD5 A;  2XEH A;  3U4T A;  3L13 A;  4I6E A;  2NYJ A;  2RKK A;  3NB2 A;  4BES A;  3Q47 B;  3D9O A;  3KMA A;  1OY3 D;  4FC8 A;  3RU0 A;  1K1B A;  3G2T A;  4GPM A;  3DXM G;  4F7A A;  4BWR A;  5HI7 A;  4YNM A;  4KXK B;  3NQP A;  2I9C A;  3OXG A;  3ONK A;  4WWN A;  3L9T A;  3QKY A;  5EDS A;  4ILI A;  5ENP D;  3RJW A;  4ATZ D;  3T5X A;  2HO1 A;  3M5A A;  1W3B A;  3AG2 E;  3ZRH A;  5FZS A;  3OOI A;  2R02 A;  1LTX A;  2DWZ A;  2AWI A;  3FUL A;  4YVO A;  4HI9 A;  5EID A;  4DI4 A;  3DB5 A;  5LX8 A;  2F69 A;  3PUK A;  3FUI A;  2ZGD A;  4JA9 A;  4ACL A;  4LEU A;  2C0M A;  3HXC A;  5CRV A;  4CDN A;  5JHB A;  4GTV A;  2HR2 A;  2XCC A;  2Y3A A;  2CHX A;  1JPL A;  3KS2 A;  2JV0 A;  3UMV A;  2XCB A;  3CVX A;  3Q5M A;  1JWF A;  3QK0 A;  3PEV B;  4E6H A;  3EHN A;  1N94 A;  3MGB A;  2PM7 A;  3M58 A;  3CBP A;  3SBT B;  5CBO A;  4URK A;  4Q69 A;  1S70 B;  1Q2Z A;  4PS3 A;  3P1U A;  2GRQ B;  3LPZ A;  4J8O A;  3U66 A;  2Q7F A;  3AJI A;  3RRU A;  3KMT A;  1WG0 A;  4APO A;  1H2V C;  1INZ A;  1HG5 A;  2A5E A;  2VGX B;  4ILG A;  3E4B A;  3WG7 E;  3CLJ A;  5B3S E;  2IO2 C;  2RFI A;  3FU0 A;  1SA4 A;  5BNW A;  3G2S A;  5F6L A;  3OXL A;  3TAX A;  4B0Z A;  4HOU A;  5CEA A;  5ENS D;  2RG8 A;  2YIN A;  4YDO A;  3QWP A;  1LF8 A;  4LNU D;  4TV3 A;  3PH0 C;  2W5Z A;  4XKC A;  1FCH A;  5AAR A;  3L54 A;  1HS6 A;  2VTB B;  1O5M A;  4G8L A;  4R7L A;  3JUI A;  4ME2 A;  2WVI A;  4JZY A;  4RSY A;  1B89 A;  5G04 J;  4DX7 D;  3CGH A;  1KZO A;  3ENE A;  1SQM A;  3HVE A;  3HNA A;  2Y4T A;  3ASH A;  1N54 A;  2LUH A;  1BPO A;  2WXL A;  1ELW A;  3SO8 A;  1E8Y A;  4U07 A;  2BED A;  4EQF A;  2WQ6 A;  3EUV A;  3O48 A;  1FVH A;  4L23 A;  4WNG A;  3FTW A;  5FQ4 A;  4D10 C;  2AJA A;  5EG2 A;  4GAA A;  1BLX B;  4BER A;  2ETB A;  4EBA G;  4JHJ A;  5FWQ A;  3DSV A;  4B94 A;  3UQ3 A;  1Z5S C;  3LXU X;  1ELK A;  3UKU G;  3MYV A;  2I6H A;  1E8X A;  1TEZ A;  5T5G A;  3CR3 A;  4I51 A;  4F53 A;  3ZVV A;  1TNB A;  3GZ1 A;  3BG0 B;  3AU4 A;  2J4D A;  2V0P A;  5B1A E;  2IJG