2W5ZA

Ternary complex of the mixed lineage leukaemia (mll1) set domain with the cofactor product s-adenosylhomocysteine and histone peptide.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
180
structure length
180
Chain Sequence
EYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the Requirement of Additional Factors for Mll1 Set Domain Activity and Recognition of Epigenetic Marks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords HISTONE-LYSINE N-METHYLTRANSFERASE HRX
total genus 48
structure length 180
sequence length 180
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2w5zA01
3IHXA 5ARGA 4WUYA 3OXLA 3MO2A 4YNDA 4IJDA 1N6CA 1N6AA 4J7FA 5T0MA 5LSZA 3M57A 4J7IA 4JLGA 4IJ8A 3OXGA 3KMJA 1MVXA 4YPEA 4MI5A 5F6KC 4BUPA 3QWWA 1ZKKA 5EX0A 1MT6A 2RFIA 3TG5A 5CCLA 4Z4PA 3RJWA 3MO0A 3M55A 3M58A 1MUFA 5LSXA 3F9XA 3F9ZA 3SW9A 3RQ4A 5KJNA 3QWVA 4QEOA 3HNAA 5CCMA 4YNPA 4E47A 2O8JA 5KJMA 4RZ0A 1O9SA 4O30A 3M5AA 3M53A 5F59A 5F6LA 4C1QA 2F69A 3DB5A 4YPUA 5ARFA 3PDNA 3EP0A 2BQZA 3M59A 3BO5A 3RAYA 5T0KA 4LDGA 3MO5A 1ML9A 4AU7A 4J8OA 4J83A 3F9WA 2W5ZA 1PEGA 1XQHA 4QENA 4YPAA 3M54A 3CBPA 5TTFA 5F5EA 5JJ0A 3SWCA 3S7DA 3CBOA 4JDSA 3KMAA 5EX3A 2R3AA 4I51A 3N71A 3OXFA 2G46A 3TG4A 5HI7A 4MI0A 3F9YA 5JIYA 2IGQA 5JHNA 5TH7A 3VV0A 3S7JA 3KMTA 4NJ5A 5EG2A 3S7FA 5JINA 4QEPA 4H12A 3OOIA 3S7BA 2W5YA 3DALA 5CPRB 4FMUA 1H3IA 1MVHA 3FPDA 4YNMA 3RIBA 5AYFA 2QPWA 3VUZA 3S8PA 5TEGA 5HQ8A 3RU0A 1N3JA 4O6FA 5KJKA 3OS5A 3K5KA 5T5GA 3MEKA 4NVQA 5KJLA 2JV0A 3M56A 3QWPA 3OPEA 3CBMA
chains in the Genus database with same CATH superfamily
3IHXA 5ARGA 4WUYA 3OXLA 3MO2A 4YNDA 4IJDA 1N6CA 1N6AA 4J7FA 5T0MA 5LSZA 3M57A 4J7IA 4JLGA 4IJ8A 3OXGA 3KMJA 1MVXA 4YPEA 4MI5A 5F6KC 4BUPA 3QWWA 1ZKKA 5EX0A 1MT6A 2RFIA 3TG5A 5CCLA 4Z4PA 3RJWA 3MO0A 3M55A 3M58A 1MUFA 5LSXA 3F9XA 3F9ZA 3SW9A 3RQ4A 5KJNA 3QWVA 4QEOA 3HNAA 5CCMA 4YNPA 4E47A 2O8JA 5KJMA 4RZ0A 1O9SA 4O30A 3M5AA 3M53A 5F59A 5F6LA 4C1QA 2F69A 3DB5A 4YPUA 5ARFA 3PDNA 3EP0A 2BQZA 3M59A 3BO5A 3RAYA 5T0KA 4LDGA 3MO5A 1ML9A 4AU7A 4J8OA 4J83A 3F9WA 2W5ZA 1PEGA 1XQHA 4QENA 4YPAA 3M54A 3CBPA 5TTFA 5F5EA 5JJ0A 3SWCA 3S7DA 3CBOA 4JDSA 3KMAA 5EX3A 2R3AA 4I51A 3N71A 3OXFA 2G46A 3TG4A 5HI7A 4MI0A 3F9YA 5JIYA 2IGQA 5JHNA 5TH7A 3VV0A 3S7JA 3KMTA 4NJ5A 5EG2A 3S7FA 5JINA 4QEPA 4H12A 3OOIA 3S7BA 2W5YA 3DALA 5CPRB 4FMUA 1H3IA 1MVHA 3FPDA 4YNMA 3RIBA 5AYFA 2QPWA 3VUZA 3S8PA 5TEGA 5HQ8A 3RU0A 1N3JA 4O6FA 5KJKA 3OS5A 3K5KA 5T5GA 3MEKA 4NVQA 5KJLA 2JV0A 3M56A 3QWPA 3OPEA 3CBMA
chains in the Genus database with same CATH topology
