2W5ZA

Ternary complex of the mixed lineage leukaemia (mll1) set domain with the cofactor product s-adenosylhomocysteine and histone peptide.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
180
structure length
180
Chain Sequence
EYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords HISTONE-LYSINE N-METHYLTRANSFERASE HRX
publication title Structural Basis for the Requirement of Additional Factors for Mll1 Set Domain Activity and Recognition of Epigenetic Marks.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 180
sequence length 180
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2w5zA01
3BO5A 5ARGA 5TEGA 3M57A 3OXFA 1PEGA 5KJNA 3KMAA 3MO2A 2BQZA 4H12A 2RFIA 2IGQA 3DB5A 2F69A 4I51A 2O8JA 1MUFA 4MI0A 3M53A 1MT6A 3OXLA 3M54A 2W5YA 1N3JA 4YPAA 5F6KC 3OPEA 3MEKA 4FMUA 2W5ZA 3S7JA 4C1QA 3SW9A 5LSXA 3CBMA 4J8OA 4QEPA 1H3IA 4AU7A 1N6CA 4IJ8A 4YPEA 5JHNA 5ARFA 3RIBA 3KMJA 3M55A 3F9ZA 5F6LA 3M56A 3HNAA 2JV0A 4E47A 2R3AA 3IHXA 3S7DA 3QWPA 5CPRB 3RU0A 1ML9A 3MO5A 4IJDA 4YNMA 1MVHA 3CBPA 5HQ8A 4YPUA 3CBOA 5KJMA 5EG2A 3N71A 5F5EA 3K5KA 5TTFA 4O30A 3S8PA 3MO0A 4JLGA 2G46A 5JJ0A 3S7FA 3DALA 4WUYA 3M5AA 5HI7A 3RJWA 4YNDA 3M58A 2QPWA 4YNPA 5F59A 5AYFA 3OS5A 3RQ4A 3RAYA 3VV0A 3TG5A 5TH7A 5LSZA 4J7FA 5EX0A 3FPDA 3VUZA 5T0KA 5T0MA 1MVXA 3OOIA 1N6AA 5CCMA 4Z4PA 3F9WA 3EP0A 4LDGA 3SWCA 3QWWA 5KJKA 4J83A 5CCLA 1XQHA 1ZKKA 4NJ5A 3TG4A 3F9XA 5EX3A 4QENA 3M59A 5T5GA 4JDSA 4QEOA 4RZ0A 4NVQA 5JINA 1O9SA 5JIYA 3KMTA 3OXGA 3S7BA 4O6FA 4J7IA 3F9YA 3QWVA 4MI5A 4BUPA 3PDNA 5KJLA
chains in the Genus database with same CATH superfamily
3BO5A 5ARGA 5TEGA 3M57A 3OXFA 1PEGA 5KJNA 3KMAA 3MO2A 2BQZA 4H12A 2RFIA 2IGQA 3DB5A 2F69A 4I51A 2O8JA 1MUFA 4MI0A 3M53A 1MT6A 3OXLA 3M54A 2W5YA 1N3JA 4YPAA 5F6KC 3OPEA 3MEKA 4FMUA 2W5ZA 3S7JA 4C1QA 3SW9A 5LSXA 3CBMA 4J8OA 4QEPA 1H3IA 4AU7A 1N6CA 4IJ8A 4YPEA 5JHNA 5ARFA 3RIBA 3KMJA 3M55A 3F9ZA 5F6LA 3M56A 3HNAA 2JV0A 4E47A 2R3AA 3IHXA 3S7DA 3QWPA 5CPRB 3RU0A 1ML9A 3MO5A 4IJDA 4YNMA 1MVHA 3CBPA 5HQ8A 4YPUA 3CBOA 5KJMA 5EG2A 3N71A 5F5EA 3K5KA 5TTFA 4O30A 3S8PA 3MO0A 4JLGA 2G46A 5JJ0A 3S7FA 3DALA 4WUYA 3M5AA 5HI7A 3RJWA 4YNDA 3M58A 2QPWA 4YNPA 5F59A 5AYFA 3OS5A 3RQ4A 3RAYA 3VV0A 3TG5A 5TH7A 5LSZA 4J7FA 5EX0A 3FPDA 3VUZA 5T0KA 5T0MA 1MVXA 3OOIA 1N6AA 5CCMA 4Z4PA 3F9WA 3EP0A 4LDGA 3SWCA 3QWWA 5KJKA 4J83A 5CCLA 1XQHA 1ZKKA 4NJ5A 3TG4A 3F9XA 5EX3A 4QENA 3M59A 5T5GA 4JDSA 4QEOA 4RZ0A 4NVQA 5JINA 1O9SA 5JIYA 3KMTA 3OXGA 3S7BA 4O6FA 4J7IA 3F9YA 3QWVA 4MI5A 4BUPA 3PDNA 5KJLA
chains in the Genus database with same CATH topology
