3S7FA

Structural basis of substrate methylation and inhibition of smyd2
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
429
structure length
429
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Substrate Methylation and Inhibition of SMYD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords N-lysine methyltransferase SMYD2
total genus 152
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3s7fA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s7fA01
4JLGA 4GPKA 4AY6A 4G25A 5LCWC 1ZBPA 4AY5A 2R3AA 4J8DA 1KT1A 5HI7A 3U4TA 3M57A 4APOA 4YPEA 4J7FA 3VUZA 4J83A 4G26A 4C1QA 2KCVA 4J8EA 4GYWA 4W9RA 4LEUA 5DBKA 4AIFA 3CBOA 3TGOA 3RJWA 3F9WA 3QWWA 3CK9A 3RQ4A 3N71A 4HOUA 4MI5A 3S7JA 1MUFA 3FP3A 5JHNA 4N3AA 3MKRA 3M58A 3F9XA 4YPAA 4O6FA 2FF4A 3MV2B 4RG6A 2DBAA 5ARFA 5DIZA 3S7FA 5BNWA 3ASHA 3SZ7A 3SF4A 4EQFA 3ZGQA 4I2ZA 3PE4A 3QKYA 4Z4PA 3HNAA 4H12A 2HO1A 5BW8C 2FI7A 4U07A 4YNMA 5F59A 3ULQA 1ELRA 2F69A 5D0QD 4YVQC 2VSYA 5LSXA 5JJ6A 2P58C 2Y4UA 5G05J 1XNFA 1B89A 3S8PA 3CVNA 1W3BA 3KMTA 1N3JA 2OOEA 1PEGA 3SWCA 4N5CA 1ZU2A 1OUVA 5CCLA 3AS4A 4CGVA 2IF4A 3Q5MA 3KMAA 3ZHEB 2YQ8A 4AM9A 1WAO1 4N3BA 1N6AA 4GCNA 4GYYA 3OXGA 4U0SA 5FJYA 3UUXA 2UY1A 3CVPA 3OXLA 3LCAA 4JL0A 5G05C 4JDSA 4U0ZA 1QZ2A 2UWJG 1N6CA 5AYFA 3GZ1A 2W5ZA 1HZ4A 2C0LA 2VGXA 4IJDA 3AS5A 3LY8A 4NQ0A 5CPRB 4HOTA 4YVOA 3NF1A 2FEZA 2VQ2A 1P5QA 5FZQA 3M54A 4O30A 3R9AB 5HQ8A 1MVXA 5T0KA 2AVPA 5TTFA 3KAEA 1XQHA 4GYOA 2XPIA 3CEQA 4UI9J 5C1DA 3BEEA 1ELWA 3ZFWA 4I9CA 3M59A 2PZIA 5JINA 3PE3A 2BQZA 4BTBA 5LCWJ 1IYGA 4GA1A 3QWPA 3ASDA 3TAXA 2WQHA 1PC2A 3FPDA 4AU7A 5FTPA 1Y8MA 4Y6WA 1E96B 3CK8A 2KCKA 3UQ3A 2HR2A 2L6JA 3MO0A 5BT1A 4GA0A 3CKBA 2LSUA 5A7DB 5EKQD 2BUGA 2V5FA 3EDTB 5F6KC 4HOSA 3CKCA 4KBQA 3MA5A 4F3VA 4U0UA 2MHKA 3K9IA 2FBNA 3Q49B 4H7YA 2HYZA 2NC9A 3CVLA 2XEVA 3AS8A 3OOIA 3QWVA 2XCCA 1FCHA 4I1AA 4LDGA 5G04C 2C0MA 4YNPA 3FWVA 4I17A 4QEPA 4BTAA 4Y6CA 5T5GA 3MEKA 4U04A 4FMUA 3GW4A 3Q47B 4KXKB 4NRHB 1MVHA 1ZKKA 4RG9A 5EG2A 3ZN3A 2R5SA 5TEGA 5F6LA 2WPVA 4GCOA 2VYIA 4CDRA 4WNDA 1NA0A 2VGYA 1KLXA 5ARGA 1WM5A 4XIFA 1A17A 3GYZA 3TG4A 3QDNA 2LNIA 3RJVA 3M55A 4J8FA 3GZ2A 4HOQA 4A1SA 4J7IA 2QFCA 3VTYA 4JHRA 3RU0A 4WNEA 3SW9A 3HYMB 4UQZA 4E47A 4GZ6A 3RAYA 3VV0A 5FT9A 4YNDA 2KATA 1ML9A 3UPVA 3DB5A 2KCLA 4GZ5A 3CBMA 1HH8A 3S7BA 5FZSA 2IGQA 1HXIA 4WNFA 3FFLA 4HORA 3RIBA 3MO2A 4QENA 4NVQA 4IN3B 4BT9A 3VTXA 4RZ0A 5CCMA 3ESKA 4JA7A 2C2LA 3BO5A 2XCBA 3CK7A 4N39A 1H3IA 3ASGA 4KYOB 5T0MA 2PQNA 2VGXB 1TJCA 5JIYA 3K5KA 4N2SA 5JJTA 1MT6A 3O48A 4BT8A 4XI9A 3IHXA 4JA9A 4I9EA 4GA2A 2W5YA 4UQYA 2I6HA 4UI9C 3CV0A 1YA0A 3U3WA 4XI0A 4ME2A 4H7XA 4YPUA 1KT0A 2YHCA 5CHEE 2XGOA 3CVQA 4IJ8A 4ABNA 5KJLA 3KD7A 4MI0A 3Q15A 4UI9K 5G04J 4CGWA 3OS5A 3F9ZA 2LSVA 3M5AA 2RFIA 4WNGA 4BWRA 3MV3B 3KS2A 3LPZA 4N3CA 3CBPA 4BUPA 3E4BA 3DALA 2KC7A 5KJMA 3QOUA 4G23A 2JV0A 3OPEA 2PL2A 3OXFA 2Q7FA 5AYWD 1O9SA 3TG5A 5M72A 3M53A 3RO2A 1NA3A 4G1TA 5LSZA 2O8JA 3RO3A 2GW1A 5FZRA 5JJ7A 4I2WA 2J9QA 3Q4AB 4B94A 3ZPJA 4QEOA 5KJKA 3ASFA 2QPWA 2IFUA 5D0OD 5F5EA 4N2QA 1QQEA 1IHGA 4I51A 3MO5A 4GZ3A 4WUYA 3LY9A 5EX0A 3EP0A 3RKVA 3PDNA 4J0UA 3F9YA 3LY7A 4G2VA 2XGMA 3S7DA 4G24A 2XGSA 4UQXA 2E2EA 5EX3A 5KJNA 3WXXA 4J8OA 1NZNA 2VSNA 5JJ0A 2UY1B 3M56A 2FO7A 3IEGA 2Y4TA 4NJ5A 3ZHEA 3LKUA 2PQRA 5TH7A 5A6CA 3LYAA 3URZA 2G46A 3KMJA 2ONDA 2JLBA 3JYSA
chains in the Genus database with same CATH superfamily
2P9LG 4G25A 3QNKA 5LCWC 3T5XA 1FPPA 1H19A 2R3AA 3M57A 5KNHD 4EZLA 4JZYA 4G26A 3NZSA 4GTVA 3S2AA 3TGOA 1H2UA 3JUIA 3QWWA 2ETBA 3S7JA 1UN9A 5JHNA 3F9XA 1MX2A 2FF4A 3MV2B 4ILGA 4RG6A 2IJGX 1LF8A 3ENEA 1HG5A 1Q2ZA 4ANWA 1YYHA 1JCQA 3VLDA 4J8YA 4EQFA 2A5EA 2EIKE 2H6GA 4DLQA 2XRYA 4Z4PA 3HRAA 3OTNA 3L54A 1MX4A 5BW8C 4YNMA 1OWNA 2XZTG 2F0YA 4FP7A 2VSYA 4JW1A 4TV3A 5JJ6A 3DPYA 2WXFA 4AEZC 2WQ7A 3UIPC 3S8PA 3Q78A 1N95A 3CVNA 3BQOA 1E8XA 3KMTA 1N3JA 1OUVA 3KMAA 3Q5MA 2R02A 3FUKA 3LJNA 4MBGA 4U0SA 3ZXSA 2IQCA 2UY1A 2X6HA 1BD8A 5G05C 3B7SA 1UN8A 4L1BA 1QZ2A 3EU9A 1N6CA 2KXPC 3ZNGA 2C0LA 2IOLA 4IJDA 3FUDA 3AS5A 3T8MA 4GU5A 1E8WA 4Q96A 5CPRB 4HOTA 3NF1A 2FEZA 2VQ2A 1N9AA 1ELKA 2LAHA 5FZQA 4O30A 5HQ8A 5IY5E 2AVPA 4DI3A 4EECA 3CEQA 4UI9J 3D9JA 4GTRA 3ZFWA 4UWHA 5JHAA 1O5MA 3PE3A 4BTBA 3QK0A 2BF0X 5LCWJ 1N4QA 4ANXA 4GA1A 3AG4E 4ATGA 4A3VA 2VTBB 4L23A 1TNBA 1ZB1A 1Y8MA 3CK8A 2KCKA 4GMJA 5G55A 4HFGA 1K8KG 2V0PA 4YDYA 2BTDA 3PVLA 2NXPA 2WXGA 1LD7A 4Q94A 2XENA 4HBDA 2ZXWE 2DYSE 3LDZA 5EN5D 3ZEFA 1MZCA 1O1TA 3MZLB 4K5BA 2MHKA 4XKBA 3Q49B 4H7YA 1QBQA 1WDYA 4GTMA 1HF8A 2XEVA 3V2OA 3ULEG 4E6HA 3DPDA 1OWMA 3ZUVB 3FEYA 5G04C 5AN8A 2LO6A 3EHQA 3FUNA 4Y6CA 3GW4A 1DCQA 3SBSA 3SFYA 4J7WA 4MS6A 3W9GA 4NRHB 1MVHA 4EBAA 2WXIA 3JQ0A 1NFIE 3RRMB 3CSFA 2VGEA 2P9SG 2IO3C 4GCOA 2VYIA 1NA0A 2J49A 2VGYA 2V4LA 4AP2A 4XIFA 3J5QB 2L0TB 4DPRA 3Q7FA 1HS6A 1U3DA 4OAUC 3GZ2A 4A1SA 4U8YD 4J7IA 1TJFA 4A1GA 5AQ7A 4I1MA 5ENPD 2DYRE 3SW9A 2YNQA 4A55A 2LXMA 4ILIA 3TWQA 5HKPA 1V54E 2AW6A 3L13A 2KATA 3LVQE 4YNDA 2KCLA 4GZ5A 3CBMA 2PNNA 3MJWA 1HXIA 1S63A 2J09A 3AJIA 3NOGD 1MQSA 2ZGDA 4IN3B 3ESKA 3PREA 2WB2A 3PZ1A 4APFA 3J5PA 1N94A 4L9PA 3RAUA 2WXOA 1EPUA 2CFZA 1H3IA 3FTVA 5T0MA 5AJDA 4M7CA 2VGXB 3ASNE 4RVBA 5JIYA 4EHMA 5CRUA 5ENNA 3UX4A 4GA2A 4UI9C 4ME2A 5ENOD 4H7XA 4YPUA 1KT0A 5CHEE 2XHEA 4IJ8A 5KNGA 3KD7A 3FH7A 4HXIA 3RRUA 4WNGA 1E8YA 1EDUA 1JPLA 3UINC 2I1KA 4OVUA 2KC7A 2GRQB 2X3MA 3FTYA 3PUKA 3DRAA 3QOUA 3EU5A 2PL2A 2Q7FA 2P9KG 3QJZA 1O9SA 3TG5A 4PDXA 3UM0A 3M53A 3RO2A 4G1TA 4D10C 2O8JA 5BPPA 4LCTA 1MYOA 3RO3A 4I2WA 3UMVA 3Q4AB 4QEOA 3BG1B 3I4RB 3UIOC 2J4DA 2GROB 1S70B 5D0OD 3AU4A 5A23A 4WUYA 4LRZA 2Y3AA 4FADA 3V79K 2JABA 2LXLA 3PRZA 3EP0A 1BPOA 3Q73A 3F9YA 1QYMA 3LY7A 5B3SE 1DVPA 3S7DA 4G24A 1TYQG 1Y6IA 2RFAA 1D8DA 5EILA 4DJAA 4J8OA 4HLEA 5AENA 1S64A 3ZHEA 3LKUA 2PQRA 5TH7A 1DC2A 3LYAA 3ZU7B 2XRZA 5EG2A 4DI4A 1KZPA 1BI8B 3CQCB 3PUJA 4PUCA 4K03A 4APOA 3VUZA 4J83A 4GZCA 4IRUA 4J8EA 3LXUX 4LEUA 2OEVA 5DBKA 3MCXA 4AIFA 3CBOA 2ZU6B 3CK9A 4MI5A 3X2QE 3GZSA 2GRMA 3FP3A 3CR3A 4N3AA 2WVIA 5FWQA 4F7AA 4YPAA 