4YNPA

Ash1l set domain s2259m mutant in complex with s-adenosyl methionine (sam)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
SYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHMFNVEKQQLCKCGFEKCRGIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Two Loops Undergoing Concerted Dynamics Regulate the Activity of the ASH1L Histone Methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase ASH1L
total genus 45
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4ynpA00
3M55A 4YNMA 5LSZA 5T0KA 5JINA 4YPAA 5KJKA 3K5KA 3FPDA 3CBMA 3F9XA 3OXGA 3F9WA 5F6KC 4Z4PA 1ZKKA 3M53A 5EG2A 2BQZA 5T5GA 2W5YA 3QWPA 4JDSA 5HQ8A 1MVHA 1MT6A 3M58A 3RAYA 4YPEA 4JLGA 1ML9A 4J7FA 3MEKA 4IJ8A 5JIYA 5CCMA 4QEOA 4MI0A 5TTFA 4J83A 5F6LA 3PDNA 4WUYA 5JJ0A 3IHXA 1MUFA 4QEPA 2R3AA 3S7DA 5KJLA 1O9SA 1N6CA 4BUPA 3S7JA 5F59A 5JHNA 5KJNA 2G46A 3MO5A 4O30A 4NVQA 5TEGA 5HI7A 5ARFA 3TG5A 3CBOA 4C1QA 3OPEA 3VV0A 3RQ4A 4NJ5A 5EX0A 2O8JA 5KJMA 3QWVA 5AYFA 4E47A 3OXFA 3OOIA 3RU0A 5CCLA 2W5ZA 4J7IA 4MI5A 3BO5A 3DB5A 4O6FA 1PEGA 4H12A 3VUZA 3F9ZA 4YPUA 5ARGA 3F9YA 5TH7A 4IJDA 3KMAA 1H3IA 3OS5A 3SW9A 5CPRB 2QPWA 3CBPA 3S7FA 3M54A 3M56A 1XQHA 3MO0A 3MO2A 4I51A 3N71A 5T0MA 3S8PA 3M5AA 3EP0A 2JV0A 3KMTA 1N6AA 4RZ0A 3RJWA 4FMUA 3HNAA 2RFIA 5LSXA 3TG4A 3OXLA 4YNPA 3RIBA 1N3JA 3S7BA 2IGQA 3DALA 3M59A 4LDGA 4YNDA 3SWCA 3M57A 2F69A 4J8OA 4QENA 4AU7A 5F5EA 1MVXA 3KMJA 3QWWA 5EX3A
chains in the Genus database with same CATH superfamily
3M55A 4YNMA 5LSZA 5T0KA 5JINA 4YPAA 5KJKA 3K5KA 3FPDA 3CBMA 3F9XA 3OXGA 3F9WA 5F6KC 4Z4PA 1ZKKA 3M53A 5EG2A 2BQZA 5T5GA 2W5YA 3QWPA 4JDSA 5HQ8A 1MVHA 1MT6A 3M58A 3RAYA 4YPEA 4JLGA 1ML9A 4J7FA 3MEKA 4IJ8A 5JIYA 5CCMA 4QEOA 4MI0A 5TTFA 4J83A 5F6LA 3PDNA 4WUYA 5JJ0A 3IHXA 1MUFA 4QEPA 2R3AA 3S7DA 5KJLA 1O9SA 1N6CA 4BUPA 3S7JA 5F59A 5JHNA 5KJNA 2G46A 3MO5A 4O30A 4NVQA 5TEGA 5HI7A 5ARFA 3TG5A 3CBOA 4C1QA 3OPEA 3VV0A 3RQ4A 4NJ5A 5EX0A 2O8JA 5KJMA 3QWVA 5AYFA 4E47A 3OXFA 3OOIA 3RU0A 5CCLA 2W5ZA 4J7IA 4MI5A 3BO5A 3DB5A 4O6FA 1PEGA 4H12A 3VUZA 3F9ZA 4YPUA 5ARGA 3F9YA 5TH7A 4IJDA 3KMAA 1H3IA 3OS5A 3SW9A 5CPRB 2QPWA 3CBPA 3S7FA 3M54A 3M56A 1XQHA 3MO0A 3MO2A 4I51A 3N71A 5T0MA 3S8PA 3M5AA 3EP0A 2JV0A 3KMTA 1N6AA 4RZ0A 3RJWA 4FMUA 3HNAA 2RFIA 5LSXA 3TG4A 3OXLA 4YNPA 3RIBA 1N3JA 3S7BA 2IGQA 3DALA 3M59A 4LDGA 4YNDA 3SWCA 3M57A 2F69A 4J8OA 4QENA 4AU7A 5F5EA 1MVXA 3KMJA 3QWWA 5EX3A
chains in the Genus database with same CATH topology