3IHXA 5ARGA 4WUYA 3OXLA 3MO2A 4YNDA 4IJDA 1N6CA 1N6AA 4J7FA 5T0MA 5LSZA 3M57A 4J7IA 4JLGA 4IJ8A 3OXGA 3KMJA 1MVXA 4YPEA 4MI5A 5F6KC 4BUPA 3QWWA 1ZKKA 5EX0A 1MT6A 2RFIA 3TG5A 5CCLA 4Z4PA 3RJWA 3MO0A 3M55A 3M58A 1MUFA 5LSXA 3F9XA 3F9ZA 3SW9A 3RQ4A 5KJNA 3QWVA 4QEOA 3HNAA 5CCMA 4YNPA 4E47A 2O8JA 5KJMA 4RZ0A 1O9SA 4O30A 3M5AA 3M53A 5F59A 5F6LA 4C1QA 2F69A 3DB5A 4YPUA 5ARFA 3PDNA 3EP0A 2BQZA 3M59A 3BO5A 3RAYA 5T0KA 4LDGA 3MO5A 1ML9A 4AU7A 4J8OA 4J83A 3F9WA 2W5ZA 1PEGA 1XQHA 4QENA 4YPAA 3M54A 3CBPA 5TTFA 5F5EA 5JJ0A 3SWCA 3S7DA 3CBOA 4JDSA 3KMAA 5EX3A 2R3AA 4I51A 3N71A 3OXFA 2G46A 3TG4A 5HI7A 4MI0A 3F9YA 5JIYA 2IGQA 5JHNA 5TH7A 3VV0A 3S7JA 3KMTA 4NJ5A 5EG2A 3S7FA 5JINA 4QEPA 4H12A 3OOIA 3S7BA 2W5YA 3DALA 5CPRB 4FMUA 1H3IA 1MVHA 3FPDA 4YNMA 3RIBA 5AYFA 2QPWA 3VUZA 3S8PA 5TEGA 5HQ8A 3RU0A 1N3JA 4O6FA 5KJKA 3OS5A 3K5KA 5T5GA 3MEKA 4NVQA 5KJLA 2JV0A 3M56A 3QWPA 3OPEA 3CBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IHX A;  5ARG A;  4WUY A;  3OXL A;  3MO2 A;  4YND A;  4IJD A;  1N6C A;  1N6A A;  4J7F A;  5T0M A;  5LSZ A;  3M57 A;  4J7I A;  4JLG A;  4IJ8 A;  3OXG A;  3KMJ A;  1MVX A;  4YPE A;  4MI5 A;  5F6K C;  4BUP A;  3QWW A;  1ZKK A;  5EX0 A;  1MT6 A;  2RFI A;  3TG5 A;  5CCL A;  4Z4P A;  3RJW A;  3MO0 A;  3M55 A;  3M58 A;  1MUF A;  5LSX A;  3F9X A;  3F9Z A;  3SW9 A;  3RQ4 A;  5KJN A;  3QWV A;  4QEO A;  3HNA A;  5CCM A;  4YNP A;  4E47 A;  2O8J A;  5KJM A;  4RZ0 A;  1O9S A;  4O30 A;  3M5A A;  3M53 A;  5F59 A;  5F6L A;  4C1Q A;  2F69 A;  3DB5 A;  4YPU A;  5ARF A;  3PDN A;  3EP0 A;  2BQZ A;  3M59 A;  3BO5 A;  3RAY A;  5T0K A;  4LDG A;  3MO5 A;  1ML9 A;  4AU7 A;  4J8O A;  4J83 A;  3F9W A;  2W5Z A;  1PEG A;  1XQH A;  4QEN A;  4YPA A;  3M54 A;  3CBP A;  5TTF A;  5F5E A;  5JJ0 A;  3SWC A;  3S7D A;  3CBO A;  4JDS A;  3KMA A;  5EX3 A;  2R3A A;  4I51 A;  3N71 A;  3OXF A;  2G46 A;  3TG4 A;  5HI7 A;  4MI0 A;  3F9Y A;  5JIY A;  2IGQ A;  5JHN A;  5TH7 A;  3VV0 A;  3S7J A;  3KMT A;  4NJ5 A;  5EG2 A;  3S7F A;  5JIN A;  4QEP A;  4H12 A;  3OOI A;  3S7B A;  2W5Y A;  3DAL A;  5CPR B;  4FMU A;  1H3I A;  1MVH A;  3FPD A;  4YNM A;  3RIB A;  5AYF A;  2QPW A;  3VUZ A;  3S8P A;  5TEG A;  5HQ8 A;  3RU0 A;  1N3J A;  4O6F A;  5KJK A;  3OS5 A;  3K5K A;  5T5G A;  3MEK A;  4NVQ A;  5KJL A;  2JV0 A;  3M56 A;  3QWP A;  3OPE A;  3CBM A; 
#chains in the Genus database with same CATH topology
