2W5ZA

Ternary complex of the mixed lineage leukaemia (mll1) set domain with the cofactor product s-adenosylhomocysteine and histone peptide.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
180
structure length
180
Chain Sequence
EYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HISTONE-LYSINE N-METHYLTRANSFERASE HRX
publication title Structural Basis for the Requirement of Additional Factors for Mll1 Set Domain Activity and Recognition of Epigenetic Marks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 48
structure length 180
sequence length 180
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2w5zA01
3SW9A 2W5YA 4MI5A 3PDNA 5EX0A 3M53A 4J7FA 1MUFA 4E47A 3MEKA 1ZKKA 3TG5A 5HI7A 3MO2A 5AYFA 4YPUA 3SWCA 3EP0A 3S8PA 5LSZA 3DALA 3S7FA 3K5KA 3FPDA 1ML9A 4IJ8A 4O30A 5CCLA 3RQ4A 4AU7A 4QEOA 3KMTA 5F6KC 5T0MA 3M57A 3DB5A 1MVHA 4J83A 3OPEA 5T5GA 4H12A 3RIBA 4J7IA 3M59A 3HNAA 5JHNA 5TTFA 2IGQA 3M55A 4JLGA 2G46A 4YNMA 5KJMA 3OXGA 4BUPA 5F6LA 3MO5A 3OOIA 4RZ0A 5TEGA 3IHXA 3RU0A 5KJLA 3RAYA 4Z4PA 4WUYA 4NJ5A 5F5EA 4JDSA 4QENA 1N3JA 3S7JA 4YPEA 5ARGA 2BQZA 4FMUA 5JIYA 2QPWA 4YPAA 3F9ZA 2RFIA 2W5ZA 3VV0A 5EG2A 3CBMA 5KJNA 5TH7A 3KMAA 3S7DA 5HQ8A 4NVQA 4QEPA 3F9WA 5CPRB 3F9XA 1MT6A 3S7BA 2R3AA 3RJWA 3OS5A 4J8OA 3M5AA 2O8JA 3CBOA 4O6FA 3N71A 4C1QA 5LSXA 1N6AA 3TG4A 2F69A 3MO0A 4MI0A 3BO5A 4YNDA 1XQHA 1N6CA 1H3IA 4I51A 4IJDA 2JV0A 3CBPA 5CCMA 5KJKA 1MVXA 4YNPA 3M58A 5JINA 3QWPA 3M56A 3M54A 1PEGA 5EX3A 3QWVA 5ARFA 3OXFA 5JJ0A 3OXLA 5F59A 4LDGA 1O9SA 3QWWA 5T0KA 3KMJA 3VUZA 3F9YA
chains in the Genus database with same CATH superfamily
3SW9A 2W5YA 4MI5A 3PDNA 5EX0A 3M53A 4J7FA 1MUFA 4E47A 3MEKA 1ZKKA 3TG5A 5HI7A 3MO2A 5AYFA 4YPUA 3SWCA 3EP0A 3S8PA 5LSZA 3DALA 3S7FA 3K5KA 3FPDA 1ML9A 4IJ8A 4O30A 5CCLA 3RQ4A 4AU7A 4QEOA 3KMTA 5F6KC 5T0MA 3M57A 3DB5A 1MVHA 4J83A 3OPEA 5T5GA 4H12A 3RIBA 4J7IA 3M59A 3HNAA 5JHNA 5TTFA 2IGQA 3M55A 4JLGA 2G46A 4YNMA 5KJMA 3OXGA 4BUPA 5F6LA 3MO5A 3OOIA 4RZ0A 5TEGA 3IHXA 3RU0A 5KJLA 3RAYA 4Z4PA 4WUYA 4NJ5A 5F5EA 4JDSA 4QENA 1N3JA 3S7JA 4YPEA 5ARGA 2BQZA 4FMUA 5JIYA 2QPWA 4YPAA 3F9ZA 2RFIA 2W5ZA 3VV0A 5EG2A 3CBMA 5KJNA 5TH7A 3KMAA 3S7DA 5HQ8A 4NVQA 4QEPA 3F9WA 5CPRB 3F9XA 1MT6A 3S7BA 2R3AA 3RJWA 3OS5A 4J8OA 3M5AA 2O8JA 3CBOA 4O6FA 3N71A 4C1QA 5LSXA 1N6AA 3TG4A 2F69A 3MO0A 4MI0A 3BO5A 4YNDA 1XQHA 1N6CA 1H3IA 4I51A 4IJDA 2JV0A 3CBPA 5CCMA 5KJKA 1MVXA 4YNPA 3M58A 5JINA 3QWPA 3M56A 3M54A 1PEGA 5EX3A 3QWVA 5ARFA 3OXFA 5JJ0A 3OXLA 5F59A 4LDGA 1O9SA 3QWWA 5T0KA 3KMJA 3VUZA 3F9YA
chains in the Genus database with same CATH topology