X;  3CK9 A;  4IJ8 A;  3RKV A;  3ESK A;  3PEU B;  1MJ0 A;  4UWG A;  4KZC A;  3B13 A;  3JQ0 A;  3ZXP A;  2ZXW E;  1TNY A;  3ZU7 B;  1MYO A;  3PRZ A;  1TR4 A;  4C48 B;  3S7D A;  2UWJ G;  4MI5 A;  2IO3 C;  3B95 A;  5LSZ A;  4HI8 A;  3J5Q B;  1TYQ G;  3IBE A;  4UWF A;  3V2X A;  2DZN A;  3IKO B;  4MLP A;  5F5E A;  3CHM A;  3IV0 A;  3FH5 A;  3RSE G;  3ZYK A;  3DSS A;  4G26 A;  2PQN A;  2KZT B;  3EU9 A;  1S64 A;  3NBN B;  3UIP C;  4AU7 A;  3MO5 A;  3UIO C;  3ML9 A;  4I9E A;  4XI0 A;  1H3I A;  3QNK A;  5BUZ A;  4TXP A;  3HXE A;  3MA5 A;  4RG9 A;  3EHR A;  4I2Z A;  3TWR A;  1TJC A;  1EDU A;  4I2W A;  1N4R A;  3IHY A;  3LEW A;  3D9K A;  4BX8 A;  3NF1 A;  5JJ0 A;  5AQ7 A;  3UPV A;  2VJ8 A;  4JW1 A;  3RQ4 A;  4GMR A;  1TJF A;  1NL4 A;  2J9Q A;  5F59 A;  1VDY A;  3CK7 A;  3MO0 A;  4FJZ A;  1MVX A;  2LNI A;  4LER A;  2O8J A;  3Q79 A;  3KSL A;  3N71 A;  2LSU A;  3SFY A;  4Z68 A;  3R9M A;  3SI5 A;  5AJD A;  3KD7 A;  3AS8 A;  3Q9N C;  4A3T A;  2C2L A;  2KCL A;  3G2U A;  3PRE A;  4O30 A;  1H0A A;  1JCS A;  4FP7 A;  3PUJ A;  1UJK A;  4O60 A;  4GTQ A;  5M72 A;  2FO7 A;  2XGS A;  3F6Q A;  4YNP A;  4GPK A;  4UI9 K;  2F0Y A;  3Q7F A;  3QC1 A;  4HQD A;  4DPR A;  2I2O A;  3ZGQ A;  1Y6I A;  4AV7 A;  4C0M A;  1MT6 A;  2EIK E;  1NFI E;  1V55 E;  4ANW A;  4JHK A;  1IHB A;  4O1O A;  4ZHB A;  2X6I A;  3DRA A;  4RG6 A;  1ML9 A;  4I1O B;  3PE3 A;  4HS2 A;  4PDX A;  3G2V A;  3FUE A;  2CFZ A;  1HE8 A;  1D8E A;  4KZ0 A;  4GA2 A;  2OVB A;  3SNX A;  3FTX A;  3MX3 A;  4X8Q A;  4OVV A;  3KEA A;  4L2Y A;  3RJV A;  3LDZ A;  4MS6 A;  5EX3 A;  3TXN A;  5ENR D;  4HRM B;  3VV0 A;  3S7B A;  4JPS A;  4UQX A;  4K5A B;  4BEP A;  2WQ7 A;  3Q7A A;  4PS7 A;  2W5Y A;  5E76 A;  3D3M A;  3VLE A;  4DRX E;  2JAB A;  4CEM A;  2VSX E;  4UQZ A;  4NQ0 A;  3VLD A;  1K8K G;  4J0U A;  5EYL A;  2V8S E;  3FUH A;  3ZXS A;  2AXU A;  2GRM A;  4XX5 A;  5J08 A;  1WY6 A;  2YQ8 A;  3M53 A;  3ZKJ A;  5CPR B;  2Y1L E;  3C72 A;  3L08 A;  2LSV A;  3SFX A;  4JL0 A;  3V2O A;  4FU3 