2W5ZA

Ternary complex of the mixed lineage leukaemia (mll1) set domain with the cofactor product s-adenosylhomocysteine and histone peptide.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
180
structure length
180
Chain Sequence
b'EYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HISTONE-LYSINE N-METHYLTRANSFERASE HRX
publication title Structural Basis for the Requirement of Additional Factors for Mll1 Set Domain Activity and Recognition of Epigenetic Marks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 48
structure length 180
sequence length 180
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2w5zA01
4YPEA 4YNPA 3RAYA 5T0MA 3VUZA 5T5GA 2R3AA 4J83A 5CPRB 4MI5A 5ARFA 5TH7A 3S7FA 5LSZA 1O9SA 5EX0A 4FMUA 1N6AA 4WUYA 1MUFA 3CBPA 3M54A 4J8OA 5EX3A 5JHNA 5EG2A 4O6FA 4AU7A 5HQ8A 4QEOA 3QWVA 4RZ0A 4C1QA 3QWWA 1PEGA 5F5EA 5JJ0A 3S7JA 3F9ZA 4E47A 3OXFA 1MVXA 1N3JA 1ZKKA 3DB5A 3M53A 4NJ5A 3CBOA 3M58A 4O30A 3OOIA 3FPDA 1N6CA 4MI0A 3RU0A 3QWPA 3MO0A 2JV0A 3EP0A 3M59A 4J7IA 3CBMA 3S7DA 2F69A 5JIYA 2IGQA 4LDGA 5ARGA 3RJWA 3F9YA 2W5YA 4IJDA 4JLGA 3RIBA 3OXLA 3RQ4A 3DALA 3OS5A 3PDNA 3MEKA 3MO5A 5CCMA 5F6KC 4QEPA 3M55A 3KMAA 3N71A 3BO5A 4QENA 3S7BA 5CCLA 3KMTA 5TTFA 3TG4A 5F59A 2O8JA 5LSXA 3SW9A 3VV0A 1ML9A 3TG5A 4YPUA 4YNMA 3HNAA 1H3IA 4H12A 2BQZA 2G46A 5AYFA 5KJKA 2RFIA 2W5ZA 3F9WA 3SWCA 2QPWA 4BUPA 3MO2A 3K5KA 3F9XA 1MVHA 5F6LA 3M57A 3S8PA 4IJ8A 3KMJA 5KJNA 5KJMA 4J7FA 3M56A 4YPAA 1XQHA 4I51A 5T0KA 4NVQA 4YNDA 4Z4PA 4JDSA 3IHXA 3OXGA 5TEGA 1MT6A 3OPEA 5HI7A 5KJLA 5JINA 3M5AA
chains in the Genus database with same CATH superfamily
4YPEA 4YNPA 3RAYA 5T0MA 3VUZA 5T5GA 2R3AA 4J83A 5CPRB 4MI5A 5ARFA 5TH7A 3S7FA 5LSZA 1O9SA 5EX0A 4FMUA 1N6AA 4WUYA 1MUFA 3CBPA 3M54A 4J8OA 5EX3A 5JHNA 5EG2A 4O6FA 4AU7A 5HQ8A 4QEOA 3QWVA 4RZ0A 4C1QA 3QWWA 1PEGA 5F5EA 5JJ0A 3S7JA 3F9ZA 4E47A 3OXFA 1MVXA 1N3JA 1ZKKA 3DB5A 3M53A 4NJ5A 3CBOA 3M58A 4O30A 3OOIA 3FPDA 1N6CA 4MI0A 3RU0A 3QWPA 3MO0A 2JV0A 3EP0A 3M59A 4J7IA 3CBMA 3S7DA 2F69A 5JIYA 2IGQA 4LDGA 5ARGA 3RJWA 3F9YA 2W5YA 4IJDA 4JLGA 3RIBA 3OXLA 3RQ4A 3DALA 3OS5A 3PDNA 3MEKA 3MO5A 5CCMA 5F6KC 4QEPA 3M55A 3KMAA 3N71A 3BO5A 4QENA 3S7BA 5CCLA 3KMTA 5TTFA 3TG4A 5F59A 2O8JA 5LSXA 3SW9A 3VV0A 1ML9A 3TG5A 4YPUA 4YNMA 3HNAA 1H3IA 4H12A 2BQZA 2G46A 5AYFA 5KJKA 2RFIA 2W5ZA 3F9WA 3SWCA 2QPWA 4BUPA 3MO2A 3K5KA 3F9XA 1MVHA 5F6LA 3M57A 3S8PA 4IJ8A 3KMJA 5KJNA 5KJMA 4J7FA 3M56A 4YPAA 1XQHA 4I51A 5T0KA 4NVQA 4YNDA 4Z4PA 4JDSA 3IHXA 3OXGA 5TEGA 1MT6A 3OPEA 5HI7A 5KJLA 5JINA 3M5AA
chains in the Genus database with same CATH topology