3BO5A 5ARGA 5TEGA 3M57A 3OXFA 1PEGA 5KJNA 3KMAA 3MO2A 2BQZA 4H12A 2RFIA 2IGQA 3DB5A 2F69A 4I51A 2O8JA 1MUFA 4MI0A 3M53A 1MT6A 3OXLA 3M54A 2W5YA 1N3JA 4YPAA 5F6KC 3OPEA 3MEKA 4FMUA 2W5ZA 3S7JA 4C1QA 3SW9A 5LSXA 3CBMA 4J8OA 4QEPA 1H3IA 4AU7A 1N6CA 4IJ8A 4YPEA 5JHNA 5ARFA 3RIBA 3KMJA 3M55A 3F9ZA 5F6LA 3M56A 3HNAA 2JV0A 4E47A 2R3AA 3IHXA 3S7DA 3QWPA 5CPRB 3RU0A 1ML9A 3MO5A 4IJDA 4YNMA 1MVHA 3CBPA 5HQ8A 4YPUA 3CBOA 5KJMA 5EG2A 3N71A 5F5EA 3K5KA 5TTFA 4O30A 3S8PA 3MO0A 4JLGA 2G46A 5JJ0A 3S7FA 3DALA 4WUYA 3M5AA 5HI7A 3RJWA 4YNDA 3M58A 2QPWA 4YNPA 5F59A 5AYFA 3OS5A 3RQ4A 3RAYA 3VV0A 3TG5A 5TH7A 5LSZA 4J7FA 5EX0A 3FPDA 3VUZA 5T0KA 5T0MA 1MVXA 3OOIA 1N6AA 5CCMA 4Z4PA 3F9WA 3EP0A 4LDGA 3SWCA 3QWWA 5KJKA 4J83A 5CCLA 1XQHA 1ZKKA 4NJ5A 3TG4A 3F9XA 5EX3A 4QENA 3M59A 5T5GA 4JDSA 4QEOA 4RZ0A 4NVQA 5JINA 1O9SA 5JIYA 3KMTA 3OXGA 3S7BA 4O6FA 4J7IA 3F9YA 3QWVA 4MI5A 4BUPA 3PDNA 5KJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BO5 A;  5ARG A;  5TEG A;  3M57 A;  3OXF A;  1PEG A;  5KJN A;  3KMA A;  3MO2 A;  2BQZ A;  4H12 A;  2RFI A;  2IGQ A;  3DB5 A;  2F69 A;  4I51 A;  2O8J A;  1MUF A;  4MI0 A;  3M53 A;  1MT6 A;  3OXL A;  3M54 A;  2W5Y A;  1N3J A;  4YPA A;  5F6K C;  3OPE A;  3MEK A;  4FMU A;  2W5Z A;  3S7J A;  4C1Q A;  3SW9 A;  5LSX A;  3CBM A;  4J8O A;  4QEP A;  1H3I A;  4AU7 A;  1N6C A;  4IJ8 A;  4YPE A;  5JHN A;  5ARF A;  3RIB A;  3KMJ A;  3M55 A;  3F9Z A;  5F6L A;  3M56 A;  3HNA A;  2JV0 A;  4E47 A;  2R3A A;  3IHX A;  3S7D A;  3QWP A;  5CPR B;  3RU0 A;  1ML9 A;  3MO5 A;  4IJD A;  4YNM A;  1MVH A;  3CBP A;  5HQ8 A;  4YPU A;  3CBO A;  5KJM A;  5EG2 A;  3N71 A;  5F5E A;  3K5K A;  5TTF A;  4O30 A;  3S8P A;  3MO0 A;  4JLG A;  2G46 A;  5JJ0 A;  3S7F A;  3DAL A;  4WUY A;  3M5A A;  5HI7 A;  3RJW A;  4YND A;  3M58 A;  2QPW A;  4YNP A;  5F59 A;  5AYF A;  3OS5 A;  3RQ4 A;  3RAY A;  3VV0 A;  3TG5 A;  5TH7 A;  5LSZ A;  4J7F A;  5EX0 A;  3FPD A;  3VUZ A;  5T0K A;  5T0M A;  1MVX A;  3OOI A;  1N6A A;  5CCM A;  4Z4P A;  3F9W A;  3EP0 A;  4LDG A;  3SWC A;  3QWW A;  5KJK A;  4J83 A;  5CCL A;  1XQH A;  1ZKK A;  4NJ5 A;  3TG4 A;  3F9X A;  5EX3 A;  4QEN A;  3M59 A;  5T5G A;  4JDS A;  4QEO A;  4RZ0 A;  4NVQ A;  5JIN A;  1O9S A;  5JIY A;  3KMT A;  3OXG A;  3S7B A;  4O6F A;  4J7I A;  3F9Y A;  3QWV A;  4MI5 A;  4BUP A;  3PDN A;  5KJL A; 
#chains in the Genus database with same CATH topology