A;  2WXI A;  4UQY A;  4ANV A;  4GTM A;  4TXQ A;  2DIW A;  4L2L A;  4TXR A;  4H7Y A;  3TGO A;  2RD0 A;  1MX6 A;  2AXV A;  2YHE A;  1QQE A;  2FF4 A;  4A1G A;  3LJN A;  3PDN A;  5TH7 A;  3AS5 A;  5A23 A;  2WQH A;  2DVW A;  5HQ8 A;  3FUJ A;  3LCA A;  3HVE B;  3M57 A;  1N0Q A;  4BTA A;  3GYZ A;  3PNT B;  2WXJ A;  5FQ8 A;  2P9P G;  1ZB1 A;  2P9K G;  1OCO E;  3AU5 A;  3NZS A;  1YMP A;  2JEK A;  5ENO D;  3FH8 A;  5FZQ A;  3ZEF A;  4UWL A;  2VYI A;  4BSZ B;  3I4G A;  3C98 A;  3CVN A;  2WXR A;  4WWP A;  3C3R A;  3PS6 A;  2NXP A;  4U0U A;  3K9I A;  4I43 A;  4J7W A;  4Q94 A;  5CED B;  4AIF A;  1IYG A;  3UKR G;  1N6C A;  2VSY A;  1MX4 A;  3IXE A;  1SZA A;  3F9Z A;  3SZ7 A;  5LCW C;  1N6A A;  3LY9 A;  2GW1 A;  4JXT A;  1HXI A;  4I17 A;  5J90 A;  3QAR A;  2FBN A;  3M56 A;  5JJT A;  2DZO A;  3CBM A;  1HFA A;  3CQC B;  5KJL A;  1AWC B;  3OAW A;  4GZ6 A;  1OWP A;  3FTU A;  5FZR A;  5T8I A;  5CCM A;  3EP0 A;  5G05 C;  1TNU A;  4BUP A;  2B0O E;  3F9X A;  5CRU A;  2CHW A;  5ENN A;  4K03 A;  2QZA A;  3C3Q A;  5KWD A;  1QYM A;  2ZIS A;  3CHP A;  2PL2 A;  3B7B A;  3DXK G;  4CDR A;  2ETC A;  3RO3 A;  4DLQ A;  1L5J A;  1OT8 A;  5CHE E;  3KEZ A;  4AP2 A;  3MKR A;  3UIN C;  2OCC E;  5BW8 C;  2EIN E;  3IHV A;  3CVY A;  5KNG A;  2KCK A;  4FLH A;  3TWW A;  3L82 A;  3CSF A;  3TWQ A;  4TUM A;  5FIO A;  2XRZ A;  2DCP A;  3X2Q E;  4B8C B;  3MCX A;  3LJ3 A;  5CER B;  2X38 A;  3S2A A;  2H6F A;  3FUM A;  4GA0 A;  5LFA A;  4DX1 A;  4HB5 A;  4EEC A;  2HM8 A;  1EYH A;  4J8D A;  4GZ3 A;  4LDG A;  5ARG A;  4WNF A;  3W9F A;  4FAD A;  3VTY A;  2PM6 A;  5D66 A;  3CVU A;  1S63 A;  5BV1 A;  3BUA A;  2Y0B G;  1EF1 C;  2WMO A;  3T9K A;  2OEV A;  3GW4 A;  3U3W A;  2XRY A;  1SA5 A;  1BD8 A;  2H6G A;  3FU3 A;  3URZ A;  1AP7 A;  2FI7 A;  1E8Z A;  3FWV A;  3G2W A;  3M59 A;  3NAW A;  4ILH B;  5A7D B;  1E90 A;  3ML8 A;  3B7S A;  4LG6 A;  3CK8 A;  2BF0 X;  5ANR A;  5BXO A;  1NA0 A;  2WM9 A;  2V5Q C;  2YHC A;  4JD2 G;  2R59 A;  1MX2 A;  3NOC D;  2BKG A;  4U8Y D;  2EQX A;  4YND A;  2EIL E;  4AY5 A;  1N4Q A;  3FUF A;  4UWH A;  5BXU A;  3HXB A;  3FU5 A;  4HRN A;  3PVL A;  4I1M A;  3D9H A; 