 3IHX A;  5ARG A;  4WUY A;  3OXL A;  3MO2 A;  4YND A;  4IJD A;  1N6C A;  1N6A A;  4J7F A;  5T0M A;  5LSZ A;  3M57 A;  4J7I A;  4JLG A;  4IJ8 A;  3OXG A;  3KMJ A;  1MVX A;  4YPE A;  4MI5 A;  5F6K C;  4BUP A;  3QWW A;  1ZKK A;  5EX0 A;  1MT6 A;  2RFI A;  3TG5 A;  5CCL A;  4Z4P A;  3RJW A;  3MO0 A;  3M55 A;  3M58 A;  1MUF A;  5LSX A;  3F9X A;  3F9Z A;  3SW9 A;  3RQ4 A;  5KJN A;  3QWV A;  4QEO A;  3HNA A;  5CCM A;  4YNP A;  4E47 A;  2O8J A;  5KJM A;  4RZ0 A;  1O9S A;  4O30 A;  3M5A A;  3M53 A;  5F59 A;  5F6L A;  4C1Q A;  2F69 A;  3DB5 A;  4YPU A;  5ARF A;  3PDN A;  3EP0 A;  2BQZ A;  3M59 A;  3BO5 A;  3RAY A;  5T0K A;  4LDG A;  3MO5 A;  1ML9 A;  4AU7 A;  4J8O A;  4J83 A;  3F9W A;  2W5Z A;  1PEG A;  1XQH A;  4QEN A;  4YPA A;  3M54 A;  3CBP A;  5TTF A;  5F5E A;  5JJ0 A;  3SWC A;  3S7D A;  3CBO A;  4JDS A;  3KMA A;  5EX3 A;  2R3A A;  4I51 A;  3N71 A;  3OXF A;  2G46 A;  3TG4 A;  5HI7 A;  4MI0 A;  3F9Y A;  5JIY A;  2IGQ A;  5JHN A;  5TH7 A;  3VV0 A;  3S7J A;  3KMT A;  4NJ5 A;  5EG2 A;  3S7F A;  5JIN A;  4QEP A;  4H12 A;  3OOI A;  3S7B A;  2W5Y A;  3DAL A;  5CPR B;  4FMU A;  1H3I A;  1MVH A;  3FPD A;  4YNM A;  3RIB A;  5AYF A;  2QPW A;  3VUZ A;  3S8P A;  5TEG A;  5HQ8 A;  3RU0 A;  1N3J A;  4O6F A;  5KJK A;  3OS5 A;  3K5K A;  5T5G A;  3MEK A;  4NVQ A;  5KJL A;  2JV0 A;  3M56 A;  3QWP A;  3OPE A;  3CBM A; 
#chains in the Genus database with same CATH homology
 3IHX A;  5ARG A;  4WUY A;  3OXL A;  3MO2 A;  4YND A;  4IJD A;  1N6C A;  1N6A A;  4J7F A;  5T0M A;  5LSZ A;  3M57 A;  4J7I A;  4JLG A;  4IJ8 A;  3OXG A;  3KMJ A;  1MVX A;  4YPE A;  4MI5 A;  5F6K C;  4BUP A;  3QWW A;  1ZKK A;  5EX0 A;  1MT6 A;  2RFI A;  3TG5 A;  5CCL A;  4Z4P A;  3RJW A;  3MO0 A;  3M55 A;  3M58 A;  1MUF A;  5LSX A;  3F9X A;  3F9Z A;  3SW9 A;  3RQ4 A;  5KJN A;  3QWV A;  4QEO A;  3HNA A;  5CCM A;  4YNP A;  4E47 A;  2O8J A;  5KJM A;  4RZ0 A;  1O9S A;  4O30 A;  3M5A A;  3M53 A;  5F59 A;  5F6L A;  4C1Q A;  2F69 A;  3DB5 A;  4YPU A;  5ARF A;  3PDN A;  3EP0 A;  2BQZ A;  3M59 A;  3BO5 A;  3RAY A;  5T0K A;  4LDG A;  3MO5 A;  1ML9 A;  4AU7 A;  4J8O A;  4J83 A;  3F9W A;  2W5Z A;  1PEG A;  1XQH A;  4QEN A;  4YPA A;  3M54 A;  3CBP A;  5TTF A;  5F5E A;  5JJ0 A;  3SWC A;  3S7D A;  3CBO A;  4JDS A;  3KMA A;  5EX3 A;  2R3A A;  4I51 A;  3N71 A;  3OXF A;  2G46 A;  3TG4 A;  5HI7 A;  4MI0 A;  3F9Y A;  5JIY A;  2IGQ A;  5JHN A;  5TH7 A;  3VV0 A;  3S7J A;  3KMT A;  4NJ5 A;  5EG2 A;  3S7F A;  5JIN A;  4QEP A;  4H12 A;  3OOI A;  3S7B A;  2W5Y A;  3DAL A;  5CPR B;  4FMU A;  1H3I A;  1MVH A;  3FPD A;  4YNM A;  3RIB A;  5AYF A;  2QPW A;  3VUZ A;  3S8P A;  5TEG A;  5HQ8 A;  3RU0 A;  1N3J A;  4O6F A;  5KJK A;  3OS5 A;  3K5K A;  5T5G A;  3MEK A;  4NVQ A;  5KJL A;  2JV0 A;  3M56 A;  3QWP A;  3OPE A;  3CBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...