2DBAA 1K3ZD 3D9HA 1N52A 2KZTB 4I2ZA 1AWCB 1Z3YA 4R7LA 4DX2A 3CVXA 3NB2A 4H12A 4BFRA 3KSQA 5EYPF 4UWKA 1WG0A 2EQXA 3NQPA 3EUVA 1BU9A 5ENQD 2F69A 3ULYA 5D0QD 1UG3A 4YVQC 2R05A 3LEWA 3I3NA 5G05J 2OVBA 1JCSA 4C0MA 1OCRE 2EIJE 4I1OB 4B89A 4FHKA 2A4ZA 5AQBA 4CT4A 3DXKG 3CVVA 1FT2A 2OOEA 1VDYA 3EHMA 4N5CA 5CCLA 4CGVA 2IF4A 4YDWA 2YQ8A 5D2MC 3FTSA 1N6AA 1U3CA 3PH0C 4CZ2D 4EPZA 4GYYA 5BXUA 3AU5A 3ZYMA 4GMLA 3IKOB 3UKRG 2Y1LE 1E7UA 1TN8A 3W9FA 4XKCA 4IYPA 1OWLA 3Q9UC 4JL0A 2R2LA 4BY6A 2UWJG 2DCPA 3GZ1A 3HDXA 4M3OA 5LFAA 4HQDA 3LY8A 4NQ0A 3E33A 2WQ6A 1IHBA 3CHSA 3R9AB 1MVXA 3KAEA 1XQHA 4GYOA 2OEWA 2JEKA 4HI8A 2XPIA 5C1DA 4K5AB 2R03A 4XEIG 1IQRA 4GTPA 4X8QA 4QQIA 2L6BA 5AQ9A 4HRLA 3FU6A 2RD0A 3DSXA 3I4GA 4I9CA 3M59A 5JINA 2DZNA 2BQZA 5CBNA 3CVWA 5LOZA 2DVWA 2WXQA 3G2VA 3TAXA 1MHQA 1H2TC 3D9KA 5T8IA 2HR2A 2L6JA 4I6EA 1KZOA 2X6JA 2OVFA 3CKBA 3TXMA 4UWGA 3DSWA 3JCKC 1OWPA 3U64A 2BUGA 3NBNB 2NSZA 5F6KC 3ZIMA 3TL5A 2A5UA 1NI1A 3C5RA 3PEUB 4JVSA 3QWVA 2XCCA 1FCHA 4LDGA 4AJWA 4RSYA 3TWVA 1LD8A 3P1UA 3FWVA 2OCCE 3BU8A 3MEKA 2CHXA 3APFA 4PS8A 5T4YA 3ZXPA 4GZDA 4JB8P 3C98A 1ZKKA 3ZN3A 4JXTA 2R5SA 4HB5A 3HXDA 5T3RA 4WNDA 5ARGA 4GPMA 2L9BA 1WM5A 1A17A 3GYZA 3TG4A 1HG2A 3QDNA 3B7UX 3PEVB 2LNIA 3SFZA 2QFCA 3VTYA 1MX6A 4JHRA 1JWGA 3UI2A 2J4BA 3ZVVA 1N0RA 3RAYA 4ILHB 3E30A 1ML9A 2AXZA 4FLBA 4FC8A 4EBAG 4A63B 3S7BA 4B0ZA 4HRMB 2R17C 3SQVA 4WNFA 4JC8A 1HU3A 3TWRA 4LNGA 3NAWA 2AXVA 3CVYA 3Q9NC 3UKUG 3P2BA 4PS7A 4JA7A 2CG2A 4DX7D 3FUMA 5BUZA 1HX8A 2V4HC 3CK7A 3O4ZA 3IXEA 2MRIA 4WWPA 3FUIA 2DZOA 2PQNA 4P29A 5KCMA 1OT8A 1TJCA 1X81A 3K5KA 5CMWA 2H6HA 3ESLA 3O48A 3IHXA 3L08A 4JA9A 1O1RA 3CSTA 1HO8A 1QNFA 3UM2A 1YA0A 4DUIA 3U3WA 1FVFA 4ANVA 3SNXA 3FUJA 3CVQA 5FQ8A 4HI9A 4ABNA 4TRQA 5KJLA 1YCSB 3Q75A 3OAWA 3PNLB 3Q15A 1H2VC 4UI9K 3HVEB 3IV0A 4XX5A 3JXIA 3F9ZA 5C2YA 3M5AA 2RFIA 4J6IA 3APCA 1Z6TA 4GTQA 2IOSA 4BUPA 1N4SA 3QARA 3OXFA 1UOHA 5AYWD 2BEDA 1N4PA 5M72A 2KZTA 4C0EA 1TN6A 3UXGA 4UUCA 5JJ7A 3G2SA 3TWWA 3JUEA 3ZPJA 2AWIA 3NZUA 3AG2E 2QPWA 3DBSA 3D9MA 1NP7A 2CFUA 4ACKA 4YDOA 2P9PG 3E32A 2GRRB 3UT4A 2EILE 4RLYA 3LY9A 5EX0A 1UJKA 3LS8A 3PDNA 1HE8A 3DWLG 1D9SA 4G2VA 5FQ6A 3FH8A 5JA4D 4CCAA 4L2LA 4L2YA 4UQXA 5ITZF 1GW6A 2E2EA 5EX3A 5JJ0A 4HNAD 2FO7A 2ZGGA 2XZDG 2WXRA 3EHRA 1OY3D 4BERA 4FLHA 3KMJA 1SQMA 4JLGA 4GPKA 4AY6A 1SA5A 4KVMA 3DSVA 4MKTA 3I5PA 3FUHA 3NOCD 2V8SE 3PZ3A 1ZBPA 4J8DA 1KT1A 3U4TA 1Z5SC 4RQIA 4J7FA 3LVRE 4C1QA 3PNTB 2KCVA 4W9RA 4GYWA 4B93B 3CHOA 3RJWA 3F9WA 3RQ4A 4HLLA 3DSUA 3N71A 1OCCE 3CGHA 1H0AA 3G2WA 4HOUA 3UT8A 1H6KA 4DRXE 3MKRA 3M58A 2H6IA 4WWOA 1TR4A 4HVBA 5ARFA 5DIZA 3S7FA 5BNWA 3ASHA 3V30A 3SF4A 3L9TA 3ZGQA 4G8KA 3QKYA 2R59A 2FI7A 2I1JA 3ULQA 4URKA 3T5VA 2P9IG 2Y4UA 4N5QA 3HXBA 3RK6A 1XNFA 2ETCA 2P9UG 1W3BA 3PZ2A 3CLJA 3G2TA 1ZU2A 2XPZA 4ACLA 2X6IA 4AM9A 1N4RA 1WAO1 3KEAA 5CMYA 5FJYA 4I6GA 3UUXA 5ANRA 3UM3A 1H6PA 3CVPA 4CRWA 3LCAA 4JDSA 5BV0A 1N11A 3LJ3A 4BESA 3SI5A 2QYUA 3RSEG 3FEXA 4GTSA 1RZ4A 2VGXA 3F6QA 4C48B 3L16A 4YVOA 1TNZA 3IBEA 3M54A 4F53A 5T0KA 5TTFA 4NURA 3FTXA 4U95D 4XZ4A 3ZKJA 2PM7A 3B7RL 3D9LA 3HIZA 4PH4B 1BLXB 2QC9A 1FT1A 1IYGA 4KVOA 3QAQA 4V3IA 1PC2A 3FPDA 3B7TA 1JUQA 5FTPA 3UQ3A 3RRNB 3Q7AA 4DK5A 3MO0A 5BT1A 3DSSA 2J8SD 4LUNU 3L17A 3FTWA 4CDNA 2LSUA 5A7DB 5EKQD 3EDTB 1PY1A 3TXNA 2FBNA 2HYZA 2NC9A 4ANUA 3EIJA 2QYJA 3PZ4A 2WXHA 3ZYLA 1WY6A 4YNPA 3MX3A 3L22A 4QEPA 1TNOA 3FH5A 5T5GA 4U04A 4FMUA 4GMRA 4KXKB 1V55E 4RG9A 4EZKA 1XGWA 2DIWA 2ZISA 4BX9A 4DX6D 3VLFA 3MGBA 4B8CB 5EIBE 3FU3A 2FULA 2CHWA 3TJPA 5KBAA 3D9IA 3RJVA 3M55A 4J8FA 4CDMA 2E0IA 4HOQA 2NYJA 4AV7A 3RU0A 5JMND 4UWLA 2WXMA 4UQZA 2F8XK 4GZ6A 4GTOA 4IULA 5FT9A 3DSTA 3UPVA 5E75A 1HH8A 2AXUA 4LNBA 2IGQA 4AXHA 3ZYQA 3ZW3A 3FFLA 4HORA 3MO2A 4QENA 4NVQA 3ONKA 3FTZA 3U66A 4BT9A 3VTXA 4RZ0A 1K1AA 4K5CA 3KEZA 3FU5A 4NACA 2XCBA 1NL4A 4N39A 4B8AA 3ABME 2Y69E 5BXOA 4KYOB 3V31A 5AQAA 1JWFA 4KZ0A 4N2SA 1MT6A 2BKKB 3BUAA 2PM6A 2I9CA 5CBOA 4I9EA 5CEAA 4UQYA 2I6HA 3IHVA 4XI0A 4BX8A 2YHCA 1K1BA 3BG0B 3SBTB 2H6FA 4ZHBA 3ABKE 5EYLA 3HG0D 4CGWA 3EHNA 5D66A 3D9OA 3SD5A 4JEHA 4LNUD 2LSVA 3CHQA 4HRNA 4WAFA 3C3RA 3MV3B 1DCEA 3L6AA 3CBPA 3ABLE 4CYMD 1UJJA 5KJMA 2JV0A 3OPEA 3C3QA 2MOWA 2IU1A 5LSZA 2XQ0A 1L5JA 4PS3A 3JXJA 1SZ9A 4B94A 3APDA 4YDEA 5F5EA 2OV8A 2QY7A 2AJAA 4N2QA 1QQEA 1IHGA 4I51A 1O1SA 4GZ3A 2CG3A 4F6RD 3SGHA 2X6KA 4FA6A 2RFMA 3ML8A 3R9MA 2XGMA 2LAIA 4OYSA 4WWNA 4AVXA 4JPSA 3T8KA 2XEHA 5KJNA 2V5QC 1E8ZA 3WXXA 1NZNA 4LERA 3CHRA 2VSNA 4DX5D 2P9NG 3IEGA 2Y4TA 3ZRHA 5A6CA 3URZA 2G46A 4U96D 3QB2A 1KPSB 2JLBA 3SO8A 3VLEA 1LTXA 1OXJA 3ZYKA 4K0RA 4JHKA 5CEDB 4AY5A 5HI7A 1UW4B 1FVHA 2HE0A 3R7QA 4YPEA 5AAOA 5KWDA 4EZJA 2WXLA 2FO1E 2YINA 3L82A 3E37A 2J08A 3IHYA 1E7VA 1MUFA 1DNPA 3U9WA 3B95A 4O6FA 2L0IA 4FU3A 3SZ7A 3TWTA 4QFVA 5ENSD 4BETA 3PE4A 3FHEA 3HNAA 3MKQB 2WMOA 2HO1A 4U07A 3SY2A 5BV1A 5F59A 3TWXA 1ELRA 2ETAA 3CIAA 5LSXA 4FHJA 2P58C 3HXCA 1OCZE 1TEZA 1B89A 2KM4A 1PEGA 3SWCA 1D8EA 3AS4A 3UT7A 3ZHEB 1IXVA 4N3BA 4GCNA 3B13A 3OXGA 2XS1A 4JEUA 2B0OE 5ENRD 2VSXE 2GRPB 3OXLA 1TNUA 5ENTD 4BEPA 4U0ZA 2IONA 5J90A 2WXJA 5AYFA 3MKQA 1A5EA 2W5ZA 1HZ4A 3AG3E 3KSLA 5EDSA 4L7TA 2YHEA 2VSOE 4TUMA 1EF1C 4MRUA 4U7EB 3E34A 1P5QA 2EINE 2F37A 1SW6A 2WXKA 4NIKA 3BEEA 1MJ0A 4C9BB 3FUEA 4HS2A 4O1PA 3WG7E 3TWSA 1ELWA 4AOFA 3ASOE 4TXQA 5HRYA 4J8SA 2PZIA 4GTTA 1IKND 1Z3XA 2J07A 3QWPA 4ZFHA 4BSZB 4F1SA 3ASDA 2WQHA 5CERB 2M63A 4AU7A 3AG1E 4Y6WA 1E96B 3HHMA 5EIDA 3UM1A 3D9NA 3HVEA 2WXNA 4GA0A 4U63A 4DX1A 1HFAA 2Y0BG 4G8LA 2KBXA 2IEJA 2BKGA 2V5FA 4HOSA 3CKCA 4O60A 1INZA 2MYOA 4KBQA 3MA5A 2F8YA 4F1PA 4F3VA 4U0UA 3K9IA 2I2OA 3CVLA 4MLPA 1N54A 1H6OA 3AS8A 3OOIA 4U8VD 3DXMG 4I1AA 4A3TA 2WXPA 3CHMA 2C0MA 3G2UA 4CT0A 4FULA 5AARA 4I17A 4CEMA 2WM9A 1BI7B 1N0QA 4BTAA 2GRLA 4Q69A 4E85A 4OVVA 3Q47B 3ISMC 5G2NA 5AJLA 3HXEA 2RG8A 5TEGA 1TNYA 5F6LA 2WPVA 4CDRA 2XS8A 1KLXA 4GB9A 3CQGB 2ZIRA 3JQ1A 3TWUA 3FY4A 4TUUA 2RKKA 1S0PA 4OAVB 5CRVA 4WNEA 4BSXA 4KMOA 3HYMB 5AIJA 2QZAA 1SA4A 4E47A 3C3OA 3VV0A 3SFXA 2WMNA 3DB5A 2IY0C 4LSZE 4ATZD 3UTMA 1PAQA 4TXPA 5FZSA 1SVXA 3PZDA 3RIBA 3QC1A 5FINA 5CCMA 4O1OA 2C2LA 3BO5A 2EIME 2ILRA 2IO2C 3ML9A 2X38A 3ASGA 1RW2A 4Z68A 5E76A 4JD2G 5JJTA 4BT8A 3AAAC 4XE0A 3CHPA 4XI9A 2W5YA 3PS6A 5LX8A 3CV0A 4FJZA 1OWOA 4I43A 1JCRA 5HS0A 2XGOA 3DEPA 4MI0A 3D9PA 5G04J 2XPYA 4DLOA 5FIOA 3OS5A 5ANLA 3B7BA 4FJYA 4BWRA 4LG6A 1TN7A 2CHZA 3HXFA 2B6CA 3KS2A 3R7RA 3LPZA 4UWFA 4N3CA 5FQ4A 3E4BA 3T9KA 3DALA 5B1BE 4KT6B 1U2VG 4U8HA 2XEEA 1OCOE 1G3NB 4G23A 1IQUA 2P2CP 3SHFA 2VTBA 1EYHA 1X5BA 4G11A 5B1AE 1NA3A 3DEOA 3D3MA 2GW1A 5FZRA 5LP0A 2DWZA 2J9QA 4I6JA 2X6FA 3ONLA 5FQ7A 4TXRA 4GAAA 5J08A 5H7PA 3MYVA 5KJKA 3ASFA 2IFUA 3EJNA 4KZCA 3MO5A 3Q79A 5CECB 1YMPA 3C72A 2GGFA 3V2XA 4JHJA 3RKVA 4J0UA 3CVUA 2XGSA 3FDHA 5JHBA 3FULA 1AP7A 2VJ8A 1E90A 3FUFA 3FTUA 2UY1B 3M56A 2LUHA 3FU0A 4NJ5A 1SZAA 2HM8A 2GRNB 2ONDA 3EIQC 3JYSA