#chains in the Genus database with same CATH homology
 1PY1 A;  2AXZ A;  4EBA A;  3ML9 A;  4I9E A;  4XI0 A;  1H3I A;  3AS4 A;  1ZBP A;  3IHX A;  3QNK A;  4U0S A;  5BUZ A;  3SW9 A;  3U64 A;  4UI9 J;  3MV2 B;  4O6F A;  5F6K C;  5A6C A;  2XGO A;  3DPD A;  1HG2 A;  3MA5 A;  4BT9 A;  3FTY A;  4RG9 A;  3R9A B;  2R3A A;  1H19 A;  4I2Z A;  2I1K A;  3EDT B;  4KMO A;  3K5K A;  2R17 C;  1TJC A;  1EDU A;  4I2W A;  3CVP A;  1NP7 A;  1UG3 A;  4JDS A;  1FVF A;  3FPD A;  5FQ6 A;  5JJ7 A;  3UX4 A;  4JEH A;  3APC A;  3IHY A;  3LEW A;  3D9K A;  3QDN A;  4HOQ A;  3UT7 A;  3NF1 A;  3APD A;  4BX8 A;  5JJ0 A;  1HU3 A;  3CHO A;  1DVP A;  4GYY A;  4HFG A;  4WUY A;  3SGH A;  3QOU A;  1PC2 A;  4DLO A;  4NAC A;  3IEG A;  3Q15 A;  3UPV A;  3OS5 A;  4B8A A;  2VJ8 A;  4JW1 A;  4EZK A;  5E75 A;  1Z3Y A;  1KT1 A;  3ZYM A;  5AIJ A;  4G23 A;  3RQ4 A;  1TJF A;  4BFR A;  4J8F A;  4MRU A;  1WAO 1;  2J9Q A;  5F59 A;  1VDY A;  3CK7 A;  4CRW A;  1EPU A;  3CHR A;  4WND A;  5T3R A;  2LAH A;  3MO0 A;  4FJZ A;  5G04 C;  2CHZ A;  3L22 A;  4A3V A;  4FLB A;  4G1T A;  2LNI A;  2C0L A;  3B7U X;  4Q96 A;  4H7X A;  4U0Z A;  1MVX A;  4N3C A;  3FHE A;  4LER A;  5FJY A;  3CVV A;  4EZL A;  3CQG B;  2O8J A;  3N71 A;  1Z3X A;  3T5V A;  5EX0 A;  2LSU A;  3SI5 A;  3LKU A;  1IQR A;  4MI0 A;  2ZU6 B;  5AJD A;  3KD7 A;  3D9L A;  3AS8 A;  2WXK A;  4A3T A;  4N3B A;  2LAI A;  4KYO B;  2C2L A;  2KCL A;  3G2U A;  2XPY A;  5JJ6 A;  1E96 B;  2NSZ A;  3PRE A;  4O30 A;  4QEN A;  1H0A A;  4XZ4 A;  4FP7 A;  4XI9 A;  2WXQ A;  4QFV A;  2PQR A;  3CKC A;  3EIQ C;  3PUJ A;  1UJK A;  4GZD A;  4GB9 A;  2X6J A;  4A1S A;  5M72 A;  1SZ9 A;  2CG2 A;  2FO7 A;  2P58 C;  2XGS A;  3JYS A;  3OXF A;  4PUC A;  3MZL B;  3HIZ A;  4N2Q A;  4U04 A;  5BPP A;  4NVQ A;  2X3M A;  4YNP A;  4QEP A;  4GPK A;  4BTB A;  4UI9 K;  4CGV A;  2QY7 A;  3QC1 A;  4HOT A;  4DPR A;  2J4B