3SW9A 2W5YA 4MI5A 3PDNA 5EX0A 3M53A 4J7FA 1MUFA 4E47A 3MEKA 1ZKKA 3TG5A 5HI7A 3MO2A 5AYFA 4YPUA 3SWCA 3EP0A 3S8PA 5LSZA 3DALA 3S7FA 3K5KA 3FPDA 1ML9A 4IJ8A 4O30A 5CCLA 3RQ4A 4AU7A 4QEOA 3KMTA 5F6KC 5T0MA 3M57A 3DB5A 1MVHA 4J83A 3OPEA 5T5GA 4H12A 3RIBA 4J7IA 3M59A 3HNAA 5JHNA 5TTFA 2IGQA 3M55A 4JLGA 2G46A 4YNMA 5KJMA 3OXGA 4BUPA 5F6LA 3MO5A 3OOIA 4RZ0A 5TEGA 3IHXA 3RU0A 5KJLA 3RAYA 4Z4PA 4WUYA 4NJ5A 5F5EA 4JDSA 4QENA 1N3JA 3S7JA 4YPEA 5ARGA 2BQZA 4FMUA 5JIYA 2QPWA 4YPAA 3F9ZA 2RFIA 2W5ZA 3VV0A 5EG2A 3CBMA 5KJNA 5TH7A 3KMAA 3S7DA 5HQ8A 4NVQA 4QEPA 3F9WA 5CPRB 3F9XA 1MT6A 3S7BA 2R3AA 3RJWA 3OS5A 4J8OA 3M5AA 2O8JA 3CBOA 4O6FA 3N71A 4C1QA 5LSXA 1N6AA 3TG4A 2F69A 3MO0A 4MI0A 3BO5A 4YNDA 1XQHA 1N6CA 1H3IA 4I51A 4IJDA 2JV0A 3CBPA 5CCMA 5KJKA 1MVXA 4YNPA 3M58A 5JINA 3QWPA 3M56A 3M54A 1PEGA 5EX3A 3QWVA 5ARFA 3OXFA 5JJ0A 3OXLA 5F59A 4LDGA 1O9SA 3QWWA 5T0KA 3KMJA 3VUZA 3F9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SW9 A;  2W5Y A;  4MI5 A;  3PDN A;  5EX0 A;  3M53 A;  4J7F A;  1MUF A;  4E47 A;  3MEK A;  1ZKK A;  3TG5 A;  5HI7 A;  3MO2 A;  5AYF A;  4YPU A;  3SWC A;  3EP0 A;  3S8P A;  5LSZ A;  3DAL A;  3S7F A;  3K5K A;  3FPD A;  1ML9 A;  4IJ8 A;  4O30 A;  5CCL A;  3RQ4 A;  4AU7 A;  4QEO A;  3KMT A;  5F6K C;  5T0M A;  3M57 A;  3DB5 A;  1MVH A;  4J83 A;  3OPE A;  5T5G A;  4H12 A;  3RIB A;  4J7I A;  3M59 A;  3HNA A;  5JHN A;  5TTF A;  2IGQ A;  3M55 A;  4JLG A;  2G46 A;  4YNM A;  5KJM A;  3OXG A;  4BUP A;  5F6L A;  3MO5 A;  3OOI A;  4RZ0 A;  5TEG A;  3IHX A;  3RU0 A;  5KJL A;  3RAY A;  4Z4P A;  4WUY A;  4NJ5 A;  5F5E A;  4JDS A;  4QEN A;  1N3J A;  3S7J A;  4YPE A;  5ARG A;  2BQZ A;  4FMU A;  5JIY A;  2QPW A;  4YPA A;  3F9Z A;  2RFI A;  2W5Z A;  3VV0 A;  5EG2 A;  3CBM A;  5KJN A;  5TH7 A;  3KMA A;  3S7D A;  5HQ8 A;  4NVQ A;  4QEP A;  3F9W A;  5CPR B;  3F9X A;  1MT6 A;  3S7B A;  2R3A A;  3RJW A;  3OS5 A;  4J8O A;  3M5A A;  2O8J A;  3CBO A;  4O6F A;  3N71 A;  4C1Q A;  5LSX A;  1N6A A;  3TG4 A;  2F69 A;  3MO0 A;  4MI0 A;  3BO5 A;  4YND A;  1XQH A;  1N6C A;  1H3I A;  4I51 A;  4IJD A;  2JV0 A;  3CBP A;  5CCM A;  5KJK A;  1MVX A;  4YNP A;  3M58 A;  5JIN A;  3QWP A;  3M56 A;  3M54 A;  1PEG A;  5EX3 A;  3QWV A;  5ARF A;  3OXF A;  5JJ0 A;  3OXL A;  5F59 A;  4LDG A;  1O9S A;  3QWW A;  5T0K A;  3KMJ A;  3VUZ A;  3F9Y A; 
#chains in the Genus database with same CATH topology