chains in the Genus database with same CATH topology
1SQMA 4DI4A 4JLGA 4GPKA 4AY6A 4G25A 4KVMA 3CQCB 4MKTA 3VLEA 3PUJA 3QNKA 3ZYKA 3I5PA 3FUHA 5LCWC 4K0RA 4JHKA 3T5XA 2V8SE 4PUCA 1H19A 1ZBPA 4AY5A 2R3AA 4J8DA 1KT1A 5HI7A 4K03A 1UW4B 3U4TA 3M57A 1FVHA 4APOA 3R7QA 4EZLA 4YPEA 4J7FA 4JZYA 3VUZA 4J83A 4G26A 3LVRE 4C1QA 4GZCA 3PNTB 4IRUA 3NZSA 2KCVA 4J8EA 4GYWA 4W9RA 3LXUX 4LEUA 5DBKA 3MCXA 4AIFA 4EZJA 3CBOA 2ZU6B 3CHOA 3S2AA 1H2UA 3TGOA 2WXLA 3RJWA 3F9WA 3JUIA 3QWWA 3CK9A 3RQ4A 3N71A 2YINA 3CGHA 1H0AA 3G2WA 4HOUA 3S7JA 2J08A 1H6KA 3GZSA 1E7VA 3IHYA 3UT8A 1UN9A 1MUFA 2GRMA 3FP3A 5JHNA 1DNPA 3CR3A 4N3AA 3MKRA 2WVIA 3M58A 4WWOA 5FWQA 3U9WA 4F7AA 3F9XA 4YPAA 4O6FA 2FF4A 3MV2B 4ILGA 2DBAA 2L0IA 4FU3A 4RG6A 4EPZA 4HVBA 5ARFA 5DIZA 3S7FA 2IJGX 1LF8A 3ENEA 5BNWA 1N52A 2KZTB 1HG5A 3ASHA 3SZ7A 4ANWA 3SF4A 4QFVA 3VLDA 4EQFA 3ZGQA 4I2ZA 4DLQA 2XRYA 3PE4A 3QKYA 3FHEA 1Z3YA 4R7LA 4Z4PA 3CVXA 2R59A 3HNAA 4H12A 3MKQB 4BFRA 2WMOA 3OTNA 4UWKA 2EQXA 3L54A 2HO1A 5BW8C 3NQPA 2FI7A 4U07A 1OWNA 4YNMA 5BV1A 5F59A 2I1JA 3ULQA 1ELRA 4URKA 2F69A 5D0QD 3T5VA 1UG3A 4FP7A 4YVQC 2VSYA 3CIAA 3LEWA 5LSXA 4FHJA 4JW1A 4TV3A 5JJ6A 3I3NA 2P58C 2Y4UA 5G05J 2OVBA 4C0MA 2WXFA 4AEZC 2WQ7A 4I1OB 3RK6A 4B89A 4FHKA 1XNFA 1TEZA 1B89A 2A4ZA 3S8PA 4CT4A 3CVNA 3CVVA 1W3BA 1E8XA 3KMTA 1N3JA 3CLJA 2OOEA 1VDYA 2KM4A 3G2TA 3EHMA 4N5CA 1ZU2A 1OUVA 2XPZA 1PEGA 5CCLA 3SWCA 4ACLA 3AS4A 4CGVA 2IF4A 3Q5MA 3KMAA 3UT7A 2X6IA 3FUKA 3ZHEB 2YQ8A 4AM9A 3FTSA 1WAO1 4N3BA 1N6AA 4GCNA 1U3CA 3PH0C 3B13A 4GYYA 3OXGA 5CMYA 3AU5A 4U0SA 5FJYA 4I6GA 2IQCA 4GMLA 4JEUA 3UUXA 3ZXSA 5ANRA 3IKOB 2UY1A 2VSXE 1E7UA 2X6HA 4XKCA 3CVPA 4CRWA 4IYPA 3OXLA 1OWLA 3LCAA 4JL0A 5G05C 4JDSA 5BV0A 3B7SA 4U0ZA 1UN8A 2IONA 3LJ3A 4L1BA 1QZ2A 4BY6A 5J90A 2UWJG 1N6CA 2WXJA 2DCPA 3SI5A 5AYFA 3GZ1A 3MKQA 2W5ZA 1HZ4A 3FEXA 5EDSA 3HDXA 2C0LA 2IOLA 2VGXA 4L7TA 2YHEA 3FUDA 3AS5A 4M3OA 4GU5A 3T8MA 5LFAA 4IJDA 1E8WA 3LY8A 4NQ0A 4Q96A 5CPRB 2WQ6A 3L16A 2VSOE 4HOTA 4YVOA 3NF1A 1EF1C 2FEZA 2VQ2A 4MRUA 3IBEA 1ELKA 2LAHA 1P5QA 3CHSA 5FZQA 4F53A 3M54A 4O30A 3R9AB 5HQ8A 1MVXA 4NURA 2AVPA 5T0KA 5TTFA 4DI3A 3FTXA 3KAEA 1XQHA 4GYOA 2JEKA 4XZ4A 2XPIA 3CEQA 4UI9J 4EECA 2PM7A 5C1DA 3B7RL 2WXKA 1IQRA 3BEEA 3D9LA 3D9JA 4C9BB 3FUEA 4HS2A 3HIZA 1ELWA 3FU6A 4PH4B 3ZFWA 4AOFA 2RD0A 3I4GA 4I9CA 4J8SA 3M59A 4UWHA 2PZIA 5JHAA 5JINA 3PE3A 2BQZA 4BTBA 3QK0A 2BF0X 5LCWJ 3CVWA 5LOZA 1IYGA 4ANXA 4KVOA 4GA1A 1Z3XA 2WXQA 2J07A 3QWPA 3QAQA 3G2VA 4ATGA 4F1SA 3ASDA 3TAXA 1MHQA 2WQHA 4V3IA 2M63A 1PC2A 4L23A 4A3VA 2VTBB 3B7TA 1JUQA 3FPDA 5FTPA 1Y8MA 4Y6WA 1E96B 3CK8A 2KCKA 3UQ3A 4GMJA 5G55A 1H2TC 3HHMA 4HFGA 3D9KA 2V0PA 5T8IA 3RRNB 2HR2A 2L6JA 4I6EA 3D9NA 4DK5A 3MO0A 2BTDA 5BT1A 3HVEA 3PVLA 2NXPA 2WXGA 2WXNA 4LUNU 2X6JA 2OVFA 3L17A 3FTWA 4Q94A 4CDNA 4GA0A 3CKBA 4U63A 1HFAA 3TXMA 4UWGA 2LSUA 2XRZA 5A7DB 3LDZA 3JCKC 1OWPA 5EKQD 3ZEFA 3U64A 2BUGA 2NSZA 2V5FA 3EDTB 5F6KC 4HOSA 1PY1A 3CKCA 3MZLB 1INZA 3ZIMA 4KBQA 3MA5A 4F3VA 3TXNA 4U0UA 3TL5A 2MHKA 3K9IA 2A5UA 2FBNA 4XKBA 2I2OA 3Q49B 4H7YA 2HYZA 2NC9A 3CVLA 3PEUB 1HF8A 2XEVA 4ANUA 3EIJA 4MLPA 1N54A 4JVSA 3AS8A 4E6HA 3OOIA 3QWVA 2XCCA 3DPDA 1OWMA 1FCHA 4I1AA 2WXHA 4LDGA 4A3TA 3FEYA 5G04C 2WXPA 3CHMA 2C0MA 1WY6A 3G2UA 4RSYA 4FULA 3ZYLA 4AJWA 4CT0A 4YNPA 3MX3A 3P1UA 3FWVA 4I17A 4CEMA 3L22A 2WM9A 2LO6A 4QEPA 4BTAA 3FUNA 3FH5A 4Y6CA 2GRLA 3MEKA 4U04A 2CHXA 4Q69A 4FMUA 5T5GA 3APFA 3GW4A 4PS8A 3SBSA 4OVVA 3Q47B 4E85A 5T4YA 4KXKB 4GZDA 5G2NA 3C98A 4MS6A 5AJLA 4NRHB 1MVHA 1ZKKA 4RG9A 4EBAA 4EZKA 5EG2A 3ZN3A 1XGWA 2DIWA 2WXIA 3JQ0A 4JXTA 3RRMB 3CSFA 4BX9A 2R5SA 2RG8A 3VLFA 5TEGA 5F6LA 2WPVA 4GCOA 2VYIA 4CDRA 5T3RA 3MGBA 4WNDA 1NA0A 2J49A 2VGYA 1KLXA 4B8CB 5ARGA 2L9BA 2V4LA 1WM5A 4XIFA 1A17A 3GYZA 3TG4A 3FU3A 4AP2A 1HG2A 4GB9A 2FULA 2L0TB 2CHWA 3B7UX 3PEVB 3QDNA 3TJPA 4DPRA 1HS6A 3D9IA 2LNIA 3CQGB 3RJVA 3M55A 4J8FA 4CDMA 1U3DA 3JQ1A 2E0IA 3GZ2A 3FY4A 4HOQA 4A1SA 4TUUA 3SFZA 4J7IA 2QFCA 3VTYA 1S0PA 1TJFA 4JHRA 1JWGA 3RU0A 4A1GA 4AV7A 4I1MA 4WNEA 4BSXA 4UWLA 3SW9A 2J4BA 2YNQA 4A55A 4KMOA 3HYMB 3ZVVA 2WXMA 4ILIA 4UQZA 5AIJA 4E47A 4GZ6A 3RAYA 3VV0A 4ILHB 4IULA 2AW6A 5FT9A 2WMNA 3L13A 2KATA 3LVQE 4YNDA 3UPVA 1ML9A 3DB5A 2KCLA 2AXZA 4FLBA 4GZ5A 4FC8A 4EBAG 3CBMA 1PAQA 5E75A 1HH8A 2AXUA 3S7BA 3MJWA 4B0ZA 5FZSA 2IGQA 4AXHA 1HXIA 2R17C 3ZYQA 4WNFA 3ZW3A 4MI5A 4JC8A 1HU3A 2J09A 3PZDA 3FFLA 4HORA 3RIBA 1MQSA 3MO2A 2AXVA 4QENA 3CVYA 4NVQA 3ONKA 3FTZA 3QC1A 3U66A 4IN3B 4BT9A 3P2BA 4PS7A 3VTXA 4RZ0A 5CCMA 3ESKA 4JA7A 3PREA 2WB2A 2CG2A 2C2LA 4APFA 3FUMA 3KEZA 3BO5A 3FU5A 5BUZA 1HX8A 4NACA 2XCBA 2ILRA 3CK7A 2WXOA 3O4ZA 4N39A 3ML9A 4B8AA 1EPUA 2CFZA 2X38A 1H3IA 3FTVA 2MRIA 3ASGA 3FUIA 4WWPA 4KYOB 5E76A 5AJDA 5T0MA 2PQNA 4P29A 2VGXB 5KCMA 1TJCA 1JWFA 4RVBA 5JIYA 3K5KA 5CMWA 4KZ0A 3ESLA 5JJTA 4N2SA 1MT6A 3O48A 3ZYMA 4BT8A 2PM6A 4XE0A 3CHPA 4XI9A 3IHXA 3L08A 2I9CA 4JA9A 4I9EA 5ENNA 3CSTA 3UX4A 1HO8A 4GA2A 2W5YA 1QNFA 4UQYA 2I6HA 3PS6A 4UI9C 5LX8A 3CV0A 1YA0A 3IHVA 3U3WA 4XI0A 4FJZA 4BX8A 1OWOA 4ME2A 4I43A 4H7XA 4YPUA 1KT0A 2YHCA 1FVFA 5CHEE 4ANVA 3BG0B 3SNXA 3SBTB 3FUJA 2XGOA 2XHEA 3CVQA 4IJ8A 5FQ8A 4ABNA 4TRQA 5KJLA 3KD7A 3OAWA 3PNLB 3Q15A 1H2VC 4UI9K 3HVEB 4MI0A 