A;  4I1A A;  1HZ4 A;  4PS8 A;  1U3D A;  4HLE A;  3EIJ A;  4ATG A;  2I2O A;  3ZGQ A;  4I6J A;  3FEY A;  1Y6I A;  2A5U A;  1XNF A;  2J08 A;  4AV7 A;  4C0M A;  1MT6 A;  5JIN A;  3RRM B;  4Z4P A;  3I3N A;  4C9B B;  4AOF A;  3M54 A;  3FEX A;  3RAY A;  4ANW A;  2BTD A;  4JHK A;  2IOS A;  4J8S A;  2XQ0 A;  4AXH A;  2UY1 B;  2X6I A;  2XHE A;  3MKQ A;  4I1O B;  2A4Z A;  4RG6 A;  3PE3 A;  4HS2 A;  4PH4 B;  4L7T A;  5LCW J;  1MHQ A;  4PDX A;  3G2V A;  1UN8 A;  3FUE A;  2CFZ A;  4XE0 A;  1HE8 A;  4GYW A;  5AEN A;  2ILR A;  4GA2 A;  2KZT A;  4KZ0 A;  4OVU A;  2WB2 A;  3QAQ A;  2OVB A;  2VQ2 A;  4MKT A;  3D9M A;  3RRN B;  3ZW3 A;  3FUN A;  4BX9 A;  2CFU A;  1HX8 A;  5ARF A;  3LYA A;  5KCM A;  3ASG A;  3SNX A;  3CHS A;  2XPZ A;  2J09 A;  1ML9 A;  3FTX A;  3HYM B;  1X5B A;  5AYW D;  3L17 A;  3SWC A;  3S7J A;  4AEZ C;  5D0Q D;  2L6J A;  3MX3 A;  4N3A A;  3OPE A;  2OV8 A;  4OVV A;  3DBS A;  3MKQ B;  3SFZ A;  3FU6 A;  4L2Y A;  3RJV A;  3LDZ A;  2IQC A;  4MS6 A;  5EX3 A;  1H6K A;  4XIF A;  3TXN A;  3S8P A;  4AY6 A;  3CBO A;  2IGQ A;  4G11 A;  4OYS A;  4ABN A;  3VV0 A;  3TJP A;  2L0I A;  3S7B A;  4CDM A;  3QWW A;  4JPS A;  3LS8 A;  4UQX A;  3VTX A;  3D9J A;  4GML A;  3B7R L;  5CMY A;  5G2N A;  4HXI A;  4KBQ A;  4GU5 A;  2WQ7 A;  1A17 A;  4I9C A;  1QZ2 A;  3LY8 A;  2WXP A;  4GZ5 A;  4PS7 A;  4U8H A;  4M3O A;  1MUF A;  2W5Y A;  4JLG A;  5E76 A;  4E47 A;  3D3M A;  3VLE A;  4FUL A;  4CEM A;  1YA0 A;  4CT4 A;  4TRQ A;  4BT8 A;  3CVQ A;  1Y8M A;  1JUQ A;  3F9Y A;  4I1M A;  2VSX E;  1OWL A;  4UQZ A;  4NQ0 A;  3VLD A;  4EZJ A;  4JVS A;  3CHQ A;  2WXN A;  2Y4U A;  3CVL A;  2WXO A;  4J0U A;  3SD5 A;  2V8S E;  2KCV A;  3FUH A;  3L13 A;  4I6E A;  3U4T A;  4UI9 C;  2AXU A;  3UUX A;  3ZXS A;  1NA3 A;  4RZ0 A;  2GRM A;  5LSX A;  2OVF A;  4J7F A;  4XX5 A;  5J08 A;  1U3C A;  5ANL A;  4UWK A;  1WY6 A;  3Q47 B;  2YQ8 A;  3ZHE B;  4CCA A;  3M53 A;  3D9O A;  3KMA A;  5CPR B;  1S0P A;  3ZIM A;  2WXM A;  4FC8 A;  3RO2 A;  1ZU2 A;  3RU0 A;  3G2T