4YNPA

Ash1l set domain s2259m mutant in complex with s-adenosyl methionine (sam)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
SYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHMFNVEKQQLCKCGFEKCRGIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Two Loops Undergoing Concerted Dynamics Regulate the Activity of the ASH1L Histone Methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase ASH1L
total genus 45
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4ynpA00
3RIBA 3QWPA 1N3JA 2JV0A 3CBPA 4BUPA 4YNPA 4MI0A 4QEPA 3KMJA 3EP0A 5TH7A 5CCMA 3M54A 3F9YA 5F5EA 5CPRB 2F69A 1MVHA 4J7IA 5T0MA 3S7JA 3S7FA 4JDSA 4NJ5A 3KMTA 4QENA 3MO2A 3N71A 4RZ0A 4J8OA 4JLGA 3OXLA 4E47A 3S7BA 3M55A 3RQ4A 4AU7A 3VUZA 4C1QA 4YNDA 3BO5A 3MO0A 3RU0A 3S8PA 4FMUA 3M58A 3DALA 3OXFA 3HNAA 3M57A 3TG5A 5EG2A 4Z4PA 5F6LA 3SW9A 5T5GA 1PEGA 5HQ8A 3FPDA 1MVXA 5JINA 3OS5A 3QWWA 3CBOA 3M59A 4YPUA 3DB5A 3TG4A 4IJ8A 4YNMA 3QWVA 4QEOA 2W5YA 1ML9A 3K5KA 5JJ0A 2IGQA 3MO5A 1MT6A 3M53A 5ARGA 4WUYA 5LSXA 3RAYA 3RJWA 5CCLA 2QPWA 5F59A 2R3AA 4O30A 4MI5A 2G46A 3KMAA 5LSZA 1N6AA 4LDGA 4I51A 5KJKA 2O8JA 3SWCA 4H12A 3S7DA 5T0KA 3F9XA 1H3IA 3OPEA 4J7FA 5AYFA 4YPAA 5HI7A 4IJDA 3M5AA 2BQZA 1MUFA 5JIYA 2W5ZA 5F6KC 5JHNA 1O9SA 3M56A 3CBMA 3OXGA 3PDNA 3OOIA 1ZKKA 4J83A 1XQHA 4O6FA 5KJNA 3MEKA 5ARFA 5EX0A 1N6CA 4YPEA 3IHXA 3F9ZA 3VV0A 5KJMA 3F9WA 4NVQA 5TEGA 5TTFA 5EX3A 2RFIA 5KJLA
chains in the Genus database with same CATH superfamily
3RIBA 3QWPA 1N3JA 2JV0A 3CBPA 4BUPA 4YNPA 4MI0A 4QEPA 3KMJA 3EP0A 5TH7A 5CCMA 3M54A 3F9YA 5F5EA 5CPRB 2F69A 1MVHA 4J7IA 5T0MA 3S7JA 3S7FA 4JDSA 4NJ5A 3KMTA 4QENA 3MO2A 3N71A 4RZ0A 4J8OA 4JLGA 3OXLA 4E47A 3S7BA 3M55A 3RQ4A 4AU7A 3VUZA 4C1QA 4YNDA 3BO5A 3MO0A 3RU0A 3S8PA 4FMUA 3M58A 3DALA 3OXFA 3HNAA 3M57A 3TG5A 5EG2A 4Z4PA 5F6LA 3SW9A 5T5GA 1PEGA 5HQ8A 3FPDA 1MVXA 5JINA 3OS5A 3QWWA 3CBOA 3M59A 4YPUA 3DB5A 3TG4A 4IJ8A 4YNMA 3QWVA 4QEOA 2W5YA 1ML9A 3K5KA 5JJ0A 2IGQA 3MO5A 1MT6A 3M53A 5ARGA 4WUYA 5LSXA 3RAYA 3RJWA 5CCLA 2QPWA 5F59A 2R3AA 4O30A 4MI5A 2G46A 3KMAA 5LSZA 1N6AA 4LDGA 4I51A 5KJKA 2O8JA 3SWCA 4H12A 3S7DA 5T0KA 3F9XA 1H3IA 3OPEA 4J7FA 5AYFA 4YPAA 5HI7A 4IJDA 3M5AA 2BQZA 1MUFA 5JIYA 2W5ZA 5F6KC 5JHNA 1O9SA 3M56A 3CBMA 3OXGA 3PDNA 3OOIA 1ZKKA 4J83A 1XQHA 4O6FA 5KJNA 3MEKA 5ARFA 5EX0A 1N6CA 4YPEA 3IHXA 3F9ZA 3VV0A 5KJMA 3F9WA 4NVQA 5TEGA 5TTFA 5EX3A 2RFIA 5KJLA
chains in the Genus database with same CATH topology
