2W5ZA

Ternary complex of the mixed lineage leukaemia (mll1) set domain with the cofactor product s-adenosylhomocysteine and histone peptide.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
180
structure length
180
Chain Sequence
EYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HISTONE-LYSINE N-METHYLTRANSFERASE HRX
publication title Structural Basis for the Requirement of Additional Factors for Mll1 Set Domain Activity and Recognition of Epigenetic Marks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 48
structure length 180
sequence length 180
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2w5zA01
3SW9A 5KJLA 3KMAA 5ARFA 4E47A 5JJ0A 3MO0A 3K5KA 2R3AA 3N71A 3OPEA 4C1QA 5ARGA 4O30A 3F9YA 3F9XA 1N6AA 3RJWA 2JV0A 3OXGA 2IGQA 2G46A 4IJDA 5HQ8A 4YPAA 3M58A 5CPRB 5KJMA 3HNAA 3BO5A 5KJNA 4Z4PA 3FPDA 1ZKKA 5CCMA 3CBPA 3KMJA 3M54A 4NVQA 2QPWA 4H12A 3TG5A 3M53A 5JINA 1N3JA 5LSXA 4YNPA 4YPUA 5AYFA 3QWVA 4QEPA 5LSZA 4J8OA 1ML9A 3OOIA 3QWWA 4JLGA 1MT6A 3M56A 3RAYA 3MO5A 5TH7A 4NJ5A 3DALA 2W5ZA 2O8JA 2F69A 5T0MA 1MVXA 3OXLA 4WUYA 3M57A 3RQ4A 3IHXA 3M5AA 1H3IA 3OS5A 3TG4A 5TEGA 3QWPA 5EX0A 4J83A 3M55A 5T0KA 5CCLA 5F6KC 3EP0A 4IJ8A 1N6CA 1XQHA 1O9SA 5F5EA 4BUPA 5EX3A 4QEOA 3VV0A 1MUFA 4O6FA 4RZ0A 3OXFA 4JDSA 4YPEA 4J7FA 3DB5A 3RIBA 3SWCA 5HI7A 5EG2A 4AU7A 1MVHA 3MEKA 4FMUA 3S8PA 3VUZA 3S7DA 2RFIA 3S7JA 1PEGA 3CBOA 5JIYA 3F9WA 3RU0A 5KJKA 5TTFA 4J7IA 4LDGA 5F59A 4QENA 2BQZA 3CBMA 3S7FA 3F9ZA 4I51A 4YNDA 3KMTA 3M59A 5T5GA 3S7BA 5JHNA 4MI5A 5F6LA 3MO2A 3PDNA 2W5YA 4MI0A 4YNMA
chains in the Genus database with same CATH superfamily
3SW9A 5KJLA 3KMAA 5ARFA 4E47A 5JJ0A 3MO0A 3K5KA 2R3AA 3N71A 3OPEA 4C1QA 5ARGA 4O30A 3F9YA 3F9XA 1N6AA 3RJWA 2JV0A 3OXGA 2IGQA 2G46A 4IJDA 5HQ8A 4YPAA 3M58A 5CPRB 5KJMA 3HNAA 3BO5A 5KJNA 4Z4PA 3FPDA 1ZKKA 5CCMA 3CBPA 3KMJA 3M54A 4NVQA 2QPWA 4H12A 3TG5A 3M53A 5JINA 1N3JA 5LSXA 4YNPA 4YPUA 5AYFA 3QWVA 4QEPA 5LSZA 4J8OA 1ML9A 3OOIA 3QWWA 4JLGA 1MT6A 3M56A 3RAYA 3MO5A 5TH7A 4NJ5A 3DALA 2W5ZA 2O8JA 2F69A 5T0MA 1MVXA 3OXLA 4WUYA 3M57A 3RQ4A 3IHXA 3M5AA 1H3IA 3OS5A 3TG4A 5TEGA 3QWPA 5EX0A 4J83A 3M55A 5T0KA 5CCLA 5F6KC 3EP0A 4IJ8A 1N6CA 1XQHA 1O9SA 5F5EA 4BUPA 5EX3A 4QEOA 3VV0A 1MUFA 4O6FA 4RZ0A 3OXFA 4JDSA 4YPEA 4J7FA 3DB5A 3RIBA 3SWCA 5HI7A 5EG2A 4AU7A 1MVHA 3MEKA 4FMUA 3S8PA 3VUZA 3S7DA 2RFIA 3S7JA 1PEGA 3CBOA 5JIYA 3F9WA 3RU0A 5KJKA 5TTFA 4J7IA 4LDGA 5F59A 4QENA 2BQZA 3CBMA 3S7FA 3F9ZA 4I51A 4YNDA 3KMTA 3M59A 5T5GA 3S7BA 5JHNA 4MI5A 5F6LA 3MO2A 3PDNA 2W5YA 4MI0A 4YNMA
chains in the Genus database with same CATH topology