A;  4J6I A;  3L08 A;  2LSV A;  2QFC A;  5KJM A;  4JL0 A;  3ZPJ A;  3CKB A;  4F7A A;  1H2T C;  4FHK A;  2BUG A;  4BWR A;  4FU3 A;  2WXI A;  2ION A;  4UQY A;  3WXX A;  1ZKK A;  3HHM A;  2X6H A;  2L0T B;  4FHJ A;  5HI7 A;  3MJW A;  4ANV A;  4YNM A;  4KXK B;  4A55 A;  2DIW A;  3NQP A;  2I9C A;  4L2L A;  3TL5 A;  5KJK A;  3OXG A;  2WPV A;  3ONK A;  4IYP A;  4WWN A;  1MVH A;  2VSO E;  3UT8 A;  1N52 A;  4H7Y A;  3Q49 B;  4YPE A;  3QKY A;  5EDS A;  3CVW A;  4AJW A;  4ILI A;  3TGO A;  2XEV A;  4KVM A;  3RJW A;  2MHK A;  4J8E A;  4RVB A;  3T5X A;  2RD0 A;  1HH8 A;  2HO1 A;  3M5A A;  1IHG A;  1W3B A;  2AXV A;  1UN9 A;  3ZRH A;  2YHE A;  1QQE A;  2FF4 A;  3F9W A;  3PZD A;  4A1G A;  5FZS A;  3PDN A;  5TH7 A;  3AS5 A;  5A23 A;  2WQH A;  3FY4 A;  3OOI A;  5HQ8 A;  2AWI A;  4GCN A;  3FUL A;  2AVP A;  3FUJ A;  3R7R A;  4YVO A;  2MOW A;  3FDH A;  3LCA A;  3HVE B;  2UY1 A;  4DI4 A;  3DB5 A;  3VLF A;  5LP0 A;  5LX8 A;  2WXH A;  2F69 A;  2IOL A;  3TG5 A;  3PUK A;  3M57 A;  3FUI A;  4JA9 A;  3ZYQ A;  3CIA A;  4ACL A;  2C0M A;  4LEU A;  4G25 A;  1HO8 A;  3GYZ A;  3EHM A;  3GZ2 A;  3PNT B;  2WXJ A;  4BTA A;  4CDN A;  5JHB A;  5FQ8 A;  2DBA A;  3FUD A;  2HR2 A;  2KAT A;  2XCC A;  4AVX A;  2Y3A A;  2CHX A;  3FTS A;  1GW6 A;  3ONL A;  3AU5 A;  3NZS A;  3BO5 A;  1JPL A;  4JA7 A;  3KS2 A;  5LOZ A;  2JEK A;  4C1Q A;  2JV0 A;  3UMV A;  1NZN A;  2XCB A;  2XGM A;  3CVX A;  3Q5M A;  3FH8 A;  5FZQ A;  3FFL A;  1JWF A;  4GMJ A;  4JHR A;  3QK0 A;  3PEV B;  1PAQ A;  4UWL A;  3ZEF A;  1WM5 A;  4E6H A;  2VYI A;  3EHN A;  3BEE A;  3I4G A;  3MGB A;  3C98 A;  3CVN A;  3I5P A;  2PM7 A;  1O9S A;  2WXR A;  4WWP A;  3M58 A;  2PZI A;  2NXP A;  3PS6 A;  4U0U A;  2I1J A;  3K9I A;  3RIB A;  4I43 A;  1UJJ A;  3L16 A;  4Q94 A;  3CBP A;  4AIF A;  3SBT B;  4XKB A;  1IYG A;  3ESL A;  5AJL A;  4URK A;  4IRU A;  4F3V A;  4Q69 A;  1N6C A;  5DIZ A;  1MQS A;  2VSY A;  5G55 A;  4PS3 A;  3P1U A;  2YNQ A;  5T0M A;  1SZA A;  3MV3 B;  3F9Z A;  3SZ7 A;  3ASF A;  4GZC