4YNPA

Ash1l set domain s2259m mutant in complex with s-adenosyl methionine (sam)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
b'SYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHMFNVEKQQLCKCGFEKCRGIIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase ASH1L
molecule tags Transferase
source organism Homo sapiens
publication title Two Loops Undergoing Concerted Dynamics Regulate the Activity of the ASH1L Histone Methyltransferase.
pubmed doi rcsb
total genus 45
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4ynpA00
4NVQA 2G46A 3M5AA 5CCLA 3OXLA 4LDGA 5AYFA 3OPEA 3F9XA 3HNAA 3QWWA 4MI0A 3PDNA 5F6LA 2W5ZA 3KMTA 1N3JA 3F9ZA 1MVXA 5JIYA 3DB5A 2JV0A 3K5KA 3RQ4A 3M58A 1MVHA 3S8PA 4WUYA 1O9SA 4YNDA 4YPUA 4QEPA 3RU0A 1XQHA 5EG2A 5LSXA 5JINA 3BO5A 3TG5A 3DALA 4O6FA 3QWVA 5KJNA 3S7JA 1ML9A 3S7FA 5KJLA 4H12A 3M55A 4YNMA 1PEGA 3OS5A 3RAYA 3KMAA 4NJ5A 5F6KC 3CBPA 3QWPA 3F9WA 1N6AA 4I51A 4IJ8A 2RFIA 5F5EA 5JJ0A 3RIBA 3S7DA 4QENA 1MT6A 2O8JA 3SWCA 3M56A 2IGQA 3MO2A 5EX0A 4BUPA 5KJKA 3CBMA 3M57A 4RZ0A 4FMUA 3IHXA 5T0KA 3MO5A 4AU7A 3OXGA 3S7BA 3VUZA 5EX3A 5HI7A 3M53A 3RJWA 2QPWA 4IJDA 3VV0A 1H3IA 4J7FA 3M59A 3CBOA 4YPAA 3EP0A 4Z4PA 4J7IA 3SW9A 5CCMA 4J8OA 3M54A 4E47A 1MUFA 4MI5A 5TTFA 3F9YA 5T0MA 4C1QA 5KJMA 5TEGA 4YNPA 4YPEA 2BQZA 3OXFA 3TG4A 3N71A 2W5YA 5CPRB 5F59A 4JDSA 5ARGA 2F69A 2R3AA 3OOIA 4QEOA 4J83A 3FPDA 5ARFA 3MO0A 5T5GA 3KMJA 5LSZA 5HQ8A 4O30A 5TH7A 1N6CA 5JHNA 1ZKKA 4JLGA 3MEKA
chains in the Genus database with same CATH superfamily
4NVQA 2G46A 3M5AA 5CCLA 3OXLA 4LDGA 5AYFA 3OPEA 3F9XA 3HNAA 3QWWA 4MI0A 3PDNA 5F6LA 2W5ZA 3KMTA 1N3JA 3F9ZA 1MVXA 5JIYA 3DB5A 2JV0A 3K5KA 3RQ4A 3M58A 1MVHA 3S8PA 4WUYA 1O9SA 4YNDA 4YPUA 4QEPA 3RU0A 1XQHA 5EG2A 5LSXA 5JINA 3BO5A 3TG5A 3DALA 4O6FA 3QWVA 5KJNA 3S7JA 1ML9A 3S7FA 5KJLA 4H12A 3M55A 4YNMA 1PEGA 3OS5A 3RAYA 3KMAA 4NJ5A 5F6KC 3CBPA 3QWPA 3F9WA 1N6AA 4I51A 4IJ8A 2RFIA 5F5EA 5JJ0A 3RIBA 3S7DA 4QENA 1MT6A 2O8JA 3SWCA 3M56A 2IGQA 3MO2A 5EX0A 4BUPA 5KJKA 3CBMA 3M57A 4RZ0A 4FMUA 3IHXA 5T0KA 3MO5A 4AU7A 3OXGA 3S7BA 3VUZA 5EX3A 5HI7A 3M53A 3RJWA 2QPWA 4IJDA 3VV0A 1H3IA 4J7FA 3M59A 3CBOA 4YPAA 3EP0A 4Z4PA 4J7IA 3SW9A 5CCMA 4J8OA 3M54A 4E47A 1MUFA 4MI5A 5TTFA 3F9YA 5T0MA 4C1QA 5KJMA 5TEGA 4YNPA 4YPEA 2BQZA 3OXFA 3TG4A 3N71A 2W5YA 5CPRB 5F59A 4JDSA 5ARGA 2F69A 2R3AA 3OOIA 4QEOA 4J83A 3FPDA 5ARFA 3MO0A 5T5GA 3KMJA 5LSZA 5HQ8A 4O30A 5TH7A 1N6CA 5JHNA 1ZKKA 4JLGA 3MEKA
chains in the Genus database with same CATH topology
