2BQZA

Crystal structure of a ternary complex of the human histone methyltransferase pr-set7 (also known as set8)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
161
structure length
161
Chain Sequence
b'RKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SET8 PROTEIN
publication title Specificity and Mechanism of the Histone Methyltransferase Pr-Set7
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 44
structure length 161
sequence length 161
chains with identical sequence E
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2005-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2bqzA00
4J83A 5F59A 3F9XA 5F6LA 4BUPA 3KMAA 2W5ZA 3M58A 3RQ4A 3IHXA 3TG5A 4I51A 3OPEA 3OXFA 4YNPA 3PDNA 1N6CA 2G46A 1MT6A 3F9YA 5T0KA 1MVHA 3KMJA 5CCLA 5EG2A 5KJNA 5ARFA 3HNAA 4YNMA 4Z4PA 3OOIA 5TH7A 1PEGA 3MO5A 4QEOA 3S7BA 2JV0A 3RIBA 5F5EA 3RU0A 4NVQA 5JINA 3VV0A 3M5AA 5KJLA 5T0MA 5HQ8A 4J7FA 3SWCA 3EP0A 3KMTA 3M56A 3QWPA 2O8JA 4AU7A 3S7FA 3K5KA 5TEGA 4O6FA 5KJKA 3CBOA 1H3IA 1ML9A 5CPRB 4YPAA 3DB5A 3TG4A 4JLGA 3MO2A 1XQHA 4RZ0A 3DALA 5TTFA 4QEPA 3N71A 2RFIA 5JHNA 5AYFA 4QENA 4NJ5A 3RJWA 3M55A 4J7IA 1O9SA 2W5YA 4C1QA 5ARGA 3QWVA 5EX3A 1MUFA 3M54A 3S8PA 5KJMA 3M53A 4MI5A 4E47A 3CBPA 3F9ZA 1MVXA 2F69A 5JIYA 3QWWA 3S7DA 4YNDA 3CBMA 3SW9A 3MO0A 5CCMA 5JJ0A 3M57A 4JDSA 5LSXA 4FMUA 5T5GA 3VUZA 3FPDA 4H12A 4J8OA 4YPUA 4MI0A 1N3JA 1ZKKA 3MEKA 3BO5A 3OS5A 4IJ8A 5F6KC 4YPEA 3OXGA 3S7JA 3RAYA 5HI7A 2IGQA 4O30A 3F9WA 3OXLA 4LDGA 1N6AA 4WUYA 4IJDA 5LSZA 2QPWA 2BQZA 5EX0A 2R3AA 3M59A
chains in the Genus database with same CATH superfamily
4J83A 5F59A 3F9XA 5F6LA 4BUPA 3KMAA 2W5ZA 3M58A 3RQ4A 3IHXA 3TG5A 4I51A 3OPEA 3OXFA 4YNPA 3PDNA 1N6CA 2G46A 1MT6A 3F9YA 5T0KA 1MVHA 3KMJA 5CCLA 5EG2A 5KJNA 5ARFA 3HNAA 4YNMA 4Z4PA 3OOIA 5TH7A 1PEGA 3MO5A 4QEOA 3S7BA 2JV0A 3RIBA 5F5EA 3RU0A 4NVQA 5JINA 3VV0A 3M5AA 5KJLA 5T0MA 5HQ8A 4J7FA 3SWCA 3EP0A 3KMTA 3M56A 3QWPA 2O8JA 4AU7A 3S7FA 3K5KA 5TEGA 4O6FA 5KJKA 3CBOA 1H3IA 1ML9A 5CPRB 4YPAA 3DB5A 3TG4A 4JLGA 3MO2A 1XQHA 4RZ0A 3DALA 5TTFA 4QEPA 