A;  5LCW C;  1N6A A;  3LPZ A;  4J8O A;  3U66 A;  2V5F A;  4WAF A;  3D9P A;  2Q7F A;  4J7I A;  3LY9 A;  3RRU A;  1QNF A;  3I4R B;  5C2Y A;  4LRZ A;  2FUL A;  2WXF A;  3SBS A;  4J83 A;  1E7V A;  2GW1 A;  5FQ7 A;  4V3I A;  2IU1 A;  4JXT A;  3KMT A;  3BG1 B;  1HXI A;  2GRL A;  3LVQ E;  1XGW A;  4I17 A;  2L9B A;  1P5Q A;  1H2V C;  5G05 J;  4APO A;  5J90 A;  1INZ A;  3QAR A;  1HG5 A;  5TEG A;  3ZFW A;  2FBN A;  2M63 A;  2VGX B;  3UT4 A;  4ILG A;  3CV0 A;  3E4B A;  3M56 A;  5JJT A;  4GYO A;  3KMJ A;  3CLJ A;  2LO6 A;  2RFI A;  3ZHE A;  3CBM A;  3CEQ A;  1HFA A;  3CQC B;  4L1B A;  3SF4 A;  5KJL A;  4GCO A;  3OAW A;  4GZ6 A;  1OWP A;  3FTU A;  5FZR A;  4YPU A;  3D9N A;  5T8I A;  5CCM A;  2HYZ A;  4GA1 A;  1H2U A;  3FU0 A;  4APF A;  5G05 C;  3QB2 A;  2VTB A;  2MRI A;  5BNW A;  3G2S A;  3LY7 A;  3ZN3 A;  3OXL A;  4W9R A;  4N5C A;  5F6L A;  1IQU A;  4K0R A;  3TAX A;  4BUP A;  3HDX A;  3GZS A;  4B0Z A;  4HOU A;  4WNE A;  3F9X A;  5AYF A;  3L6A A;  2RG8 A;  2YIN A;  3O4Z A;  2CHW A;  5ENN A;  4FMU A;  3D9I A;  3FP3 A;  5EKQ D;  4K03 A;  2OOE A;  3U9W A;  2CG3 A;  1LF8 A;  3APF A;  3QWP A;  1OWM A;  3FTZ A;  4P29 A;  4TV3 A;  3PH0 C;  2W5Z A;  3CHP A;  4JC8 A;  2PL2 A;  4XKC A;  4CT0 A;  4E85 A;  1FCH A;  3T8M A;  5BT1 A;  4CDR A;  3OTN A;  2R5S A;  3L54 A;  1HS6 A;  2VTB B;  5C1D A;  3RO3 A;  4G24 A;  4WWO A;  2IFU A;  4DLQ A;  1L5J A;  4R7L A;  5T4Y A;  3TG4 A;  4QEO A;  3JUI A;  1HF8 A;  5CHE E;  3R7Q A;  2JLB A;  4LUN U;  3KEZ A;  4ME2 A;  2WVI A;  4AP2 A;  3MKR A;  4JZY A;  2NC9 A;  2IF4 A;  4RSY A;  4Y6C A;  1KLX A;  1B89 A;  5FTP A;  5T0K A;  3VUZ A;  5G04 J;  4YPA A;  3CST A;  3CGH A;  4Y6W A;  5BW8 C;  3ENE A;  1SQM A;  5TTF A;  3DAL A;  4FA6 A;  3HVE A;  3HNA A;  3IHV A;  3CVY A;  4IN3 B;  2Y4T A;  3ASH A;  2AW6 A;  1JWG A;  2KCK A;  1N54 A;  4I6G A;  1BPO A;  2WXL A;  1ELW A;  4FLH A;  1OWN A;  3NZU A;  4HVB A;  3JQ1 A;  3CSF A;  3FH7 A;  1E8Y A;  3KAE A;  4U07 A;  2X6F A;  4EQF A;  2WQ6 A;  2QPW A;  4IUL