4NVQA 2G46A 3M5AA 5CCLA 3OXLA 4LDGA 5AYFA 3OPEA 3F9XA 3HNAA 3QWWA 4MI0A 3PDNA 5F6LA 2W5ZA 3KMTA 1N3JA 3F9ZA 1MVXA 5JIYA 3DB5A 2JV0A 3K5KA 3RQ4A 3M58A 1MVHA 3S8PA 4WUYA 1O9SA 4YNDA 4YPUA 4QEPA 3RU0A 1XQHA 5EG2A 5LSXA 5JINA 3BO5A 3TG5A 3DALA 4O6FA 3QWVA 5KJNA 3S7JA 1ML9A 3S7FA 5KJLA 4H12A 3M55A 4YNMA 1PEGA 3OS5A 3RAYA 3KMAA 4NJ5A 5F6KC 3CBPA 3QWPA 3F9WA 1N6AA 4I51A 4IJ8A 2RFIA 5F5EA 5JJ0A 3RIBA 3S7DA 4QENA 1MT6A 2O8JA 3SWCA 3M56A 2IGQA 3MO2A 5EX0A 4BUPA 5KJKA 3CBMA 3M57A 4RZ0A 4FMUA 3IHXA 5T0KA 3MO5A 4AU7A 3OXGA 3S7BA 3VUZA 5EX3A 5HI7A 3M53A 3RJWA 2QPWA 4IJDA 3VV0A 1H3IA 4J7FA 3M59A 3CBOA 4YPAA 3EP0A 4Z4PA 4J7IA 3SW9A 5CCMA 4J8OA 3M54A 4E47A 1MUFA 4MI5A 5TTFA 3F9YA 5T0MA 4C1QA 5KJMA 5TEGA 4YNPA 4YPEA 2BQZA 3OXFA 3TG4A 3N71A 2W5YA 5CPRB 5F59A 4JDSA 5ARGA 2F69A 2R3AA 3OOIA 4QEOA 4J83A 3FPDA 5ARFA 3MO0A 5T5GA 3KMJA 5LSZA 5HQ8A 4O30A 5TH7A 1N6CA 5JHNA 1ZKKA 4JLGA 3MEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NVQ A;  2G46 A;  3M5A A;  5CCL A;  3OXL A;  4LDG A;  5AYF A;  3OPE A;  3F9X A;  3HNA A;  3QWW A;  4MI0 A;  3PDN A;  5F6L A;  2W5Z A;  3KMT A;  1N3J A;  3F9Z A;  1MVX A;  5JIY A;  3DB5 A;  2JV0 A;  3K5K A;  3RQ4 A;  3M58 A;  1MVH A;  3S8P A;  4WUY A;  1O9S A;  4YND A;  4YPU A;  4QEP A;  3RU0 A;  1XQH A;  5EG2 A;  5LSX A;  5JIN A;  3BO5 A;  3TG5 A;  3DAL A;  4O6F A;  3QWV A;  5KJN A;  3S7J A;  1ML9 A;  3S7F A;  5KJL A;  4H12 A;  3M55 A;  4YNM A;  1PEG A;  3OS5 A;  3RAY A;  3KMA A;  4NJ5 A;  5F6K C;  3CBP A;  3QWP A;  3F9W A;  1N6A A;  4I51 A;  4IJ8 A;  2RFI A;  5F5E A;  5JJ0 A;  3RIB A;  3S7D A;  4QEN A;  1MT6 A;  2O8J A;  3SWC A;  3M56 A;  2IGQ A;  3MO2 A;  5EX0 A;  4BUP A;  5KJK A;  3CBM A;  3M57 A;  4RZ0 A;  4FMU A;  3IHX A;  5T0K A;  3MO5 A;  4AU7 A;  3OXG A;  3S7B A;  3VUZ A;  5EX3 A;  5HI7 A;  3M53 A;  3RJW A;  2QPW A;  4IJD A;  3VV0 A;  1H3I A;  4J7F A;  3M59 A;  3CBO A;  4YPA A;  3EP0 A;  4Z4P A;  4J7I A;  3SW9 A;  5CCM A;  4J8O A;  3M54 A;  4E47 A;  1MUF A;  4MI5 A;  5TTF A;  3F9Y A;  5T0M A;  4C1Q A;  5KJM A;  5TEG A;  4YNP A;  4YPE A;  2BQZ A;  3OXF A;  3TG4 A;  3N71 A;  2W5Y A;  5CPR B;  5F59 A;  4JDS A;  5ARG A;  2F69 A;  2R3A A;  3OOI A;  4QEO A;  4J83 A;  3FPD A;  5ARF A;  3MO0 A;  5T5G A;  3KMJ A;  5LSZ A;  5HQ8 A;  4O30 A;  5TH7 A;  1N6C A;  5JHN A;  1ZKK A;  4JLG A;  3MEK A; 
#chains in the Genus database with same CATH topology