3FH7A 3D9PA 5G04J 4CGWA 3IV0A 3EHNA 2XPYA 3D9OA 4HXIA 3RRUA 3SD5A 4JEHA 4XX5A 4DLOA 3OS5A 3F9ZA 5ANLA 2LSVA 5C2YA 3CHQA 2RFIA 3M5AA 4FJYA 4WNGA 4BWRA 4J6IA 3APCA 1E8YA 4WAFA 2CHZA 1EDUA 1JPLA 1Z6TA 3KS2A 2IOSA 3MV3B 3R7RA 3LPZA 4UWFA 4N3CA 3L6AA 3CBPA 5FQ4A 4BUPA 3E4BA 3DALA 2I1KA 4KT6B 4OVUA 2KC7A 4U8HA 1UJJA 5KJMA 2X3MA 3FTYA 3PUKA 3QOUA 4G23A 1IQUA 2JV0A 3QARA 2PL2A 3OXFA 3SHFA 2VTBA 1EYHA 3OPEA 1X5BA 4G11A 2Q7FA 2MOWA 3QJZA 5AYWD 1O9SA 3TG5A 4PDXA 5M72A 2IU1A 3M53A 3RO2A 2KZTA 1NA3A 4G1TA 4D10C 2O8JA 5LSZA 2XQ0A 5BPPA 4LCTA 3D3MA 4C0EA 3RO3A 2GW1A 5FZRA 5JJ7A 3G2SA 1L5JA 5LP0A 4PS3A 4I2WA 2J9QA 4I6JA 2X6FA 3UMVA 1SZ9A 3Q4AB 3ONLA 5FQ7A 3ZPJA 2AWIA 4B94A 4QEOA 3BG1B 3I4RB 3NZUA 4GAAA 3APDA 2J4DA 3MYVA 5J08A 3ASFA 3DBSA 5KJKA 2QPWA 3D9MA 2IFUA 1NP7A 2CFUA 3EJNA 4KZCA 4ACKA 5D0OD 3AU4A 2OV8A 2QY7A 5F5EA 4N2QA 1QQEA 1IHGA 4I51A 3MO5A 5A23A 4GZ3A 4WUYA 3UT4A 4LRZA 2Y3AA 2CG3A 4FADA 2GGFA 3LY9A 5EX0A 1UJKA 3SGHA 4JHJA 3PRZA 3EP0A 3RKVA 2X6KA 3LS8A 3PDNA 1BPOA 4J0UA 4FA6A 3F9YA 1HE8A 3LY7A 1DVPA 4G2VA 3ML8A 5FQ6A 2XGMA 3FH8A 2LAIA 3CVUA 4OYSA 3S7DA 4WWNA 4AVXA 4G24A 4JPSA 4CCAA 4L2LA 4L2YA 1Y6IA 2XGSA 4UQXA 3FDHA 1GW6A 2E2EA 5JHBA 5EX3A 3FULA 2VJ8A 3WXXA 1E8ZA 5KJNA 1E90A 3FUFA 4DJAA 4J8OA 3FTUA 1NZNA 4LERA 3CHRA 2VSNA 4HLEA 5AENA 2UY1B 5JJ0A 3M56A 2FO7A 4AU7A 2WXRA 3IEGA 3FU0A 2Y4TA 4NJ5A 3ZHEA 3LKUA 1SZAA 2PQRA 3ZRHA 5TH7A 5A6CA 2HM8A 3LYAA 4FLHA 3URZA 2G46A 3KMJA 2ONDA 3QB2A 2JLBA 3EIQC 3JYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JLG A;  4GPK A;  4AY6 A;  4G25 A;  5LCW C;  1ZBP A;  4AY5 A;  2R3A A;  4J8D A;  1KT1 A;  5HI7 A;  3U4T A;  3M57 A;  4APO A;  4YPE A;  4J7F A;  3VUZ A;  4J83 A;  4G26 A;  4C1Q A;  2KCV A;  4J8E A;  4GYW A;  4W9R A;  4LEU A;  5DBK A;  4AIF A;  3CBO A;  3TGO A;  3RJW A;  3F9W A;  3QWW A;  3CK9 A;  3RQ4 A;  3N71 A;  4HOU A;  4MI5 A;  3S7J A;  1MUF A;  3FP3 A;  5JHN A;  4N3A A;  3MKR A;  3M58 A;  3F9X A;  4YPA A;  4O6F A;  2FF4 A;  3MV2 B;  4RG6 A;  2DBA A;  5ARF A;  5DIZ A;  3S7F A;  5BNW A;  3ASH A;  3SZ7 A;  3SF4 A;  4EQF A;  3ZGQ A;  4I2Z A;  3PE4 A;  3QKY A;  4Z4P A;  3HNA A;  4H12 A;  2HO1 A;  5BW8 C;  2FI7 A;  4U07 A;  4YNM A;  5F59 A;  3ULQ A;  1ELR A;  2F69 A;  5D0Q D;  4YVQ C;  2VSY A;  5LSX A;  5JJ6 A;  2P58 C;  2Y4U A;  5G05 J;  1XNF A;  1B89 A;  3S8P A;  3CVN A;  1W3B A;  3KMT A;  1N3J A;  2OOE A;  1PEG A;  3SWC A;  4N5C A;  1ZU2 A;  1OUV A;  5CCL A;  3AS4 A;  4CGV A;  2IF4 A;  3Q5M A;  3KMA A;  3ZHE B;  2YQ8 A;  4AM9 A;  1WAO 1;  4N3B A;  1N6A A;  4GCN A;  4GYY A;  3OXG A;  4U0S A;  5FJY A;  3UUX A;  2UY1 A;  3CVP A;  3OXL A;  3LCA A;  4JL0 A;  5G05 C;  4JDS A;  4U0Z A;  1QZ2 A;  2UWJ G;  1N6C A;  5AYF A;  3GZ1 A;  2W5Z A;  1HZ4 A;  2C0L A;  2VGX A;  4IJD A;  3AS5 A;  3LY8 A;  4NQ0 A;  5CPR B;  4HOT A;  4YVO A;  3NF1 A;  2FEZ A;  2VQ2 A;  1P5Q A;  5FZQ A;  3M54 A;  4O30 A;  3R9A B;  5HQ8 A;  1MVX A;  5T0K A;  2AVP A;  5TTF A;  3KAE A;  1XQH A;  4GYO A;  2XPI A;  3CEQ A;  4UI9 J;  5C1D A;  3BEE A;  1ELW A;  3ZFW A;  4I9C A;  3M59 A;  2PZI A;  5JIN A;  3PE3 A;  2BQZ A;  4BTB A;  5LCW J;  1IYG A;  4GA1 A;  3QWP A;  3ASD A;  3TAX A;  2WQH A;  1PC2 A;  3FPD A;  4AU7 A;  5FTP A;  1Y8M A;  4Y6W A;  1E96 B;  3CK8 A;  2KCK A;  3UQ3 A;  2HR2 A;  2L6J A;  3MO0 A;  5BT1 A;  4GA0 A;  3CKB A;  2LSU A;  5A7D B;  5EKQ D;  2BUG A;  2V5F A;  3EDT B;  5F6K C;  4HOS A;  3CKC A;  4KBQ A;  3MA5 A;  4F3V A;  4U0U A;  2MHK A;  3K9I A;  2FBN A;  3Q49 B;  4H7Y A;  2HYZ A;  2NC9 A;  3CVL A;  2XEV A;  3AS8 A;  3OOI A;  3QWV A;  2XCC A;  1FCH A;  4I1A A;  4LDG A;  5G04 C;  2C0M A;  4YNP A;  3FWV A;  4I17 A;  4QEP A;  4BTA A;  4Y6C A;  5T5G A;  3MEK A;  4U04 A;  4FMU A;  3GW4 A;  3Q47 B;  4KXK B;  4NRH B;  1MVH A;  1ZKK A;  4RG9 A;  5EG2 A;  3ZN3 A;  2R5S A;  5TEG A;  5F6L A;  2WPV A;  4GCO A;  2VYI A;  4CDR A;  4WND A;  1NA0 A;  2VGY A;  1KLX A;  5ARG A;  1WM5 A;  4XIF A;  1A17 A;  3GYZ A;  3TG4 A;  3QDN A;  2LNI A;  3RJV A;  3M55 A;  4J8F A;  3GZ2 A;  4HOQ A;  4A1S A;  4J7I A;  2QFC A;  3VTY A;  4JHR A;  3RU0 A;  4WNE A;  3SW9 A;  3HYM B;  4UQZ A;  4E47 A;  4GZ6 A;  3RAY A;  3VV0 A;  5FT9 A;  4YND A;  2KAT A;  1ML9 A;  3UPV A;  3DB5 A;  2KCL A;  4GZ5 A;  3CBM A;  1HH8 A;  3S7B A;  5FZS A;  2IGQ A;  1HXI A;  4WNF A;  3FFL A;  4HOR A;  3RIB A;  3MO2 A;  4QEN A;  4NVQ A;  4IN3 B;  4BT9 A;  3VTX A;  4RZ0 A;  5CCM A;  3ESK A;  4JA7 A;  2C2L A;  3BO5 A;  2XCB A;  3CK7 A;  4N39 A;  1H3I A;  3ASG A;  4KYO B;  5T0M A;  2PQN A;  2VGX B;  1TJC A;  5JIY A;  3K5K A;  4N2S A;  5JJT A;  1MT6 A;  3O48 A;  4BT8 A;  4XI9 A;  3IHX A;  4JA9 A;  4I9E A;  4GA2 A;  2W5Y A;  4UQY A;  2I6H A;  4UI9 C;  3CV0 A;  1YA0 A;  3U3W A;  4XI0 A;  4ME2 A;  4H7X A;  4YPU A;  1KT0 A;  2YHC A;  5CHE E;  2XGO A;  3CVQ A;  4IJ8 A;  4ABN A;  5KJL A;  3KD7 A;  4MI0 A;  3Q15 A;  4UI9 K;  5G04 J;  4CGW A;  3OS5 A;  3F9Z A;  2LSV A;  3M5A A;  2RFI A;  4WNG A;  4BWR A;  3MV3 B;  3KS2 A;  3LPZ A;  4N3C A;  3CBP A;  4BUP A;  3E4B A;  3DAL A;  2KC7 A;  5KJM A;  3QOU A;  4G23 A;  2JV0 A;  3OPE A;  2PL2 A;  3OXF A;  2Q7F A;  5AYW D;  1O9S A;  3TG5 A;  5M72 A;  3M53 A;  3RO2 A;  1NA3 A;  4G1T A;  5LSZ A;  2O8J A;  3RO3 A;  2GW1 A;  5FZR A;  5JJ7 A;  4I2W A;  2J9Q A;  3Q4A B;  4B94 A;  3ZPJ A;  4QEO A;  5KJK A;  3ASF A;  2QPW A;  2IFU A;  5D0O D;  5F5E A;  4N2Q A;  1QQE A;  1IHG A;  4I51 A;  3MO5 A;  4GZ3 A;  4WUY A;  3LY9 A;  5EX0 A;  3EP0 A;  3RKV A;  3PDN A;  4J0U A;  3F9Y A;  3LY7 A;  4G2V A;  2XGM A;  3S7D A;  4G24 A;  2XGS A;  4UQX A;  2E2E A;  5EX3 A;  5KJN A;  3WXX A;  4J8O A;  1NZN A;  2VSN A;  5JJ0 A;  2UY1 B;  3M56 A;  2FO7 A;  3IEG A;  2Y4T A;  4NJ5 A;  3ZHE A;  3LKU A;  2PQR A;  5TH7 A;  5A6C A;  3LYA A;  3URZ A;  2G46 A;  3KMJ A;  2OND A;  2JLB A;  3JYS A; 
#chains in the Genus database with same CATH topology