A;  2XRZ A;  3O48 A;  1FVH A;  2DCP A;  4KT6 B;  4L23 A;  3P2B A;  4B8C B;  3MCX A;  3LJ3 A;  4ACK A;  4WNG A;  3EP0 A;  2WMN A;  3FTW A;  3FUK A;  4ANX A;  3FTV A;  2X38 A;  3S2A A;  5FQ4 A;  1KT0 A;  3FUM A;  4D10 C;  3RK6 A;  4GA0 A;  4N39 A;  5LFA A;  5EG2 A;  4GAA A;  3SHF A;  3QJZ A;  1OUV A;  1Z6T A;  4ANU A;  4EEC A;  2HM8 A;  4EBA G;  1EYH A;  3ASD A;  3B7T A;  3JCK C;  4JHJ A;  3ULQ A;  4J8D A;  4GZ3 A;  1UW4 B;  4IJD A;  5FWQ A;  4LDG A;  5ARG A;  4B94 A;  4WNF A;  3UQ3 A;  4N2S A;  4TUU A;  3LXU X;  4FAD A;  1ELK A;  2BQZ A;  2VGY A;  3MYV A;  3Q4A B;  2I6H A;  4NRH B;  2PM6 A;  3VTY A;  3CVU A;  1N3J A;  5BV1 A;  1E8X A;  1TEZ A;  5T5G A;  4H12 A;  3MO2 A;  5CMW A;  3CR3 A;  3EJN A;  1EF1 C;  4I51 A;  4F53 A;  2WMO A;  4HOS A;  3PE4 A;  3ZVV A;  4AM9 A;  3GZ1 A;  3BG0 B;  3GW4 A;  3AU4 A;  3U3W A;  2XRY A;  2J4D A;  5D0O D;  3LVR E;  2V0P A;  3FU3 A;  3URZ A;  2IJG X;  2KM4 A;  3CK9 A;  4IJ8 A;  5KJN A;  5JHA A;  3RKV A;  3ESK A;  3PEU B;  4JEU A;  2KC7 A;  2VGX A;  4UWG A;  2FI7 A;  4KVO A;  1E8W A;  4KZC A;  4BSX A;  3B13 A;  5BV0 A;  4DK5 A;  1E8Z A;  3FWV A;  3TXM A;  4EPZ A;  2V4L A;  1OWO A;  3JQ0 A;  1ELR A;  4G2V A;  3G2W A;  4B89 A;  3M59 A;  2J49 A;  5CCL A;  3PRZ A;  2E2E A;  3S7D A;  2UWJ G;  4MI5 A;  4ILH B;  5A7D B;  1E90 A;  1E7U A;  4FJY A;  3S7F A;  3ML8 A;  5LSZ A;  3B7S A;  4BY6 A;  5FT9 A;  3CK8 A;  2BF0 X;  4F1S A;  4NUR A;  4YVQ C;  4CGW A;  3ZYL A;  5ANR A;  1NA0 A;  2WM9 A;  2GGF A;  1PEG A;  2G46 A;  3IBE A;  4AU7 A;  4UWF A;  4DJA A;  2YHC A;  3QWV A;  4LCT A;  4C0E A;  3IKO B;  2X6K A;  2R59 A;  4U63 A;  4MLP A;  1DNP A;  5F5E A;  2WXG A;  3CHM A;  3IV0 A;  3FH5 A;  2EQX A;  5DBK A;  4YND A;  4AY5 A;  3ZYK A;  4HOR A;  2J07 A;  2FEZ A;  3PNL B;  5JHN A;  3FUF A;  2VSN A;  4G26 A;  2PQN A;  4UWH A;  5JIY A;  4NJ5 A;  2KZT B;  3FU5 A;  3PVL A;  2E0I A;  2XPI A;  4DI3 A;  3MEK A;  1XQH A;  3MO5 A;  2OND A;  3M55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...