 4NVQ A;  2G46 A;  3M5A A;  5CCL A;  3OXL A;  4LDG A;  5AYF A;  3OPE A;  3F9X A;  3HNA A;  3QWW A;  4MI0 A;  3PDN A;  5F6L A;  2W5Z A;  3KMT A;  1N3J A;  3F9Z A;  1MVX A;  5JIY A;  3DB5 A;  2JV0 A;  3K5K A;  3RQ4 A;  3M58 A;  1MVH A;  3S8P A;  4WUY A;  1O9S A;  4YND A;  4YPU A;  4QEP A;  3RU0 A;  1XQH A;  5EG2 A;  5LSX A;  5JIN A;  3BO5 A;  3TG5 A;  3DAL A;  4O6F A;  3QWV A;  5KJN A;  3S7J A;  1ML9 A;  3S7F A;  5KJL A;  4H12 A;  3M55 A;  4YNM A;  1PEG A;  3OS5 A;  3RAY A;  3KMA A;  4NJ5 A;  5F6K C;  3CBP A;  3QWP A;  3F9W A;  1N6A A;  4I51 A;  4IJ8 A;  2RFI A;  5F5E A;  5JJ0 A;  3RIB A;  3S7D A;  4QEN A;  1MT6 A;  2O8J A;  3SWC A;  3M56 A;  2IGQ A;  3MO2 A;  5EX0 A;  4BUP A;  5KJK A;  3CBM A;  3M57 A;  4RZ0 A;  4FMU A;  3IHX A;  5T0K A;  3MO5 A;  4AU7 A;  3OXG A;  3S7B A;  3VUZ A;  5EX3 A;  5HI7 A;  3M53 A;  3RJW A;  2QPW A;  4IJD A;  3VV0 A;  1H3I A;  4J7F A;  3M59 A;  3CBO A;  4YPA A;  3EP0 A;  4Z4P A;  4J7I A;  3SW9 A;  5CCM A;  4J8O A;  3M54 A;  4E47 A;  1MUF A;  4MI5 A;  5TTF A;  3F9Y A;  5T0M A;  4C1Q A;  5KJM A;  5TEG A;  4YNP A;  4YPE A;  2BQZ A;  3OXF A;  3TG4 A;  3N71 A;  2W5Y A;  5CPR B;  5F59 A;  4JDS A;  5ARG A;  2F69 A;  2R3A A;  3OOI A;  4QEO A;  4J83 A;  3FPD A;  5ARF A;  3MO0 A;  5T5G A;  3KMJ A;  5LSZ A;  5HQ8 A;  4O30 A;  5TH7 A;  1N6C A;  5JHN A;  1ZKK A;  4JLG A;  3MEK A; 
#chains in the Genus database with same CATH homology
 4NVQ A;  2G46 A;  3M5A A;  5CCL A;  3OXL A;  4LDG A;  5AYF A;  3OPE A;  3F9X A;  3HNA A;  3QWW A;  4MI0 A;  3PDN A;  5F6L A;  2W5Z A;  3KMT A;  1N3J A;  3F9Z A;  1MVX A;  5JIY A;  3DB5 A;  2JV0 A;  3K5K A;  3RQ4 A;  3M58 A;  1MVH A;  3S8P A;  4WUY A;  1O9S A;  4YND A;  4YPU A;  4QEP A;  3RU0 A;  1XQH A;  5EG2 A;  5LSX A;  5JIN A;  3BO5 A;  3TG5 A;  3DAL A;  4O6F A;  3QWV A;  5KJN A;  3S7J A;  1ML9 A;  3S7F A;  5KJL A;  4H12 A;  3M55 A;  4YNM A;  1PEG A;  3OS5 A;  3RAY A;  3KMA A;  4NJ5 A;  5F6K C;  3CBP A;  3QWP A;  3F9W A;  1N6A A;  4I51 A;  4IJ8 A;  2RFI A;  5F5E A;  5JJ0 A;  3RIB A;  3S7D A;  4QEN A;  1MT6 A;  2O8J A;  3SWC A;  3M56 A;  2IGQ A;  3MO2 A;  5EX0 A;  4BUP A;  5KJK A;  3CBM A;  3M57 A;  4RZ0 A;  4FMU A;  3IHX A;  5T0K A;  3MO5 A;  4AU7 A;  3OXG A;  3S7B A;  3VUZ A;  5EX3 A;  5HI7 A;  3M53 A;  3RJW A;  2QPW A;  4IJD A;  3VV0 A;  1H3I A;  4J7F A;  3M59 A;  3CBO A;  4YPA A;  3EP0 A;  4Z4P A;  4J7I A;  3SW9 A;  5CCM A;  4J8O A;  3M54 A;  4E47 A;  1MUF A;  4MI5 A;  5TTF A;  3F9Y A;  5T0M A;  4C1Q A;  5KJM A;  5TEG A;  4YNP A;  4YPE A;  2BQZ A;  3OXF A;  3TG4 A;  3N71 A;  2W5Y A;  5CPR B;  5F59 A;  4JDS A;  5ARG A;  2F69 A;  2R3A A;  3OOI A;  4QEO A;  4J83 A;  3FPD A;  5ARF A;  3MO0 A;  5T5G A;  3KMJ A;  5LSZ A;  5HQ8 A;  4O30 A;  5TH7 A;  1N6C A;  5JHN A;  1ZKK A;  4JLG A;  3MEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...