 3BO5 A;  5ARG A;  5TEG A;  3M57 A;  3OXF A;  1PEG A;  5KJN A;  3KMA A;  3MO2 A;  2BQZ A;  4H12 A;  2RFI A;  2IGQ A;  3DB5 A;  2F69 A;  4I51 A;  2O8J A;  1MUF A;  4MI0 A;  3M53 A;  1MT6 A;  3OXL A;  3M54 A;  2W5Y A;  1N3J A;  4YPA A;  5F6K C;  3OPE A;  3MEK A;  4FMU A;  2W5Z A;  3S7J A;  4C1Q A;  3SW9 A;  5LSX A;  3CBM A;  4J8O A;  4QEP A;  1H3I A;  4AU7 A;  1N6C A;  4IJ8 A;  4YPE A;  5JHN A;  5ARF A;  3RIB A;  3KMJ A;  3M55 A;  3F9Z A;  5F6L A;  3M56 A;  3HNA A;  2JV0 A;  4E47 A;  2R3A A;  3IHX A;  3S7D A;  3QWP A;  5CPR B;  3RU0 A;  1ML9 A;  3MO5 A;  4IJD A;  4YNM A;  1MVH A;  3CBP A;  5HQ8 A;  4YPU A;  3CBO A;  5KJM A;  5EG2 A;  3N71 A;  5F5E A;  3K5K A;  5TTF A;  4O30 A;  3S8P A;  3MO0 A;  4JLG A;  2G46 A;  5JJ0 A;  3S7F A;  3DAL A;  4WUY A;  3M5A A;  5HI7 A;  3RJW A;  4YND A;  3M58 A;  2QPW A;  4YNP A;  5F59 A;  5AYF A;  3OS5 A;  3RQ4 A;  3RAY A;  3VV0 A;  3TG5 A;  5TH7 A;  5LSZ A;  4J7F A;  5EX0 A;  3FPD A;  3VUZ A;  5T0K A;  5T0M A;  1MVX A;  3OOI A;  1N6A A;  5CCM A;  4Z4P A;  3F9W A;  3EP0 A;  4LDG A;  3SWC A;  3QWW A;  5KJK A;  4J83 A;  5CCL A;  1XQH A;  1ZKK A;  4NJ5 A;  3TG4 A;  3F9X A;  5EX3 A;  4QEN A;  3M59 A;  5T5G A;  4JDS A;  4QEO A;  4RZ0 A;  4NVQ A;  5JIN A;  1O9S A;  5JIY A;  3KMT A;  3OXG A;  3S7B A;  4O6F A;  4J7I A;  3F9Y A;  3QWV A;  4MI5 A;  4BUP A;  3PDN A;  5KJL A; 
#chains in the Genus database with same CATH homology
 3BO5 A;  5ARG A;  5TEG A;  3M57 A;  3OXF A;  1PEG A;  5KJN A;  3KMA A;  3MO2 A;  2BQZ A;  4H12 A;  2RFI A;  2IGQ A;  3DB5 A;  2F69 A;  4I51 A;  2O8J A;  1MUF A;  4MI0 A;  3M53 A;  1MT6 A;  3OXL A;  3M54 A;  2W5Y A;  1N3J A;  4YPA A;  5F6K C;  3OPE A;  3MEK A;  4FMU A;  2W5Z A;  3S7J A;  4C1Q A;  3SW9 A;  5LSX A;  3CBM A;  4J8O A;  4QEP A;  1H3I A;  4AU7 A;  1N6C A;  4IJ8 A;  4YPE A;  5JHN A;  5ARF A;  3RIB A;  3KMJ A;  3M55 A;  3F9Z A;  5F6L A;  3M56 A;  3HNA A;  2JV0 A;  4E47 A;  2R3A A;  3IHX A;  3S7D A;  3QWP A;  5CPR B;  3RU0 A;  1ML9 A;  3MO5 A;  4IJD A;  4YNM A;  1MVH A;  3CBP A;  5HQ8 A;  4YPU A;  3CBO A;  5KJM A;  5EG2 A;  3N71 A;  5F5E A;  3K5K A;  5TTF A;  4O30 A;  3S8P A;  3MO0 A;  4JLG A;  2G46 A;  5JJ0 A;  3S7F A;  3DAL A;  4WUY A;  3M5A A;  5HI7 A;  3RJW A;  4YND A;  3M58 A;  2QPW A;  4YNP A;  5F59 A;  5AYF A;  3OS5 A;  3RQ4 A;  3RAY A;  3VV0 A;  3TG5 A;  5TH7 A;  5LSZ A;  4J7F A;  5EX0 A;  3FPD A;  3VUZ A;  5T0K A;  5T0M A;  1MVX A;  3OOI A;  1N6A A;  5CCM A;  4Z4P A;  3F9W A;  3EP0 A;  4LDG A;  3SWC A;  3QWW A;  5KJK A;  4J83 A;  5CCL A;  1XQH A;  1ZKK A;  4NJ5 A;  3TG4 A;  3F9X A;  5EX3 A;  4QEN A;  3M59 A;  5T5G A;  4JDS A;  4QEO A;  4RZ0 A;  4NVQ A;  5JIN A;  1O9S A;  5JIY A;  3KMT A;  3OXG A;  3S7B A;  4O6F A;  4J7I A;  3F9Y A;  3QWV A;  4MI5 A;  4BUP A;  3PDN A;  5KJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...