 2P9L G;  4G25 A;  3QNK A;  5LCW C;  3T5X A;  1FPP A;  1H19 A;  2R3A A;  3M57 A;  5KNH D;  4EZL A;  4JZY A;  4G26 A;  3NZS A;  4GTV A;  3S2A A;  3TGO A;  1H2U A;  3JUI A;  3QWW A;  2ETB A;  3S7J A;  1UN9 A;  5JHN A;  3F9X A;  1MX2 A;  2FF4 A;  3MV2 B;  4ILG A;  4RG6 A;  2IJG X;  1LF8 A;  3ENE A;  1HG5 A;  1Q2Z A;  4ANW A;  1YYH A;  1JCQ A;  3VLD A;  4J8Y A;  4EQF A;  2A5E A;  2EIK E;  2H6G A;  4DLQ A;  2XRY A;  4Z4P A;  3HRA A;  3OTN A;  3L54 A;  1MX4 A;  5BW8 C;  4YNM A;  1OWN A;  2XZT G;  2F0Y A;  4FP7 A;  2VSY A;  4JW1 A;  4TV3 A;  5JJ6 A;  3DPY A;  2WXF A;  4AEZ C;  2WQ7 A;  3UIP C;  3S8P A;  3Q78 A;  1N95 A;  3CVN A;  3BQO A;  1E8X A;  3KMT A;  1N3J A;  1OUV A;  3KMA A;  3Q5M A;  2R02 A;  3FUK A;  3LJN A;  4MBG A;  4U0S A;  3ZXS A;  2IQC A;  2UY1 A;  2X6H A;  1BD8 A;  5G05 C;  3B7S A;  1UN8 A;  4L1B A;  1QZ2 A;  3EU9 A;  1N6C A;  2KXP C;  3ZNG A;  2C0L A;  2IOL A;  4IJD A;  3FUD A;  3AS5 A;  3T8M A;  4GU5 A;  1E8W A;  4Q96 A;  5CPR B;  4HOT A;  3NF1 A;  2FEZ A;  2VQ2 A;  1N9A A;  1ELK A;  2LAH A;  5FZQ A;  4O30 A;  5HQ8 A;  5IY5 E;  2AVP A;  4DI3 A;  4EEC A;  3CEQ A;  4UI9 J;  3D9J A;  4GTR A;  3ZFW A;  4UWH A;  5JHA A;  1O5M A;  3PE3 A;  4BTB A;  3QK0 A;  2BF0 X;  5LCW J;  1N4Q A;  4ANX A;  4GA1 A;  3AG4 E;  4ATG A;  4A3V A;  2VTB B;  4L23 A;  1TNB A;  1ZB1 A;  1Y8M A;  3CK8 A;  2KCK A;  4GMJ A;  5G55 A;  4HFG A;  1K8K G;  2V0P A;  4YDY A;  2BTD A;  3PVL A;  2NXP A;  2WXG A;  1LD7 A;  4Q94 A;  2XEN A;  4HBD A;  2ZXW E;  2DYS E;  3LDZ A;  5EN5 D;  3ZEF A;  1MZC A;  1O1T A;  3MZL B;  4K5B A;  2MHK A;  4XKB A;  3Q49 B;  4H7Y A;  1QBQ A;  1WDY A;  4GTM A;  1HF8 A;  2XEV A;  3V2O A;  3ULE G;  4E6H A;  3DPD A;  1OWM A;  3ZUV B;  3FEY A;  5G04 C;  5AN8 A;  2LO6 A;  3EHQ A;  3FUN A;  4Y6C A;  3GW4 A;  1DCQ A;  3SBS A;  3SFY A;  4J7W A;  4MS6 A;  3W9G A;  4NRH B;  1MVH A;  4EBA A;  2WXI A;  3JQ0 A;  1NFI E;  3RRM B;  3CSF A;  2VGE A;  2P9S G;  2IO3 C;  4GCO A;  2VYI A;  1NA0 A;  2J49 A;  2VGY A;  2V4L A;  4AP2 A;  4XIF A;  3J5Q B;  2L0T B;  4DPR A;  3Q7F A;  1HS6 A;  1U3D A;  4OAU C;  3GZ2 A;  4A1S A;  4U8Y D;  4J7I A;  1TJF A;  4A1G A;  5AQ7 A;  4I1M A;  5ENP D;  2DYR E;  3SW9 A;  2YNQ A;  4A55 A;  2LXM A;  4ILI A;  3TWQ A;  5HKP A;  1V54 E;  2AW6 A;  3L13 A;  2KAT A;  3LVQ E;  4YND A;  2KCL A;  4GZ5 A;  3CBM A;  2PNN A;  3MJW A;  1HXI A;  1S63 A;  2J09 A;  3AJI A;  3NOG D;  1MQS A;  2ZGD A;  4IN3 B;  3ESK A;  3PRE A;  2WB2 A;  3PZ1 A;  4APF A;  3J5P A;  1N94 A;  4L9P A;  3RAU A;  2WXO A;  1EPU A;  2CFZ A;  1H3I A;  3FTV A;  5T0M A;  5AJD A;  4M7C A;  2VGX B;  3ASN E;  4RVB A;  5JIY A;  4EHM A;  5CRU A;  5ENN A;  3UX4 A;  4GA2 A;  4UI9 C;  4ME2 A;  5ENO D;  4H7X A;  4YPU A;  1KT0 A;  5CHE E;  2XHE A;  4IJ8 A;  5KNG A;  3KD7 A;  3FH7 A;  4HXI A;  3RRU A;  4WNG A;  1E8Y A;  1EDU A;  1JPL A;  3UIN C;  2I1K A;  4OVU A;  2KC7 A;  2GRQ B;  2X3M A;  3FTY A;  3PUK A;  3DRA A;  3QOU A;  3EU5 A;  2PL2 A;  2Q7F A;  2P9K G;  3QJZ A;  1O9S A;  3TG5 A;  4PDX A;  3UM0 A;  3M53 A;  3RO2 A;  4G1T A;  4D10 C;  2O8J A;  5BPP A;  4LCT A;  1MYO A;  3RO3 A;  4I2W A;  3UMV A;  3Q4A B;  4QEO A;  3BG1 B;  3I4R B;  3UIO C;  2J4D A;  2GRO B;  1S70 B;  5D0O D;  3AU4 A;  5A23 A;  4WUY A;  4LRZ A;  2Y3A A;  4FAD A;  3V79 K;  2JAB A;  2LXL A;  3PRZ A;  3EP0 A;  1BPO A;  3Q73 A;  3F9Y A;  1QYM A;  3LY7 A;  5B3S E;  1DVP A;  3S7D A;  4G24 A;  1TYQ G;  1Y6I A;  2RFA A;  1D8D A;  5EIL A;  4DJA A;  4J8O A;  4HLE A;  5AEN A;  1S64 A;  3ZHE A;  3LKU A;  2PQR A;  5TH7 A;  1DC2 A;  3LYA A;  3ZU7 B;  2XRZ A;  5EG2 A;  4DI4 A;  1KZP A;  1BI8 B;  3CQC B;  3PUJ A;  4PUC A;  4K03 A;  4APO A;  3VUZ A;  4J83 A;  4GZC A;  4IRU A;  4J8E A;  3LXU X;  4LEU A;  2OEV A;  5DBK A;  3MCX A;  4AIF A;  3CBO A;  2ZU6 B;  3CK9 A;  4MI5 A;  3X2Q E;  3GZS A;  2GRM A;  3FP3 A;  3CR3 A;  4N3A A;  2WVI A;  5FWQ A;  4F7A A;  4YPA A;  2DBA A;  1K3Z D;  3D9H A;  1N52 A;  2KZT B;  4I2Z A;  1AWC B;  1Z3Y A;  4R7L A;  4DX2 A;  3CVX A;  3NB2 A;  4H12 A;  4BFR A;  3KSQ A;  5EYP F;  4UWK A;  1WG0 A;  2EQX A;  3NQP A;  3EUV A;  1BU9 A;  5ENQ D;  2F69 A;  3ULY A;  5D0Q D;  1UG3 A;  4YVQ C;  2R05 A;  3LEW A;  3I3N A;  5G05 J;  2OVB A;  1JCS A;  4C0M A;  1OCR E;  2EIJ E;  4I1O B;  4B89 A;  4FHK A;  2A4Z A;  5AQB A;  4CT4 A;  3DXK G;  3CVV A;  1FT2 A;  2OOE A;  1VDY A;  3EHM A;  4N5C A;  5CCL A;  4CGV A;  2IF4 A;  4YDW A;  2YQ8 A;  5D2M C;  3FTS A;  1N6A A;  1U3C A;  3PH0 C;  4CZ2 D;  4EPZ A;  4GYY A;  5BXU A;  3AU5 A;  3ZYM A;  4GML A;  3IKO B;  3UKR G;  2Y1L E;  1E7U A;  1TN8 A;  3W9F A;  4XKC A;  4IYP A;  1OWL A;  3Q9U C;  4JL0 A;  2R2L A;  4BY6 A;  2UWJ G;  2DCP A;  3GZ1 A;  3HDX A;  4M3O A;  5LFA A;  4HQD A;  3LY8 A;  4NQ0 A;  3E33 A;  2WQ6 A;  1IHB A;  3CHS A;  3R9A B;  1MVX A;  3KAE A;  1XQH A;  4GYO A;  2OEW A;  2JEK A;  4HI8 A;  2XPI A;  5C1D A;  4K5A B;  2R03 A;  4XEI G;  1IQR A;  4GTP A;  4X8Q A;  4QQI A;  2L6B A;  5AQ9 A;  4HRL A;  3FU6 A;  2RD0 A;  3DSX A;  3I4G A;  4I9C A;  3M59 A;  5JIN A;  2DZN A;  2BQZ A;  5CBN A;  3CVW A;  5LOZ A;  2DVW A;  2WXQ A;  3G2V A;  3TAX A;  1MHQ A;  1H2T C;  3D9K A;  5T8I A;  2HR2 A;  2L6J A;  4I6E A;  1KZO A;  2X6J A;  2OVF A;  3CKB A;  3TXM A;  4UWG A;  3DSW A;  3JCK C;  1OWP A;  3U64 A;  2BUG A;  3NBN B;  2NSZ A;  5F6K C;  3ZIM A;  3TL5 A;  2A5U A;  1NI1 A;  3C5R A;  3PEU B;  4JVS A;  3QWV A;  2XCC A;  1FCH A;  4LDG A;  4AJW A;  4RSY A;  3TWV A;  1LD8 A;  3P1U A;  3FWV A;  2OCC E;  3BU8 A;  3MEK A;  2CHX A;  3APF A;  4PS8 A;  5T4Y A;  3ZXP A;  4GZD A;  4JB8 P;  3C98 A;  1ZKK A;  3ZN3 A;  4JXT A;  2R5S A;  4HB5 A;  3HXD A;  5T3R A;  4WND A;  5ARG A;  4GPM A;  2L9B A;  1WM5 A;  1A17 A;  3GYZ A;  3TG4 A;  1HG2 A;  3QDN A;  3B7U X;  3PEV B;  2LNI A;  3SFZ A;  2QFC A;  3VTY A;  1MX6 A;  4JHR A;  1JWG A;  3UI2 A;  2J4B A;  3ZVV A;  1N0R A;  3RAY A;  4ILH B;  3E30 A;  1ML9 A;  2AXZ A;  4FLB A;  4FC8 A;  4EBA G;  4A63 B;  3S7B A;  4B0Z A;  4HRM B;  2R17 C;  3SQV A;  4WNF A;  4JC8 A;  1HU3 A;  3TWR A;  4LNG A;  3NAW A;  2AXV A;  3CVY A;  3Q9N C;  3UKU G;  3P2B A;  4PS7 A;  4JA7 A;  2CG2 A;  4DX7 D;  3FUM A;  