 3SW9 A;  2W5Y A;  4MI5 A;  3PDN A;  5EX0 A;  3M53 A;  4J7F A;  1MUF A;  4E47 A;  3MEK A;  1ZKK A;  3TG5 A;  5HI7 A;  3MO2 A;  5AYF A;  4YPU A;  3SWC A;  3EP0 A;  3S8P A;  5LSZ A;  3DAL A;  3S7F A;  3K5K A;  3FPD A;  1ML9 A;  4IJ8 A;  4O30 A;  5CCL A;  3RQ4 A;  4AU7 A;  4QEO A;  3KMT A;  5F6K C;  5T0M A;  3M57 A;  3DB5 A;  1MVH A;  4J83 A;  3OPE A;  5T5G A;  4H12 A;  3RIB A;  4J7I A;  3M59 A;  3HNA A;  5JHN A;  5TTF A;  2IGQ A;  3M55 A;  4JLG A;  2G46 A;  4YNM A;  5KJM A;  3OXG A;  4BUP A;  5F6L A;  3MO5 A;  3OOI A;  4RZ0 A;  5TEG A;  3IHX A;  3RU0 A;  5KJL A;  3RAY A;  4Z4P A;  4WUY A;  4NJ5 A;  5F5E A;  4JDS A;  4QEN A;  1N3J A;  3S7J A;  4YPE A;  5ARG A;  2BQZ A;  4FMU A;  5JIY A;  2QPW A;  4YPA A;  3F9Z A;  2RFI A;  2W5Z A;  3VV0 A;  5EG2 A;  3CBM A;  5KJN A;  5TH7 A;  3KMA A;  3S7D A;  5HQ8 A;  4NVQ A;  4QEP A;  3F9W A;  5CPR B;  3F9X A;  1MT6 A;  3S7B A;  2R3A A;  3RJW A;  3OS5 A;  4J8O A;  3M5A A;  2O8J A;  3CBO A;  4O6F A;  3N71 A;  4C1Q A;  5LSX A;  1N6A A;  3TG4 A;  2F69 A;  3MO0 A;  4MI0 A;  3BO5 A;  4YND A;  1XQH A;  1N6C A;  1H3I A;  4I51 A;  4IJD A;  2JV0 A;  3CBP A;  5CCM A;  5KJK A;  1MVX A;  4YNP A;  3M58 A;  5JIN A;  3QWP A;  3M56 A;  3M54 A;  1PEG A;  5EX3 A;  3QWV A;  5ARF A;  3OXF A;  5JJ0 A;  3OXL A;  5F59 A;  4LDG A;  1O9S A;  3QWW A;  5T0K A;  3KMJ A;  3VUZ A;  3F9Y A; 
#chains in the Genus database with same CATH homology
 3SW9 A;  2W5Y A;  4MI5 A;  3PDN A;  5EX0 A;  3M53 A;  4J7F A;  1MUF A;  4E47 A;  3MEK A;  1ZKK A;  3TG5 A;  5HI7 A;  3MO2 A;  5AYF A;  4YPU A;  3SWC A;  3EP0 A;  3S8P A;  5LSZ A;  3DAL A;  3S7F A;  3K5K A;  3FPD A;  1ML9 A;  4IJ8 A;  4O30 A;  5CCL A;  3RQ4 A;  4AU7 A;  4QEO A;  3KMT A;  5F6K C;  5T0M A;  3M57 A;  3DB5 A;  1MVH A;  4J83 A;  3OPE A;  5T5G A;  4H12 A;  3RIB A;  4J7I A;  3M59 A;  3HNA A;  5JHN A;  5TTF A;  2IGQ A;  3M55 A;  4JLG A;  2G46 A;  4YNM A;  5KJM A;  3OXG A;  4BUP A;  5F6L A;  3MO5 A;  3OOI A;  4RZ0 A;  5TEG A;  3IHX A;  3RU0 A;  5KJL A;  3RAY A;  4Z4P A;  4WUY A;  4NJ5 A;  5F5E A;  4JDS A;  4QEN A;  1N3J A;  3S7J A;  4YPE A;  5ARG A;  2BQZ A;  4FMU A;  5JIY A;  2QPW A;  4YPA A;  3F9Z A;  2RFI A;  2W5Z A;  3VV0 A;  5EG2 A;  3CBM A;  5KJN A;  5TH7 A;  3KMA A;  3S7D A;  5HQ8 A;  4NVQ A;  4QEP A;  3F9W A;  5CPR B;  3F9X A;  1MT6 A;  3S7B A;  2R3A A;  3RJW A;  3OS5 A;  4J8O A;  3M5A A;  2O8J A;  3CBO A;  4O6F A;  3N71 A;  4C1Q A;  5LSX A;  1N6A A;  3TG4 A;  2F69 A;  3MO0 A;  4MI0 A;  3BO5 A;  4YND A;  1XQH A;  1N6C A;  1H3I A;  4I51 A;  4IJD A;  2JV0 A;  3CBP A;  5CCM A;  5KJK A;  1MVX A;  4YNP A;  3M58 A;  5JIN A;  3QWP A;  3M56 A;  3M54 A;  1PEG A;  5EX3 A;  3QWV A;  5ARF A;  3OXF A;  5JJ0 A;  3OXL A;  5F59 A;  4LDG A;  1O9S A;  3QWW A;  5T0K A;  3KMJ A;  3VUZ A;  3F9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...