3M55A 4YNMA 5LSZA 5T0KA 5JINA 4YPAA 5KJKA 3K5KA 3FPDA 3CBMA 3F9XA 3OXGA 3F9WA 5F6KC 4Z4PA 1ZKKA 3M53A 5EG2A 2BQZA 5T5GA 2W5YA 3QWPA 4JDSA 5HQ8A 1MVHA 1MT6A 3M58A 3RAYA 4YPEA 4JLGA 1ML9A 4J7FA 3MEKA 4IJ8A 5JIYA 5CCMA 4QEOA 4MI0A 5TTFA 4J83A 5F6LA 3PDNA 4WUYA 5JJ0A 3IHXA 1MUFA 4QEPA 2R3AA 3S7DA 5KJLA 1O9SA 1N6CA 4BUPA 3S7JA 5F59A 5JHNA 5KJNA 2G46A 3MO5A 4O30A 4NVQA 5TEGA 5HI7A 5ARFA 3TG5A 3CBOA 4C1QA 3OPEA 3VV0A 3RQ4A 4NJ5A 5EX0A 2O8JA 5KJMA 3QWVA 5AYFA 4E47A 3OXFA 3OOIA 3RU0A 5CCLA 2W5ZA 4J7IA 4MI5A 3BO5A 3DB5A 4O6FA 1PEGA 4H12A 3VUZA 3F9ZA 4YPUA 5ARGA 3F9YA 5TH7A 4IJDA 3KMAA 1H3IA 3OS5A 3SW9A 5CPRB 2QPWA 3CBPA 3S7FA 3M54A 3M56A 1XQHA 3MO0A 3MO2A 4I51A 3N71A 5T0MA 3S8PA 3M5AA 3EP0A 2JV0A 3KMTA 1N6AA 4RZ0A 3RJWA 4FMUA 3HNAA 2RFIA 5LSXA 3TG4A 3OXLA 4YNPA 3RIBA 1N3JA 3S7BA 2IGQA 3DALA 3M59A 4LDGA 4YNDA 3SWCA 3M57A 2F69A 4J8OA 4QENA 4AU7A 5F5EA 1MVXA 3KMJA 3QWWA 5EX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M55 A;  4YNM A;  5LSZ A;  5T0K A;  5JIN A;  4YPA A;  5KJK A;  3K5K A;  3FPD A;  3CBM A;  3F9X A;  3OXG A;  3F9W A;  5F6K C;  4Z4P A;  1ZKK A;  3M53 A;  5EG2 A;  2BQZ A;  5T5G A;  2W5Y A;  3QWP A;  4JDS A;  5HQ8 A;  1MVH A;  1MT6 A;  3M58 A;  3RAY A;  4YPE A;  4JLG A;  1ML9 A;  4J7F A;  3MEK A;  4IJ8 A;  5JIY A;  5CCM A;  4QEO A;  4MI0 A;  5TTF A;  4J83 A;  5F6L A;  3PDN A;  4WUY A;  5JJ0 A;  3IHX A;  1MUF A;  4QEP A;  2R3A A;  3S7D A;  5KJL A;  1O9S A;  1N6C A;  4BUP A;  3S7J A;  5F59 A;  5JHN A;  5KJN A;  2G46 A;  3MO5 A;  4O30 A;  4NVQ A;  5TEG A;  5HI7 A;  5ARF A;  3TG5 A;  3CBO A;  4C1Q A;  3OPE A;  3VV0 A;  3RQ4 A;  4NJ5 A;  5EX0 A;  2O8J A;  5KJM A;  3QWV A;  5AYF A;  4E47 A;  3OXF A;  3OOI A;  3RU0 A;  5CCL A;  2W5Z A;  4J7I A;  4MI5 A;  3BO5 A;  3DB5 A;  4O6F A;  1PEG A;  4H12 A;  3VUZ A;  3F9Z A;  4YPU A;  5ARG A;  3F9Y A;  5TH7 A;  4IJD A;  3KMA A;  1H3I A;  3OS5 A;  3SW9 A;  5CPR B;  2QPW A;  3CBP A;  3S7F A;  3M54 A;  3M56 A;  1XQH A;  3MO0 A;  3MO2 A;  4I51 A;  3N71 A;  5T0M A;  3S8P A;  3M5A A;  3EP0 A;  2JV0 A;  3KMT A;  1N6A A;  4RZ0 A;  3RJW A;  4FMU A;  3HNA A;  2RFI A;  5LSX A;  3TG4 A;  3OXL A;  4YNP A;  3RIB A;  1N3J A;  3S7B A;  2IGQ A;  3DAL A;  3M59 A;  4LDG A;  4YND A;  3SWC A;  3M57 A;  2F69 A;  4J8O A;  4QEN A;  4AU7 A;  5F5E A;  1MVX A;  3KMJ A;  3QWW A;  5EX3 A; 
#chains in the Genus database with same CATH topology