5BUZ A;  1HX8 A;  2V4H C;  3CK7 A;  3O4Z A;  3IXE A;  2MRI A;  4WWP A;  3FUI A;  2DZO A;  2PQN A;  4P29 A;  5KCM A;  1OT8 A;  1TJC A;  1X81 A;  3K5K A;  5CMW A;  2H6H A;  3ESL A;  3O48 A;  3IHX A;  3L08 A;  4JA9 A;  1O1R A;  3CST A;  1HO8 A;  1QNF A;  3UM2 A;  1YA0 A;  4DUI A;  3U3W A;  1FVF A;  4ANV A;  3SNX A;  3FUJ A;  3CVQ A;  5FQ8 A;  4HI9 A;  4ABN A;  4TRQ A;  5KJL A;  1YCS B;  3Q75 A;  3OAW A;  3PNL B;  3Q15 A;  1H2V C;  4UI9 K;  3HVE B;  3IV0 A;  4XX5 A;  3JXI A;  3F9Z A;  5C2Y A;  3M5A A;  2RFI A;  4J6I A;  3APC A;  1Z6T A;  4GTQ A;  2IOS A;  4BUP A;  1N4S A;  3QAR A;  3OXF A;  1UOH A;  5AYW D;  2BED A;  1N4P A;  5M72 A;  2KZT A;  4C0E A;  1TN6 A;  3UXG A;  4UUC A;  5JJ7 A;  3G2S A;  3TWW A;  3JUE A;  3ZPJ A;  2AWI A;  3NZU A;  3AG2 E;  2QPW A;  3DBS A;  3D9M A;  1NP7 A;  2CFU A;  4ACK A;  4YDO A;  2P9P G;  3E32 A;  2GRR B;  3UT4 A;  2EIL E;  4RLY A;  3LY9 A;  5EX0 A;  1UJK A;  3LS8 A;  3PDN A;  1HE8 A;  3DWL G;  1D9S A;  4G2V A;  5FQ6 A;  3FH8 A;  5JA4 D;  4CCA A;  4L2L A;  4L2Y A;  4UQX A;  5ITZ F;  1GW6 A;  2E2E A;  5EX3 A;  5JJ0 A;  4HNA D;  2FO7 A;  2ZGG A;  2XZD G;  2WXR A;  3EHR A;  1OY3 D;  4BER A;  4FLH A;  3KMJ A;  1SQM A;  4JLG A;  4GPK A;  4AY6 A;  1SA5 A;  4KVM A;  3DSV A;  4MKT A;  3I5P A;  3FUH A;  3NOC D;  2V8S E;  3PZ3 A;  1ZBP A;  4J8D A;  1KT1 A;  3U4T A;  1Z5S C;  4RQI A;  4J7F A;  3LVR E;  4C1Q A;  3PNT B;  2KCV A;  4W9R A;  4GYW A;  4B93 B;  3CHO A;  3RJW A;  3F9W A;  3RQ4 A;  4HLL A;  3DSU A;  3N71 A;  1OCC E;  3CGH A;  1H0A A;  3G2W A;  4HOU A;  3UT8 A;  1H6K A;  4DRX E;  3MKR A;  3M58 A;  2H6I A;  4WWO A;  1TR4 A;  4HVB A;  5ARF A;  5DIZ A;  3S7F A;  5BNW A;  3ASH A;  3V30 A;  3SF4 A;  3L9T A;  3ZGQ A;  4G8K A;  3QKY A;  2R59 A;  2FI7 A;  2I1J A;  3ULQ A;  4URK A;  3T5V A;  2P9I G;  2Y4U A;  4N5Q A;  3HXB A;  3RK6 A;  1XNF A;  2ETC A;  2P9U G;  1W3B A;  3PZ2 A;  3CLJ A;  3G2T A;  1ZU2 A;  2XPZ A;  4ACL A;  2X6I A;  4AM9 A;  1N4R A;  1WAO 1;  3KEA A;  5CMY A;  5FJY A;  4I6G A;  3UUX A;  5ANR A;  3UM3 A;  1H6P A;  3CVP A;  4CRW A;  3LCA A;  4JDS A;  5BV0 A;  1N11 A;  3LJ3 A;  4BES A;  3SI5 A;  2QYU A;  3RSE G;  3FEX A;  4GTS A;  1RZ4 A;  2VGX A;  3F6Q A;  4C48 B;  3L16 A;  4YVO A;  1TNZ A;  3IBE A;  3M54 A;  4F53 A;  5T0K A;  5TTF A;  4NUR A;  3FTX A;  4U95 D;  4XZ4 A;  3ZKJ A;  2PM7 A;  3B7R L;  3D9L A;  3HIZ A;  4PH4 B;  1BLX B;  2QC9 A;  1FT1 A;  1IYG A;  4KVO A;  3QAQ A;  4V3I A;  1PC2 A;  3FPD A;  3B7T A;  1JUQ A;  5FTP A;  3UQ3 A;  3RRN B;  3Q7A A;  4DK5 A;  3MO0 A;  5BT1 A;  3DSS A;  2J8S D;  4LUN U;  3L17 A;  3FTW A;  4CDN A;  2LSU A;  5A7D B;  5EKQ D;  3EDT B;  1PY1 A;  3TXN A;  2FBN A;  2HYZ A;  2NC9 A;  4ANU A;  3EIJ A;  2QYJ A;  3PZ4 A;  2WXH A;  3ZYL A;  1WY6 A;  4YNP A;  3MX3 A;  3L22 A;  4QEP A;  1TNO A;  3FH5 A;  5T5G A;  4U04 A;  4FMU A;  4GMR A;  4KXK B;  1V55 E;  4RG9 A;  4EZK A;  1XGW A;  2DIW A;  2ZIS A;  4BX9 A;  4DX6 D;  3VLF A;  3MGB A;  4B8C B;  5EIB E;  3FU3 A;  2FUL A;  2CHW A;  3TJP A;  5KBA A;  3D9I A;  3RJV A;  3M55 A;  4J8F A;  4CDM A;  2E0I A;  4HOQ A;  2NYJ A;  4AV7 A;  3RU0 A;  5JMN D;  4UWL A;  2WXM A;  4UQZ A;  2F8X K;  4GZ6 A;  4GTO A;  4IUL A;  5FT9 A;  3DST A;  3UPV A;  5E75 A;  1HH8 A;  2AXU A;  4LNB A;  2IGQ A;  4AXH A;  3ZYQ A;  3ZW3 A;  3FFL A;  4HOR A;  3MO2 A;  4QEN A;  4NVQ A;  3ONK A;  3FTZ A;  3U66 A;  4BT9 A;  3VTX A;  4RZ0 A;  1K1A A;  4K5C A;  3KEZ A;  3FU5 A;  4NAC A;  2XCB A;  1NL4 A;  4N39 A;  4B8A A;  3ABM E;  2Y69 E;  5BXO A;  4KYO B;  3V31 A;  5AQA A;  1JWF A;  4KZ0 A;  4N2S A;  1MT6 A;  2BKK B;  3BUA A;  2PM6 A;  2I9C A;  5CBO A;  4I9E A;  5CEA A;  4UQY A;  2I6H A;  3IHV A;  4XI0 A;  4BX8 A;  2YHC A;  1K1B A;  3BG0 B;  3SBT B;  2H6F A;  4ZHB A;  3ABK E;  5EYL A;  3HG0 D;  4CGW A;  3EHN A;  5D66 A;  3D9O A;  3SD5 A;  4JEH A;  4LNU D;  2LSV A;  3CHQ A;  4HRN A;  4WAF A;  3C3R A;  3MV3 B;  1DCE A;  3L6A A;  3CBP A;  3ABL E;  4CYM D;  1UJJ A;  5KJM A;  2JV0 A;  3OPE A;  3C3Q A;  2MOW A;  2IU1 A;  5LSZ A;  2XQ0 A;  1L5J A;  4PS3 A;  3JXJ A;  1SZ9 A;  4B94 A;  3APD A;  4YDE A;  5F5E A;  2OV8 A;  2QY7 A;  2AJA A;  4N2Q A;  1QQE A;  1IHG A;  4I51 A;  1O1S A;  4GZ3 A;  2CG3 A;  4F6R D;  3SGH A;  2X6K A;  4FA6 A;  2RFM A;  3ML8 A;  3R9M A;  2XGM A;  2LAI A;  4OYS A;  4WWN A;  4AVX A;  4JPS A;  3T8K A;  2XEH A;  5KJN A;  2V5Q C;  1E8Z A;  3WXX A;  1NZN A;  4LER A;  3CHR A;  2VSN A;  4DX5 D;  2P9N G;  3IEG A;  2Y4T A;  3ZRH A;  5A6C A;  3URZ A;  2G46 A;  4U96 D;  3QB2 A;  1KPS B;  2JLB A;  3SO8 A;  3VLE A;  1LTX A;  1OXJ A;  3ZYK A;  4K0R A;  4JHK A;  5CED B;  4AY5 A;  5HI7 A;  1UW4 B;  1FVH A;  2HE0 A;  3R7Q A;  4YPE A;  5AAO A;  5KWD A;  4EZJ A;  2WXL A;  2FO1 E;  2YIN A;  3L82 A;  3E37 A;  2J08 A;  3IHY A;  1E7V A;  1MUF A;  1DNP A;  3U9W A;  3B95 A;  4O6F A;  2L0I A;  4FU3 A;  3SZ7 A;  3TWT A;  4QFV A;  5ENS D;  4BET A;  3PE4 A;  3FHE A;  3HNA A;  3MKQ B;  2WMO A;  2HO1 A;  4U07 A;  3SY2 A;  5BV1 A;  5F59 A;  3TWX A;  1ELR A;  2ETA A;  3CIA A;  5LSX A;  4FHJ A;  2P58 C;  3HXC A;  1OCZ E;  1TEZ A;  1B89 A;  2KM4 A;  1PEG A;  3SWC A;  1D8E A;  3AS4 A;  3UT7 A;  3ZHE B;  1IXV A;  4N3B A;  4GCN A;  3B13 A;  3OXG A;  2XS1 A;  4JEU A;  2B0O E;  5ENR D;  2VSX E;  2GRP B;  3OXL A;  1TNU A;  5ENT D;  4BEP A;  4U0Z A;  2ION A;  5J90 A;  2WXJ A;  5AYF A;  3MKQ A;  1A5E A;  2W5Z A;  1HZ4 A;  3AG3 E;  3KSL A;  5EDS A;  4L7T A;  2YHE A;  2VSO E;  4TUM A;  1EF1 C;  4MRU A;  4U7E B;  3E34 A;  1P5Q A;  2EIN E;  2F37 A;  1SW6 A;  2WXK A;  4NIK A;  3BEE A;  1MJ0 A;  4C9B B;  3FUE A;  4HS2 A;  4O1P A;  3WG7 E;  3TWS A;  1ELW A;  4AOF A;  3ASO E;  4TXQ A;  5HRY A;  4J8S A;  2PZI A;  4GTT A;  1IKN D;  1Z3X A;  2J07 A;  3QWP A;  4ZFH A;  4BSZ B;  4F1S A;  3ASD A;  2WQH A;  5CER B;  2M63 A;  4AU7 A;  3AG1 E;  4Y6W A;  1E96 B;  3HHM A;  5EID A;  3UM1 A;  3D9N A;  3HVE A;  2WXN A;  4GA0 A;  4U63 A;  4DX1 A;  1HFA A;  2Y0B G;  4G8L A;  2KBX A;  2IEJ A;  2BKG A;  2V5F A;  