3RIBA 3QWPA 1N3JA 2JV0A 3CBPA 4BUPA 4YNPA 4MI0A 4QEPA 3KMJA 3EP0A 5TH7A 5CCMA 3M54A 3F9YA 5F5EA 5CPRB 2F69A 1MVHA 4J7IA 5T0MA 3S7JA 3S7FA 4JDSA 4NJ5A 3KMTA 4QENA 3MO2A 3N71A 4RZ0A 4J8OA 4JLGA 3OXLA 4E47A 3S7BA 3M55A 3RQ4A 4AU7A 3VUZA 4C1QA 4YNDA 3BO5A 3MO0A 3RU0A 3S8PA 4FMUA 3M58A 3DALA 3OXFA 3HNAA 3M57A 3TG5A 5EG2A 4Z4PA 5F6LA 3SW9A 5T5GA 1PEGA 5HQ8A 3FPDA 1MVXA 5JINA 3OS5A 3QWWA 3CBOA 3M59A 4YPUA 3DB5A 3TG4A 4IJ8A 4YNMA 3QWVA 4QEOA 2W5YA 1ML9A 3K5KA 5JJ0A 2IGQA 3MO5A 1MT6A 3M53A 5ARGA 4WUYA 5LSXA 3RAYA 3RJWA 5CCLA 2QPWA 5F59A 2R3AA 4O30A 4MI5A 2G46A 3KMAA 5LSZA 1N6AA 4LDGA 4I51A 5KJKA 2O8JA 3SWCA 4H12A 3S7DA 5T0KA 3F9XA 1H3IA 3OPEA 4J7FA 5AYFA 4YPAA 5HI7A 4IJDA 3M5AA 2BQZA 1MUFA 5JIYA 2W5ZA 5F6KC 5JHNA 1O9SA 3M56A 3CBMA 3OXGA 3PDNA 3OOIA 1ZKKA 4J83A 1XQHA 4O6FA 5KJNA 3MEKA 5ARFA 5EX0A 1N6CA 4YPEA 3IHXA 3F9ZA 3VV0A 5KJMA 3F9WA 4NVQA 5TEGA 5TTFA 5EX3A 2RFIA 5KJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RIB A;  3QWP A;  1N3J A;  2JV0 A;  3CBP A;  4BUP A;  4YNP A;  4MI0 A;  4QEP A;  3KMJ A;  3EP0 A;  5TH7 A;  5CCM A;  3M54 A;  3F9Y A;  5F5E A;  5CPR B;  2F69 A;  1MVH A;  4J7I A;  5T0M A;  3S7J A;  3S7F A;  4JDS A;  4NJ5 A;  3KMT A;  4QEN A;  3MO2 A;  3N71 A;  4RZ0 A;  4J8O A;  4JLG A;  3OXL A;  4E47 A;  3S7B A;  3M55 A;  3RQ4 A;  4AU7 A;  3VUZ A;  4C1Q A;  4YND A;  3BO5 A;  3MO0 A;  3RU0 A;  3S8P A;  4FMU A;  3M58 A;  3DAL A;  3OXF A;  3HNA A;  3M57 A;  3TG5 A;  5EG2 A;  4Z4P A;  5F6L A;  3SW9 A;  5T5G A;  1PEG A;  5HQ8 A;  3FPD A;  1MVX A;  5JIN A;  3OS5 A;  3QWW A;  3CBO A;  3M59 A;  4YPU A;  3DB5 A;  3TG4 A;  4IJ8 A;  4YNM A;  3QWV A;  4QEO A;  2W5Y A;  1ML9 A;  3K5K A;  5JJ0 A;  2IGQ A;  3MO5 A;  1MT6 A;  3M53 A;  5ARG A;  4WUY A;  5LSX A;  3RAY A;  3RJW A;  5CCL A;  2QPW A;  5F59 A;  2R3A A;  4O30 A;  4MI5 A;  2G46 A;  3KMA A;  5LSZ A;  1N6A A;  4LDG A;  4I51 A;  5KJK A;  2O8J A;  3SWC A;  4H12 A;  3S7D A;  5T0K A;  3F9X A;  1H3I A;  3OPE A;  4J7F A;  5AYF A;  4YPA A;  5HI7 A;  4IJD A;  3M5A A;  2BQZ A;  1MUF A;  5JIY A;  2W5Z A;  5F6K C;  5JHN A;  1O9S A;  3M56 A;  3CBM A;  3OXG A;  3PDN A;  3OOI A;  1ZKK A;  4J83 A;  1XQH A;  4O6F A;  5KJN A;  3MEK A;  5ARF A;  5EX0 A;  1N6C A;  4YPE A;  3IHX A;  3F9Z A;  3VV0 A;  5KJM A;  3F9W A;  4NVQ A;  5TEG A;  5TTF A;  5EX3 A;  2RFI A;  5KJL A; 
#chains in the Genus database with same CATH topology