3SW9A 5KJLA 3KMAA 5ARFA 4E47A 5JJ0A 3MO0A 3K5KA 2R3AA 3N71A 3OPEA 4C1QA 5ARGA 4O30A 3F9YA 3F9XA 1N6AA 3RJWA 2JV0A 3OXGA 2IGQA 2G46A 4IJDA 5HQ8A 4YPAA 3M58A 5CPRB 5KJMA 3HNAA 3BO5A 5KJNA 4Z4PA 3FPDA 1ZKKA 5CCMA 3CBPA 3KMJA 3M54A 4NVQA 2QPWA 4H12A 3TG5A 3M53A 5JINA 1N3JA 5LSXA 4YNPA 4YPUA 5AYFA 3QWVA 4QEPA 5LSZA 4J8OA 1ML9A 3OOIA 3QWWA 4JLGA 1MT6A 3M56A 3RAYA 3MO5A 5TH7A 4NJ5A 3DALA 2W5ZA 2O8JA 2F69A 5T0MA 1MVXA 3OXLA 4WUYA 3M57A 3RQ4A 3IHXA 3M5AA 1H3IA 3OS5A 3TG4A 5TEGA 3QWPA 5EX0A 4J83A 3M55A 5T0KA 5CCLA 5F6KC 3EP0A 4IJ8A 1N6CA 1XQHA 1O9SA 5F5EA 4BUPA 5EX3A 4QEOA 3VV0A 1MUFA 4O6FA 4RZ0A 3OXFA 4JDSA 4YPEA 4J7FA 3DB5A 3RIBA 3SWCA 5HI7A 5EG2A 4AU7A 1MVHA 3MEKA 4FMUA 3S8PA 3VUZA 3S7DA 2RFIA 3S7JA 1PEGA 3CBOA 5JIYA 3F9WA 3RU0A 5KJKA 5TTFA 4J7IA 4LDGA 5F59A 4QENA 2BQZA 3CBMA 3S7FA 3F9ZA 4I51A 4YNDA 3KMTA 3M59A 5T5GA 3S7BA 5JHNA 4MI5A 5F6LA 3MO2A 3PDNA 2W5YA 4MI0A 4YNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SW9 A;  5KJL A;  3KMA A;  5ARF A;  4E47 A;  5JJ0 A;  3MO0 A;  3K5K A;  2R3A A;  3N71 A;  3OPE A;  4C1Q A;  5ARG A;  4O30 A;  3F9Y A;  3F9X A;  1N6A A;  3RJW A;  2JV0 A;  3OXG A;  2IGQ A;  2G46 A;  4IJD A;  5HQ8 A;  4YPA A;  3M58 A;  5CPR B;  5KJM A;  3HNA A;  3BO5 A;  5KJN A;  4Z4P A;  3FPD A;  1ZKK A;  5CCM A;  3CBP A;  3KMJ A;  3M54 A;  4NVQ A;  2QPW A;  4H12 A;  3TG5 A;  3M53 A;  5JIN A;  1N3J A;  5LSX A;  4YNP A;  4YPU A;  5AYF A;  3QWV A;  4QEP A;  5LSZ A;  4J8O A;  1ML9 A;  3OOI A;  3QWW A;  4JLG A;  1MT6 A;  3M56 A;  3RAY A;  3MO5 A;  5TH7 A;  4NJ5 A;  3DAL A;  2W5Z A;  2O8J A;  2F69 A;  5T0M A;  1MVX A;  3OXL A;  4WUY A;  3M57 A;  3RQ4 A;  3IHX A;  3M5A A;  1H3I A;  3OS5 A;  3TG4 A;  5TEG A;  3QWP A;  5EX0 A;  4J83 A;  3M55 A;  5T0K A;  5CCL A;  5F6K C;  3EP0 A;  4IJ8 A;  1N6C A;  1XQH A;  1O9S A;  5F5E A;  4BUP A;  5EX3 A;  4QEO A;  3VV0 A;  1MUF A;  4O6F A;  4RZ0 A;  3OXF A;  4JDS A;  4YPE A;  4J7F A;  3DB5 A;  3RIB A;  3SWC A;  5HI7 A;  5EG2 A;  4AU7 A;  1MVH A;  3MEK A;  4FMU A;  3S8P A;  3VUZ A;  3S7D A;  2RFI A;  3S7J A;  1PEG A;  3CBO A;  5JIY A;  3F9W A;  3RU0 A;  5KJK A;  5TTF A;  4J7I A;  4LDG A;  5F59 A;  4QEN A;  2BQZ A;  3CBM A;  3S7F A;  3F9Z A;  4I51 A;  4YND A;  3KMT A;  3M59 A;  5T5G A;  3S7B A;  5JHN A;  4MI5 A;  5F6L A;  3MO2 A;  3PDN A;  2W5Y A;  4MI0 A;  4YNM A; 
#chains in the Genus database with same CATH topology