4HOS A;  3CKC A;  4O60 A;  1INZ A;  2MYO A;  4KBQ A;  3MA5 A;  2F8Y A;  4F1P A;  4F3V A;  4U0U A;  3K9I A;  2I2O A;  3CVL A;  4MLP A;  1N54 A;  1H6O A;  3AS8 A;  3OOI A;  4U8V D;  3DXM G;  4I1A A;  4A3T A;  2WXP A;  3CHM A;  2C0M A;  3G2U A;  4CT0 A;  4FUL A;  5AAR A;  4I17 A;  4CEM A;  2WM9 A;  1BI7 B;  1N0Q A;  4BTA A;  2GRL A;  4Q69 A;  4E85 A;  4OVV A;  3Q47 B;  3ISM C;  5G2N A;  5AJL A;  3HXE A;  2RG8 A;  5TEG A;  1TNY A;  5F6L A;  2WPV A;  4CDR A;  2XS8 A;  1KLX A;  4GB9 A;  3CQG B;  2ZIR A;  3JQ1 A;  3TWU A;  3FY4 A;  4TUU A;  2RKK A;  1S0P A;  4OAV B;  5CRV A;  4WNE A;  4BSX A;  4KMO A;  3HYM B;  5AIJ A;  2QZA A;  1SA4 A;  4E47 A;  3C3O A;  3VV0 A;  3SFX A;  2WMN A;  3DB5 A;  2IY0 C;  4LSZ E;  4ATZ D;  3UTM A;  1PAQ A;  4TXP A;  5FZS A;  1SVX A;  3PZD A;  3RIB A;  3QC1 A;  5FIN A;  5CCM A;  4O1O A;  2C2L A;  3BO5 A;  2EIM E;  2ILR A;  2IO2 C;  3ML9 A;  2X38 A;  3ASG A;  1RW2 A;  4Z68 A;  5E76 A;  4JD2 G;  5JJT A;  4BT8 A;  3AAA C;  4XE0 A;  3CHP A;  4XI9 A;  2W5Y A;  3PS6 A;  5LX8 A;  3CV0 A;  4FJZ A;  1OWO A;  4I43 A;  1JCR A;  5HS0 A;  2XGO A;  3DEP A;  4MI0 A;  3D9P A;  5G04 J;  2XPY A;  4DLO A;  5FIO A;  3OS5 A;  5ANL A;  3B7B A;  4FJY A;  4BWR A;  4LG6 A;  1TN7 A;  2CHZ A;  3HXF A;  2B6C A;  3KS2 A;  3R7R A;  3LPZ A;  4UWF A;  4N3C A;  5FQ4 A;  3E4B A;  3T9K A;  3DAL A;  5B1B E;  4KT6 B;  1U2V G;  4U8H A;  2XEE A;  1OCO E;  1G3N B;  4G23 A;  1IQU A;  2P2C P;  3SHF A;  2VTB A;  1EYH A;  1X5B A;  4G11 A;  5B1A E;  1NA3 A;  3DEO A;  3D3M A;  2GW1 A;  5FZR A;  5LP0 A;  2DWZ A;  2J9Q A;  4I6J A;  2X6F A;  3ONL A;  5FQ7 A;  4TXR A;  4GAA A;  5J08 A;  5H7P A;  3MYV A;  5KJK A;  3ASF A;  2IFU A;  3EJN A;  4KZC A;  3MO5 A;  3Q79 A;  5CEC B;  1YMP A;  3C72 A;  2GGF A;  3V2X A;  4JHJ A;  3RKV A;  4J0U A;  3CVU A;  2XGS A;  3FDH A;  5JHB A;  3FUL A;  1AP7 A;  2VJ8 A;  1E90 A;  3FUF A;  3FTU A;  2UY1 B;  3M56 A;  2LUH A;  3FU0 A;  4NJ5 A;  1SZA A;  2HM8 A;  2GRN B;  2OND A;  3EIQ C;  3JYS A; 
#chains in the Genus database with same CATH homology
 1SQM A;  4DI4 A;  4JLG A;  4GPK A;  4AY6 A;  4G25 A;  4KVM A;  3CQC B;  4MKT A;  3VLE A;  3PUJ A;  3QNK A;  3ZYK A;  3I5P A;  3FUH A;  5LCW C;  4K0R A;  4JHK A;  3T5X A;  2V8S E;  4PUC A;  1H19 A;  1ZBP A;  4AY5 A;  2R3A A;  4J8D A;  1KT1 A;  5HI7 A;  4K03 A;  1UW4 B;  3U4T A;  3M57 A;  1FVH A;  4APO A;  3R7Q A;  4EZL A;  4YPE A;  4J7F A;  4JZY A;  3VUZ A;  4J83 A;  4G26 A;  3LVR E;  4C1Q A;  4GZC A;  3PNT B;  4IRU A;  3NZS A;  2KCV A;  4J8E A;  4GYW A;  4W9R A;  3LXU X;  4LEU A;  5DBK A;  3MCX A;  4AIF A;  4EZJ A;  3CBO A;  2ZU6 B;  3CHO A;  3S2A A;  1H2U A;  3TGO A;  2WXL A;  3RJW A;  3F9W A;  3JUI A;  3QWW A;  3CK9 A;  3RQ4 A;  3N71 A;  2YIN A;  3CGH A;  1H0A A;  3G2W A;  4HOU A;  3S7J A;  2J08 A;  1H6K A;  3GZS A;  1E7V A;  3IHY A;  3UT8 A;  1UN9 A;  1MUF A;  2GRM A;  3FP3 A;  5JHN A;  1DNP A;  3CR3 A;  4N3A A;  3MKR A;  2WVI A;  3M58 A;  4WWO A;  5FWQ A;  3U9W A;  4F7A A;  3F9X A;  4YPA A;  4O6F A;  2FF4 A;  3MV2 B;  4ILG A;  2DBA A;  2L0I A;  4FU3 A;  4RG6 A;  4EPZ A;  4HVB A;  5ARF A;  5DIZ A;  3S7F A;  2IJG X;  1LF8 A;  3ENE A;  5BNW A;  1N52 A;  2KZT B;  1HG5 A;  3ASH A;  3SZ7 A;  4ANW A;  3SF4 A;  4QFV A;  3VLD A;  4EQF A;  3ZGQ A;  4I2Z A;  4DLQ A;  2XRY A;  3PE4 A;  3QKY A;  3FHE A;  1Z3Y A;  4R7L A;  4Z4P A;  3CVX A;  2R59 A;  3HNA A;  4H12 A;  3MKQ B;  4BFR A;  2WMO A;  3OTN A;  4UWK A;  2EQX A;  3L54 A;  2HO1 A;  5BW8 C;  3NQP A;  2FI7 A;  4U07 A;  1OWN A;  4YNM A;  5BV1 A;  5F59 A;  2I1J A;  3ULQ A;  1ELR A;  4URK A;  2F69 A;  5D0Q D;  3T5V A;  1UG3 A;  4FP7 A;  4YVQ C;  2VSY A;  3CIA A;  3LEW A;  5LSX A;  4FHJ A;  4JW1 A;  4TV3 A;  5JJ6 A;  3I3N A;  2P58 C;  2Y4U A;  5G05 J;  2OVB A;  4C0M A;  2WXF A;  4AEZ C;  2WQ7 A;  4I1O B;  3RK6 A;  4B89 A;  4FHK A;  1XNF A;  1TEZ A;  1B89 A;  2A4Z A;  3S8P A;  4CT4 A;  3CVN A;  3CVV A;  1W3B A;  1E8X A;  3KMT A;  1N3J A;  3CLJ A;  2OOE A;  1VDY A;  2KM4 A;  3G2T A;  3EHM A;  4N5C A;  1ZU2 A;  1OUV A;  2XPZ A;  1PEG A;  5CCL A;  3SWC A;  4ACL A;  3AS4 A;  4CGV A;  2IF4 A;  3Q5M A;  3KMA A;  3UT7 A;  2X6I A;  3FUK A;  3ZHE B;  2YQ8 A;  4AM9 A;  3FTS A;  1WAO 1;  4N3B A;  1N6A A;  4GCN A;  1U3C A;  3PH0 C;  3B13 A;  4GYY A;  3OXG A;  5CMY A;  3AU5 A;  4U0S A;  5FJY A;  4I6G A;  2IQC A;  4GML A;  4JEU A;  3UUX A;  3ZXS A;  5ANR A;  3IKO B;  2UY1 A;  2VSX E;  1E7U A;  2X6H A;  4XKC A;  3CVP A;  4CRW A;  4IYP A;  3OXL A;  1OWL A;  3LCA A;  4JL0 A;  5G05 C;  4JDS A;  5BV0 A;  3B7S A;  4U0Z A;  1UN8 A;  2ION A;  3LJ3 A;  4L1B A;  1QZ2 A;  4BY6 A;  5J90 A;  2UWJ G;  1N6C A;  2WXJ A;  2DCP A;  3SI5 A;  5AYF A;  3GZ1 A;  3MKQ A;  2W5Z A;  1HZ4 A;  3FEX A;  5EDS A;  3HDX A;  2C0L A;  2IOL A;  2VGX A;  4L7T A;  2YHE A;  3FUD A;  3AS5 A;  4M3O A;  4GU5 A;  3T8M A;  5LFA A;  4IJD A;  1E8W A;  3LY8 A;  4NQ0 A;  4Q96 A;  5CPR B;  2WQ6 A;  3L16 A;  2VSO E;  4HOT A;  4YVO A;  3NF1 A;  1EF1 C;  2FEZ A;  2VQ2 A;  4MRU A;  3IBE A;  1ELK A;  2LAH A;  1P5Q A;  3CHS A;  5FZQ A;  4F53 A;  3M54 A;  4O30 A;  3R9A B;  5HQ8 A;  1MVX A;  4NUR A;  2AVP A;  5T0K A;  5TTF A;  4DI3 A;  3FTX A;  3KAE A;  1XQH A;  4GYO A;  2JEK A;  4XZ4 A;  2XPI A;  3CEQ A;  4UI9 J;  4EEC A;  2PM7 A;  5C1D A;  3B7R L;  2WXK A;  1IQR A;  3BEE A;  3D9L A;  3D9J A;  4C9B B;  3FUE A;  4HS2 A;  3HIZ A;  1ELW A;  3FU6 A;  4PH4 B;  3ZFW A;  4AOF A;  2RD0 A;  3I4G A;  4I9C A;  4J8S A;  3M59 A;  4UWH A;  2PZI A;  5JHA A;  5JIN A;  3PE3 A;  2BQZ A;  4BTB A;  3QK0 A;  2BF0 X;  5LCW J;  3CVW A;  5LOZ A;  1IYG A;  4ANX A;  4KVO A;  4GA1 A;  1Z3X A;  2WXQ A;  2J07 A;  3QWP A;  3QAQ A;  3G2V A;  4ATG A;  4F1S A;  3ASD A;  3TAX A;  1MHQ A;  2WQH A;  4V3I A;  2M63 A;  1PC2 A;  4L23 A;  4A3V A;  2VTB B;  3B7T A;  1JUQ A;  3FPD A;  5FTP A;  1Y8M A;  4Y6W A;  1E96 B;  3CK8 A;  2KCK A;  3UQ3 A;  4GMJ A;  5G55 A;  1H2T C;  3HHM A;  4HFG A;  3D9K A;  2V0P A;  5T8I A;  3RRN B;  2HR2 A;  2L6J A;  4I6E A;  3D9N