4YPEA 4YNPA 3RAYA 5T0MA 3VUZA 5T5GA 2R3AA 4J83A 5CPRB 4MI5A 5ARFA 5TH7A 3S7FA 5LSZA 1O9SA 5EX0A 4FMUA 1N6AA 4WUYA 1MUFA 3CBPA 3M54A 4J8OA 5EX3A 5JHNA 5EG2A 4O6FA 4AU7A 5HQ8A 4QEOA 3QWVA 4RZ0A 4C1QA 3QWWA 1PEGA 5F5EA 5JJ0A 3S7JA 3F9ZA 4E47A 3OXFA 1MVXA 1N3JA 1ZKKA 3DB5A 3M53A 4NJ5A 3CBOA 3M58A 4O30A 3OOIA 3FPDA 1N6CA 4MI0A 3RU0A 3QWPA 3MO0A 2JV0A 3EP0A 3M59A 4J7IA 3CBMA 3S7DA 2F69A 5JIYA 2IGQA 4LDGA 5ARGA 3RJWA 3F9YA 2W5YA 4IJDA 4JLGA 3RIBA 3OXLA 3RQ4A 3DALA 3OS5A 3PDNA 3MEKA 3MO5A 5CCMA 5F6KC 4QEPA 3M55A 3KMAA 3N71A 3BO5A 4QENA 3S7BA 5CCLA 3KMTA 5TTFA 3TG4A 5F59A 2O8JA 5LSXA 3SW9A 3VV0A 1ML9A 3TG5A 4YPUA 4YNMA 3HNAA 1H3IA 4H12A 2BQZA 2G46A 5AYFA 5KJKA 2RFIA 2W5ZA 3F9WA 3SWCA 2QPWA 4BUPA 3MO2A 3K5KA 3F9XA 1MVHA 5F6LA 3M57A 3S8PA 4IJ8A 3KMJA 5KJNA 5KJMA 4J7FA 3M56A 4YPAA 1XQHA 4I51A 5T0KA 4NVQA 4YNDA 4Z4PA 4JDSA 3IHXA 3OXGA 5TEGA 1MT6A 3OPEA 5HI7A 5KJLA 5JINA 3M5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YPE A;  4YNP A;  3RAY A;  5T0M A;  3VUZ A;  5T5G A;  2R3A A;  4J83 A;  5CPR B;  4MI5 A;  5ARF A;  5TH7 A;  3S7F A;  5LSZ A;  1O9S A;  5EX0 A;  4FMU A;  1N6A A;  4WUY A;  1MUF A;  3CBP A;  3M54 A;  4J8O A;  5EX3 A;  5JHN A;  5EG2 A;  4O6F A;  4AU7 A;  5HQ8 A;  4QEO A;  3QWV A;  4RZ0 A;  4C1Q A;  3QWW A;  1PEG A;  5F5E A;  5JJ0 A;  3S7J A;  3F9Z A;  4E47 A;  3OXF A;  1MVX A;  1N3J A;  1ZKK A;  3DB5 A;  3M53 A;  4NJ5 A;  3CBO A;  3M58 A;  4O30 A;  3OOI A;  3FPD A;  1N6C A;  4MI0 A;  3RU0 A;  3QWP A;  3MO0 A;  2JV0 A;  3EP0 A;  3M59 A;  4J7I A;  3CBM A;  3S7D A;  2F69 A;  5JIY A;  2IGQ A;  4LDG A;  5ARG A;  3RJW A;  3F9Y A;  2W5Y A;  4IJD A;  4JLG A;  3RIB A;  3OXL A;  3RQ4 A;  3DAL A;  3OS5 A;  3PDN A;  3MEK A;  3MO5 A;  5CCM A;  5F6K C;  4QEP A;  3M55 A;  3KMA A;  3N71 A;  3BO5 A;  4QEN A;  3S7B A;  5CCL A;  3KMT A;  5TTF A;  3TG4 A;  5F59 A;  2O8J A;  5LSX A;  3SW9 A;  3VV0 A;  1ML9 A;  3TG5 A;  4YPU A;  4YNM A;  3HNA A;  1H3I A;  4H12 A;  2BQZ A;  2G46 A;  5AYF A;  5KJK A;  2RFI A;  2W5Z A;  3F9W A;  3SWC A;  2QPW A;  4BUP A;  3MO2 A;  3K5K A;  3F9X A;  1MVH A;  5F6L A;  3M57 A;  3S8P A;  4IJ8 A;  3KMJ A;  5KJN A;  5KJM A;  4J7F A;  3M56 A;  4YPA A;  1XQH A;  4I51 A;  5T0K A;  4NVQ A;  4YND A;  4Z4P A;  4JDS A;  3IHX A;  3OXG A;  5TEG A;  1MT6 A;  3OPE A;  5HI7 A;  5KJL A;  5JIN A;  3M5A A; 
#chains in the Genus database with same CATH topology