 3SW9 A;  5KJL A;  3KMA A;  5ARF A;  4E47 A;  5JJ0 A;  3MO0 A;  3K5K A;  2R3A A;  3N71 A;  3OPE A;  4C1Q A;  5ARG A;  4O30 A;  3F9Y A;  3F9X A;  1N6A A;  3RJW A;  2JV0 A;  3OXG A;  2IGQ A;  2G46 A;  4IJD A;  5HQ8 A;  4YPA A;  3M58 A;  5CPR B;  5KJM A;  3HNA A;  3BO5 A;  5KJN A;  4Z4P A;  3FPD A;  1ZKK A;  5CCM A;  3CBP A;  3KMJ A;  3M54 A;  4NVQ A;  2QPW A;  4H12 A;  3TG5 A;  3M53 A;  5JIN A;  1N3J A;  5LSX A;  4YNP A;  4YPU A;  5AYF A;  3QWV A;  4QEP A;  5LSZ A;  4J8O A;  1ML9 A;  3OOI A;  3QWW A;  4JLG A;  1MT6 A;  3M56 A;  3RAY A;  3MO5 A;  5TH7 A;  4NJ5 A;  3DAL A;  2W5Z A;  2O8J A;  2F69 A;  5T0M A;  1MVX A;  3OXL A;  4WUY A;  3M57 A;  3RQ4 A;  3IHX A;  3M5A A;  1H3I A;  3OS5 A;  3TG4 A;  5TEG A;  3QWP A;  5EX0 A;  4J83 A;  3M55 A;  5T0K A;  5CCL A;  5F6K C;  3EP0 A;  4IJ8 A;  1N6C A;  1XQH A;  1O9S A;  5F5E A;  4BUP A;  5EX3 A;  4QEO A;  3VV0 A;  1MUF A;  4O6F A;  4RZ0 A;  3OXF A;  4JDS A;  4YPE A;  4J7F A;  3DB5 A;  3RIB A;  3SWC A;  5HI7 A;  5EG2 A;  4AU7 A;  1MVH A;  3MEK A;  4FMU A;  3S8P A;  3VUZ A;  3S7D A;  2RFI A;  3S7J A;  1PEG A;  3CBO A;  5JIY A;  3F9W A;  3RU0 A;  5KJK A;  5TTF A;  4J7I A;  4LDG A;  5F59 A;  4QEN A;  2BQZ A;  3CBM A;  3S7F A;  3F9Z A;  4I51 A;  4YND A;  3KMT A;  3M59 A;  5T5G A;  3S7B A;  5JHN A;  4MI5 A;  5F6L A;  3MO2 A;  3PDN A;  2W5Y A;  4MI0 A;  4YNM A; 
#chains in the Genus database with same CATH homology
 3SW9 A;  5KJL A;  3KMA A;  5ARF A;  4E47 A;  5JJ0 A;  3MO0 A;  3K5K A;  2R3A A;  3N71 A;  3OPE A;  4C1Q A;  5ARG A;  4O30 A;  3F9Y A;  3F9X A;  1N6A A;  3RJW A;  2JV0 A;  3OXG A;  2IGQ A;  2G46 A;  4IJD A;  5HQ8 A;  4YPA A;  3M58 A;  5CPR B;  5KJM A;  3HNA A;  3BO5 A;  5KJN A;  4Z4P A;  3FPD A;  1ZKK A;  5CCM A;  3CBP A;  3KMJ A;  3M54 A;  4NVQ A;  2QPW A;  4H12 A;  3TG5 A;  3M53 A;  5JIN A;  1N3J A;  5LSX A;  4YNP A;  4YPU A;  5AYF A;  3QWV A;  4QEP A;  5LSZ A;  4J8O A;  1ML9 A;  3OOI A;  3QWW A;  4JLG A;  1MT6 A;  3M56 A;  3RAY A;  3MO5 A;  5TH7 A;  4NJ5 A;  3DAL A;  2W5Z A;  2O8J A;  2F69 A;  5T0M A;  1MVX A;  3OXL A;  4WUY A;  3M57 A;  3RQ4 A;  3IHX A;  3M5A A;  1H3I A;  3OS5 A;  3TG4 A;  5TEG A;  3QWP A;  5EX0 A;  4J83 A;  3M55 A;  5T0K A;  5CCL A;  5F6K C;  3EP0 A;  4IJ8 A;  1N6C A;  1XQH A;  1O9S A;  5F5E A;  4BUP A;  5EX3 A;  4QEO A;  3VV0 A;  1MUF A;  4O6F A;  4RZ0 A;  3OXF A;  4JDS A;  4YPE A;  4J7F A;  3DB5 A;  3RIB A;  3SWC A;  5HI7 A;  5EG2 A;  4AU7 A;  1MVH A;  3MEK A;  4FMU A;  3S8P A;  3VUZ A;  3S7D A;  2RFI A;  3S7J A;  1PEG A;  3CBO A;  5JIY A;  3F9W A;  3RU0 A;  5KJK A;  5TTF A;  4J7I A;  4LDG A;  5F59 A;  4QEN A;  2BQZ A;  3CBM A;  3S7F A;  3F9Z A;  4I51 A;  4YND A;  3KMT A;  3M59 A;  5T5G A;  3S7B A;  5JHN A;  4MI5 A;  5F6L A;  3MO2 A;  3PDN A;  2W5Y A;  4MI0 A;  4YNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...