A;  4DK5 A;  3MO0 A;  2BTD A;  5BT1 A;  3HVE A;  3PVL A;  2NXP A;  2WXG A;  2WXN A;  4LUN U;  2X6J A;  2OVF A;  3L17 A;  3FTW A;  4Q94 A;  4CDN A;  4GA0 A;  3CKB A;  4U63 A;  1HFA A;  3TXM A;  4UWG A;  2LSU A;  2XRZ A;  5A7D B;  3LDZ A;  3JCK C;  1OWP A;  5EKQ D;  3ZEF A;  3U64 A;  2BUG A;  2NSZ A;  2V5F A;  3EDT B;  5F6K C;  4HOS A;  1PY1 A;  3CKC A;  3MZL B;  1INZ A;  3ZIM A;  4KBQ A;  3MA5 A;  4F3V A;  3TXN A;  4U0U A;  3TL5 A;  2MHK A;  3K9I A;  2A5U A;  2FBN A;  4XKB A;  2I2O A;  3Q49 B;  4H7Y A;  2HYZ A;  2NC9 A;  3CVL A;  3PEU B;  1HF8 A;  2XEV A;  4ANU A;  3EIJ A;  4MLP A;  1N54 A;  4JVS A;  3AS8 A;  4E6H A;  3OOI A;  3QWV A;  2XCC A;  3DPD A;  1OWM A;  1FCH A;  4I1A A;  2WXH A;  4LDG A;  4A3T A;  3FEY A;  5G04 C;  2WXP A;  3CHM A;  2C0M A;  1WY6 A;  3G2U A;  4RSY A;  4FUL A;  3ZYL A;  4AJW A;  4CT0 A;  4YNP A;  3MX3 A;  3P1U A;  3FWV A;  4I17 A;  4CEM A;  3L22 A;  2WM9 A;  2LO6 A;  4QEP A;  4BTA A;  3FUN A;  3FH5 A;  4Y6C A;  2GRL A;  3MEK A;  4U04 A;  2CHX A;  4Q69 A;  4FMU A;  5T5G A;  3APF A;  3GW4 A;  4PS8 A;  3SBS A;  4OVV A;  3Q47 B;  4E85 A;  5T4Y A;  4KXK B;  4GZD A;  5G2N A;  3C98 A;  4MS6 A;  5AJL A;  4NRH B;  1MVH A;  1ZKK A;  4RG9 A;  4EBA A;  4EZK A;  5EG2 A;  3ZN3 A;  1XGW A;  2DIW A;  2WXI A;  3JQ0 A;  4JXT A;  3RRM B;  3CSF A;  4BX9 A;  2R5S A;  2RG8 A;  3VLF A;  5TEG A;  5F6L A;  2WPV A;  4GCO A;  2VYI A;  4CDR A;  5T3R A;  3MGB A;  4WND A;  1NA0 A;  2J49 A;  2VGY A;  1KLX A;  4B8C B;  5ARG A;  2L9B A;  2V4L A;  1WM5 A;  4XIF A;  1A17 A;  3GYZ A;  3TG4 A;  3FU3 A;  4AP2 A;  1HG2 A;  4GB9 A;  2FUL A;  2L0T B;  2CHW A;  3B7U X;  3PEV B;  3QDN A;  3TJP A;  4DPR A;  1HS6 A;  3D9I A;  2LNI A;  3CQG B;  3RJV A;  3M55 A;  4J8F A;  4CDM A;  1U3D A;  3JQ1 A;  2E0I A;  3GZ2 A;  3FY4 A;  4HOQ A;  4A1S A;  4TUU A;  3SFZ A;  4J7I A;  2QFC A;  3VTY A;  1S0P A;  1TJF A;  4JHR A;  1JWG A;  3RU0 A;  4A1G A;  4AV7 A;  4I1M A;  4WNE A;  4BSX A;  4UWL A;  3SW9 A;  2J4B A;  2YNQ A;  4A55 A;  4KMO A;  3HYM B;  3ZVV A;  2WXM A;  4ILI A;  4UQZ A;  5AIJ A;  4E47 A;  4GZ6 A;  3RAY A;  3VV0 A;  4ILH B;  4IUL A;  2AW6 A;  5FT9 A;  2WMN A;  3L13 A;  2KAT A;  3LVQ E;  4YND A;  3UPV A;  1ML9 A;  3DB5 A;  2KCL A;  2AXZ A;  4FLB A;  4GZ5 A;  4FC8 A;  4EBA G;  3CBM A;  1PAQ A;  5E75 A;  1HH8 A;  2AXU A;  3S7B A;  3MJW A;  4B0Z A;  5FZS A;  2IGQ A;  4AXH A;  1HXI A;  2R17 C;  3ZYQ A;  4WNF A;  3ZW3 A;  4MI5 A;  4JC8 A;  1HU3 A;  2J09 A;  3PZD A;  3FFL A;  4HOR A;  3RIB A;  1MQS A;  3MO2 A;  2AXV A;  4QEN A;  3CVY A;  4NVQ A;  3ONK A;  3FTZ A;  3QC1 A;  3U66 A;  4IN3 B;  4BT9 A;  3P2B A;  4PS7 A;  3VTX A;  4RZ0 A;  5CCM A;  3ESK A;  4JA7 A;  3PRE A;  2WB2 A;  2CG2 A;  2C2L A;  4APF A;  3FUM A;  3KEZ A;  3BO5 A;  3FU5 A;  5BUZ A;  1HX8 A;  4NAC A;  2XCB A;  2ILR A;  3CK7 A;  2WXO A;  3O4Z A;  4N39 A;  3ML9 A;  4B8A A;  1EPU A;  2CFZ A;  2X38 A;  1H3I A;  3FTV A;  2MRI A;  3ASG A;  3FUI A;  4WWP A;  4KYO B;  5E76 A;  5AJD A;  5T0M A;  2PQN A;  4P29 A;  2VGX B;  5KCM A;  1TJC A;  1JWF A;  4RVB A;  5JIY A;  3K5K A;  5CMW A;  4KZ0 A;  3ESL A;  5JJT A;  4N2S A;  1MT6 A;  3O48 A;  3ZYM A;  4BT8 A;  2PM6 A;  4XE0 A;  3CHP A;  4XI9 A;  3IHX A;  3L08 A;  2I9C A;  4JA9 A;  4I9E A;  5ENN A;  3CST A;  3UX4 A;  1HO8 A;  4GA2 A;  2W5Y A;  1QNF A;  4UQY A;  2I6H A;  3PS6 A;  4UI9 C;  5LX8 A;  3CV0 A;  1YA0 A;  3IHV A;  3U3W A;  4XI0 A;  4FJZ A;  4BX8 A;  1OWO A;  4ME2 A;  4I43 A;  4H7X A;  4YPU A;  1KT0 A;  2YHC A;  1FVF A;  5CHE E;  4ANV A;  3BG0 B;  3SNX A;  3SBT B;  3FUJ A;  2XGO A;  2XHE A;  3CVQ A;  4IJ8 A;  5FQ8 A;  4ABN A;  4TRQ A;  5KJL A;  3KD7 A;  3OAW A;  3PNL B;  3Q15 A;  1H2V C;  4UI9 K;  3HVE B;  4MI0 A;  3FH7 A;  3D9P A;  5G04 J;  4CGW A;  3IV0 A;  3EHN A;  2XPY A;  3D9O A;  4HXI A;  3RRU A;  3SD5 A;  4JEH A;  4XX5 A;  4DLO A;  3OS5 A;  3F9Z A;  5ANL A;  2LSV A;  5C2Y A;  3CHQ A;  2RFI A;  3M5A A;  4FJY A;  4WNG A;  4BWR A;  4J6I A;  3APC A;  1E8Y A;  4WAF A;  2CHZ A;  1EDU A;  1JPL A;  1Z6T A;  3KS2 A;  2IOS A;  3MV3 B;  3R7R A;  3LPZ A;  4UWF A;  4N3C A;  3L6A A;  3CBP A;  5FQ4 A;  4BUP A;  3E4B A;  3DAL A;  2I1K A;  4KT6 B;  4OVU A;  2KC7 A;  4U8H A;  1UJJ A;  5KJM A;  2X3M A;  3FTY A;  3PUK A;  3QOU A;  4G23 A;  1IQU A;  2JV0 A;  3QAR A;  2PL2 A;  3OXF A;  3SHF A;  2VTB A;  1EYH A;  3OPE A;  1X5B A;  4G11 A;  2Q7F A;  2MOW A;  3QJZ A;  5AYW D;  1O9S A;  3TG5 A;  4PDX A;  5M72 A;  2IU1 A;  3M53 A;  3RO2 A;  2KZT A;  1NA3 A;  4G1T A;  4D10 C;  2O8J A;  5LSZ A;  2XQ0 A;  5BPP A;  4LCT A;  3D3M A;  4C0E A;  3RO3 A;  2GW1 A;  5FZR A;  5JJ7 A;  3G2S A;  1L5J A;  5LP0 A;  4PS3 A;  4I2W A;  2J9Q A;  4I6J A;  2X6F A;  3UMV A;  1SZ9 A;  3Q4A B;  3ONL A;  5FQ7 A;  3ZPJ A;  2AWI A;  4B94 A;  4QEO A;  3BG1 B;  3I4R B;  3NZU A;  4GAA A;  3APD A;  2J4D A;  3MYV A;  5J08 A;  3ASF A;  3DBS A;  5KJK A;  2QPW A;  3D9M A;  2IFU A;  1NP7 A;  2CFU A;  3EJN A;  4KZC A;  4ACK A;  5D0O D;  3AU4 A;  2OV8 A;  2QY7 A;  5F5E A;  4N2Q A;  1QQE A;  1IHG A;  4I51 A;  3MO5 A;  5A23 A;  4GZ3 A;  4WUY A;  3UT4 A;  4LRZ A;  2Y3A A;  2CG3 A;  4FAD A;  2GGF A;  3LY9 A;  5EX0 A;  1UJK A;  3SGH A;  4JHJ A;  3PRZ A;  3EP0 A;  3RKV A;  2X6K A;  3LS8 A;  3PDN A;  1BPO A;  4J0U A;  4FA6 A;  3F9Y A;  1HE8 A;  3LY7 A;  1DVP A;  4G2V A;  3ML8 A;  5FQ6 A;  2XGM A;  3FH8 A;  2LAI A;  3CVU A;  4OYS A;  3S7D A;  4WWN A;  4AVX A;  4G24 A;  4JPS A;  4CCA A;  4L2L A;  4L2Y A;  1Y6I A;  2XGS A;  4UQX A;  3FDH A;  1GW6 A;  2E2E A;  5JHB A;  5EX3 A;  3FUL A;  2VJ8 A;  3WXX A;  1E8Z A;  5KJN A;  1E90 A;  3FUF A;  4DJA A;  4J8O A;  3FTU A;  1NZN A;  4LER A;  3CHR A;  2VSN A;  4HLE A;  5AEN A;  2UY1 B;  5JJ0 A;  3M56 A;  2FO7 A;  4AU7 A;  2WXR A;  3IEG A;  3FU0 A;  2Y4T A;  4NJ5 A;  3ZHE A;  3LKU A;  1SZA A;  2PQR A;  3ZRH A;  5TH7 A;  5A6C A;  2HM8 A;  3LYA A;  4FLH A;  3URZ A;  2G46 A;  3KMJ A;  2OND A;  3QB2 A;  2JLB A;  3EIQ C;  3JYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...