 3M55 A;  4YNM A;  5LSZ A;  5T0K A;  5JIN A;  4YPA A;  5KJK A;  3K5K A;  3FPD A;  3CBM A;  3F9X A;  3OXG A;  3F9W A;  5F6K C;  4Z4P A;  1ZKK A;  3M53 A;  5EG2 A;  2BQZ A;  5T5G A;  2W5Y A;  3QWP A;  4JDS A;  5HQ8 A;  1MVH A;  1MT6 A;  3M58 A;  3RAY A;  4YPE A;  4JLG A;  1ML9 A;  4J7F A;  3MEK A;  4IJ8 A;  5JIY A;  5CCM A;  4QEO A;  4MI0 A;  5TTF A;  4J83 A;  5F6L A;  3PDN A;  4WUY A;  5JJ0 A;  3IHX A;  1MUF A;  4QEP A;  2R3A A;  3S7D A;  5KJL A;  1O9S A;  1N6C A;  4BUP A;  3S7J A;  5F59 A;  5JHN A;  5KJN A;  2G46 A;  3MO5 A;  4O30 A;  4NVQ A;  5TEG A;  5HI7 A;  5ARF A;  3TG5 A;  3CBO A;  4C1Q A;  3OPE A;  3VV0 A;  3RQ4 A;  4NJ5 A;  5EX0 A;  2O8J A;  5KJM A;  3QWV A;  5AYF A;  4E47 A;  3OXF A;  3OOI A;  3RU0 A;  5CCL A;  2W5Z A;  4J7I A;  4MI5 A;  3BO5 A;  3DB5 A;  4O6F A;  1PEG A;  4H12 A;  3VUZ A;  3F9Z A;  4YPU A;  5ARG A;  3F9Y A;  5TH7 A;  4IJD A;  3KMA A;  1H3I A;  3OS5 A;  3SW9 A;  5CPR B;  2QPW A;  3CBP A;  3S7F A;  3M54 A;  3M56 A;  1XQH A;  3MO0 A;  3MO2 A;  4I51 A;  3N71 A;  5T0M A;  3S8P A;  3M5A A;  3EP0 A;  2JV0 A;  3KMT A;  1N6A A;  4RZ0 A;  3RJW A;  4FMU A;  3HNA A;  2RFI A;  5LSX A;  3TG4 A;  3OXL A;  4YNP A;  3RIB A;  1N3J A;  3S7B A;  2IGQ A;  3DAL A;  3M59 A;  4LDG A;  4YND A;  3SWC A;  3M57 A;  2F69 A;  4J8O A;  4QEN A;  4AU7 A;  5F5E A;  1MVX A;  3KMJ A;  3QWW A;  5EX3 A; 
#chains in the Genus database with same CATH homology
 3M55 A;  4YNM A;  5LSZ A;  5T0K A;  5JIN A;  4YPA A;  5KJK A;  3K5K A;  3FPD A;  3CBM A;  3F9X A;  3OXG A;  3F9W A;  5F6K C;  4Z4P A;  1ZKK A;  3M53 A;  5EG2 A;  2BQZ A;  5T5G A;  2W5Y A;  3QWP A;  4JDS A;  5HQ8 A;  1MVH A;  1MT6 A;  3M58 A;  3RAY A;  4YPE A;  4JLG A;  1ML9 A;  4J7F A;  3MEK A;  4IJ8 A;  5JIY A;  5CCM A;  4QEO A;  4MI0 A;  5TTF A;  4J83 A;  5F6L A;  3PDN A;  4WUY A;  5JJ0 A;  3IHX A;  1MUF A;  4QEP A;  2R3A A;  3S7D A;  5KJL A;  1O9S A;  1N6C A;  4BUP A;  3S7J A;  5F59 A;  5JHN A;  5KJN A;  2G46 A;  3MO5 A;  4O30 A;  4NVQ A;  5TEG A;  5HI7 A;  5ARF A;  3TG5 A;  3CBO A;  4C1Q A;  3OPE A;  3VV0 A;  3RQ4 A;  4NJ5 A;  5EX0 A;  2O8J A;  5KJM A;  3QWV A;  5AYF A;  4E47 A;  3OXF A;  3OOI A;  3RU0 A;  5CCL A;  2W5Z A;  4J7I A;  4MI5 A;  3BO5 A;  3DB5 A;  4O6F A;  1PEG A;  4H12 A;  3VUZ A;  3F9Z A;  4YPU A;  5ARG A;  3F9Y A;  5TH7 A;  4IJD A;  3KMA A;  1H3I A;  3OS5 A;  3SW9 A;  5CPR B;  2QPW A;  3CBP A;  3S7F A;  3M54 A;  3M56 A;  1XQH A;  3MO0 A;  3MO2 A;  4I51 A;  3N71 A;  5T0M A;  3S8P A;  3M5A A;  3EP0 A;  2JV0 A;  3KMT A;  1N6A A;  4RZ0 A;  3RJW A;  4FMU A;  3HNA A;  2RFI A;  5LSX A;  3TG4 A;  3OXL A;  4YNP A;  3RIB A;  1N3J A;  3S7B A;  2IGQ A;  3DAL A;  3M59 A;  4LDG A;  4YND A;  3SWC A;  3M57 A;  2F69 A;  4J8O A;  4QEN A;  4AU7 A;  5F5E A;  1MVX A;  3KMJ A;  3QWW A;  5EX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...