 4YPE A;  4YNP A;  3RAY A;  5T0M A;  3VUZ A;  5T5G A;  2R3A A;  4J83 A;  5CPR B;  4MI5 A;  5ARF A;  5TH7 A;  3S7F A;  5LSZ A;  1O9S A;  5EX0 A;  4FMU A;  1N6A A;  4WUY A;  1MUF A;  3CBP A;  3M54 A;  4J8O A;  5EX3 A;  5JHN A;  5EG2 A;  4O6F A;  4AU7 A;  5HQ8 A;  4QEO A;  3QWV A;  4RZ0 A;  4C1Q A;  3QWW A;  1PEG A;  5F5E A;  5JJ0 A;  3S7J A;  3F9Z A;  4E47 A;  3OXF A;  1MVX A;  1N3J A;  1ZKK A;  3DB5 A;  3M53 A;  4NJ5 A;  3CBO A;  3M58 A;  4O30 A;  3OOI A;  3FPD A;  1N6C A;  4MI0 A;  3RU0 A;  3QWP A;  3MO0 A;  2JV0 A;  3EP0 A;  3M59 A;  4J7I A;  3CBM A;  3S7D A;  2F69 A;  5JIY A;  2IGQ A;  4LDG A;  5ARG A;  3RJW A;  3F9Y A;  2W5Y A;  4IJD A;  4JLG A;  3RIB A;  3OXL A;  3RQ4 A;  3DAL A;  3OS5 A;  3PDN A;  3MEK A;  3MO5 A;  5CCM A;  5F6K C;  4QEP A;  3M55 A;  3KMA A;  3N71 A;  3BO5 A;  4QEN A;  3S7B A;  5CCL A;  3KMT A;  5TTF A;  3TG4 A;  5F59 A;  2O8J A;  5LSX A;  3SW9 A;  3VV0 A;  1ML9 A;  3TG5 A;  4YPU A;  4YNM A;  3HNA A;  1H3I A;  4H12 A;  2BQZ A;  2G46 A;  5AYF A;  5KJK A;  2RFI A;  2W5Z A;  3F9W A;  3SWC A;  2QPW A;  4BUP A;  3MO2 A;  3K5K A;  3F9X A;  1MVH A;  5F6L A;  3M57 A;  3S8P A;  4IJ8 A;  3KMJ A;  5KJN A;  5KJM A;  4J7F A;  3M56 A;  4YPA A;  1XQH A;  4I51 A;  5T0K A;  4NVQ A;  4YND A;  4Z4P A;  4JDS A;  3IHX A;  3OXG A;  5TEG A;  1MT6 A;  3OPE A;  5HI7 A;  5KJL A;  5JIN A;  3M5A A; 
#chains in the Genus database with same CATH homology
 4YPE A;  4YNP A;  3RAY A;  5T0M A;  3VUZ A;  5T5G A;  2R3A A;  4J83 A;  5CPR B;  4MI5 A;  5ARF A;  5TH7 A;  3S7F A;  5LSZ A;  1O9S A;  5EX0 A;  4FMU A;  1N6A A;  4WUY A;  1MUF A;  3CBP A;  3M54 A;  4J8O A;  5EX3 A;  5JHN A;  5EG2 A;  4O6F A;  4AU7 A;  5HQ8 A;  4QEO A;  3QWV A;  4RZ0 A;  4C1Q A;  3QWW A;  1PEG A;  5F5E A;  5JJ0 A;  3S7J A;  3F9Z A;  4E47 A;  3OXF A;  1MVX A;  1N3J A;  1ZKK A;  3DB5 A;  3M53 A;  4NJ5 A;  3CBO A;  3M58 A;  4O30 A;  3OOI A;  3FPD A;  1N6C A;  4MI0 A;  3RU0 A;  3QWP A;  3MO0 A;  2JV0 A;  3EP0 A;  3M59 A;  4J7I A;  3CBM A;  3S7D A;  2F69 A;  5JIY A;  2IGQ A;  4LDG A;  5ARG A;  3RJW A;  3F9Y A;  2W5Y A;  4IJD A;  4JLG A;  3RIB A;  3OXL A;  3RQ4 A;  3DAL A;  3OS5 A;  3PDN A;  3MEK A;  3MO5 A;  5CCM A;  5F6K C;  4QEP A;  3M55 A;  3KMA A;  3N71 A;  3BO5 A;  4QEN A;  3S7B A;  5CCL A;  3KMT A;  5TTF A;  3TG4 A;  5F59 A;  2O8J A;  5LSX A;  3SW9 A;  3VV0 A;  1ML9 A;  3TG5 A;  4YPU A;  4YNM A;  3HNA A;  1H3I A;  4H12 A;  2BQZ A;  2G46 A;  5AYF A;  5KJK A;  2RFI A;  2W5Z A;  3F9W A;  3SWC A;  2QPW A;  4BUP A;  3MO2 A;  3K5K A;  3F9X A;  1MVH A;  5F6L A;  3M57 A;  3S8P A;  4IJ8 A;  3KMJ A;  5KJN A;  5KJM A;  4J7F A;  3M56 A;  4YPA A;  1XQH A;  4I51 A;  5T0K A;  4NVQ A;  4YND A;  4Z4P A;  4JDS A;  3IHX A;  3OXG A;  5TEG A;  1MT6 A;  3OPE A;  5HI7 A;  5KJL A;  5JIN A;  3M5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...