 3RIB A;  3QWP A;  1N3J A;  2JV0 A;  3CBP A;  4BUP A;  4YNP A;  4MI0 A;  4QEP A;  3KMJ A;  3EP0 A;  5TH7 A;  5CCM A;  3M54 A;  3F9Y A;  5F5E A;  5CPR B;  2F69 A;  1MVH A;  4J7I A;  5T0M A;  3S7J A;  3S7F A;  4JDS A;  4NJ5 A;  3KMT A;  4QEN A;  3MO2 A;  3N71 A;  4RZ0 A;  4J8O A;  4JLG A;  3OXL A;  4E47 A;  3S7B A;  3M55 A;  3RQ4 A;  4AU7 A;  3VUZ A;  4C1Q A;  4YND A;  3BO5 A;  3MO0 A;  3RU0 A;  3S8P A;  4FMU A;  3M58 A;  3DAL A;  3OXF A;  3HNA A;  3M57 A;  3TG5 A;  5EG2 A;  4Z4P A;  5F6L A;  3SW9 A;  5T5G A;  1PEG A;  5HQ8 A;  3FPD A;  1MVX A;  5JIN A;  3OS5 A;  3QWW A;  3CBO A;  3M59 A;  4YPU A;  3DB5 A;  3TG4 A;  4IJ8 A;  4YNM A;  3QWV A;  4QEO A;  2W5Y A;  1ML9 A;  3K5K A;  5JJ0 A;  2IGQ A;  3MO5 A;  1MT6 A;  3M53 A;  5ARG A;  4WUY A;  5LSX A;  3RAY A;  3RJW A;  5CCL A;  2QPW A;  5F59 A;  2R3A A;  4O30 A;  4MI5 A;  2G46 A;  3KMA A;  5LSZ A;  1N6A A;  4LDG A;  4I51 A;  5KJK A;  2O8J A;  3SWC A;  4H12 A;  3S7D A;  5T0K A;  3F9X A;  1H3I A;  3OPE A;  4J7F A;  5AYF A;  4YPA A;  5HI7 A;  4IJD A;  3M5A A;  2BQZ A;  1MUF A;  5JIY A;  2W5Z A;  5F6K C;  5JHN A;  1O9S A;  3M56 A;  3CBM A;  3OXG A;  3PDN A;  3OOI A;  1ZKK A;  4J83 A;  1XQH A;  4O6F A;  5KJN A;  3MEK A;  5ARF A;  5EX0 A;  1N6C A;  4YPE A;  3IHX A;  3F9Z A;  3VV0 A;  5KJM A;  3F9W A;  4NVQ A;  5TEG A;  5TTF A;  5EX3 A;  2RFI A;  5KJL A; 
#chains in the Genus database with same CATH homology
 3RIB A;  3QWP A;  1N3J A;  2JV0 A;  3CBP A;  4BUP A;  4YNP A;  4MI0 A;  4QEP A;  3KMJ A;  3EP0 A;  5TH7 A;  5CCM A;  3M54 A;  3F9Y A;  5F5E A;  5CPR B;  2F69 A;  1MVH A;  4J7I A;  5T0M A;  3S7J A;  3S7F A;  4JDS A;  4NJ5 A;  3KMT A;  4QEN A;  3MO2 A;  3N71 A;  4RZ0 A;  4J8O A;  4JLG A;  3OXL A;  4E47 A;  3S7B A;  3M55 A;  3RQ4 A;  4AU7 A;  3VUZ A;  4C1Q A;  4YND A;  3BO5 A;  3MO0 A;  3RU0 A;  3S8P A;  4FMU A;  3M58 A;  3DAL A;  3OXF A;  3HNA A;  3M57 A;  3TG5 A;  5EG2 A;  4Z4P A;  5F6L A;  3SW9 A;  5T5G A;  1PEG A;  5HQ8 A;  3FPD A;  1MVX A;  5JIN A;  3OS5 A;  3QWW A;  3CBO A;  3M59 A;  4YPU A;  3DB5 A;  3TG4 A;  4IJ8 A;  4YNM A;  3QWV A;  4QEO A;  2W5Y A;  1ML9 A;  3K5K A;  5JJ0 A;  2IGQ A;  3MO5 A;  1MT6 A;  3M53 A;  5ARG A;  4WUY A;  5LSX A;  3RAY A;  3RJW A;  5CCL A;  2QPW A;  5F59 A;  2R3A A;  4O30 A;  4MI5 A;  2G46 A;  3KMA A;  5LSZ A;  1N6A A;  4LDG A;  4I51 A;  5KJK A;  2O8J A;  3SWC A;  4H12 A;  3S7D A;  5T0K A;  3F9X A;  1H3I A;  3OPE A;  4J7F A;  5AYF A;  4YPA A;  5HI7 A;  4IJD A;  3M5A A;  2BQZ A;  1MUF A;  5JIY A;  2W5Z A;  5F6K C;  5JHN A;  1O9S A;  3M56 A;  3CBM A;  3OXG A;  3PDN A;  3OOI A;  1ZKK A;  4J83 A;  1XQH A;  4O6F A;  5KJN A;  3MEK A;  5ARF A;  5EX0 A;  1N6C A;  4YPE A;  3IHX A;  3F9Z A;  3VV0 A;  5KJM A;  3F9W A;  4NVQ A;  5TEG A;  5TTF A;  5EX3 A;  2RFI A;  5KJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...