3N71A 2RFIA 5JHNA 5AYFA 4QENA 4NJ5A 3RJWA 3M55A 4J7IA 1O9SA 2W5YA 4C1QA 5ARGA 3QWVA 5EX3A 1MUFA 3M54A 3S8PA 5KJMA 3M53A 4MI5A 4E47A 3CBPA 3F9ZA 1MVXA 2F69A 5JIYA 3QWWA 3S7DA 4YNDA 3CBMA 3SW9A 3MO0A 5CCMA 5JJ0A 3M57A 4JDSA 5LSXA 4FMUA 5T5GA 3VUZA 3FPDA 4H12A 4J8OA 4YPUA 4MI0A 1N3JA 1ZKKA 3MEKA 3BO5A 3OS5A 4IJ8A 5F6KC 4YPEA 3OXGA 3S7JA 3RAYA 5HI7A 2IGQA 4O30A 3F9WA 3OXLA 4LDGA 1N6AA 4WUYA 4IJDA 5LSZA 2QPWA 2BQZA 5EX0A 2R3AA 3M59A
chains in the Genus database with same CATH topology
4J83A 5F59A 3F9XA 5F6LA 4BUPA 3KMAA 2W5ZA 3M58A 3RQ4A 3IHXA 3TG5A 4I51A 3OPEA 3OXFA 4YNPA 3PDNA 1N6CA 2G46A 1MT6A 3F9YA 5T0KA 1MVHA 3KMJA 5CCLA 5EG2A 5KJNA 5ARFA 3HNAA 4YNMA 4Z4PA 3OOIA 5TH7A 1PEGA 3MO5A 4QEOA 3S7BA 2JV0A 3RIBA 5F5EA 3RU0A 4NVQA 5JINA 3VV0A 3M5AA 5KJLA 5T0MA 5HQ8A 4J7FA 3SWCA 3EP0A 3KMTA 3M56A 3QWPA 2O8JA 4AU7A 3S7FA 3K5KA 5TEGA 4O6FA 5KJKA 3CBOA 1H3IA 1ML9A 5CPRB 4YPAA 3DB5A 3TG4A 4JLGA 3MO2A 1XQHA 4RZ0A 3DALA 5TTFA 4QEPA 3N71A 2RFIA 5JHNA 5AYFA 4QENA 4NJ5A 3RJWA 3M55A 4J7IA 1O9SA 2W5YA 4C1QA 5ARGA 3QWVA 5EX3A 1MUFA 3M54A 3S8PA 5KJMA 3M53A 4MI5A 4E47A 3CBPA 3F9ZA 1MVXA 2F69A 5JIYA 3QWWA 3S7DA 4YNDA 3CBMA 3SW9A 3MO0A 5CCMA 5JJ0A 3M57A 4JDSA 5LSXA 4FMUA 5T5GA 3VUZA 3FPDA 4H12A 4J8OA 4YPUA 4MI0A 1N3JA 1ZKKA 3MEKA 3BO5A 3OS5A 4IJ8A 5F6KC 4YPEA 3OXGA 3S7JA 3RAYA 5HI7A 2IGQA 4O30A 3F9WA 3OXLA 4LDGA 1N6AA 4WUYA 4IJDA 5LSZA 2QPWA 2BQZA 5EX0A 2R3AA 3M59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J83 A;  5F59 A;  3F9X A;  5F6L A;  4BUP A;  3KMA A;  2W5Z A;  3M58 A;  3RQ4 A;  3IHX A;  3TG5 A;  4I51 A;  3OPE A;  3OXF A;  4YNP A;  3PDN A;  1N6C A;  2G46 A;  1MT6 A;  3F9Y A;  5T0K A;  1MVH A;  3KMJ A;  5CCL A;  5EG2 A;  5KJN A;  5ARF A;  3HNA A;  4YNM A;  4Z4P A;  3OOI A;  5TH7 A;  1PEG A;  3MO5 A;  4QEO A;  3S7B A;  2JV0 A;  3RIB A;  5F5E A;  3RU0 A;  4NVQ A;  5JIN A;  3VV0 A;  3M5A A;  5KJL A;  5T0M A;  5HQ8 A;  4J7F A;  3SWC A;  3EP0 A;  3KMT A;  3M56 A;  3QWP A;  2O8J A;  4AU7 A;  3S7F A;  3K5K A;  5TEG A;  4O6F A;  5KJK A;  3CBO A;  1H3I A;  1ML9 A;  5CPR B;  4YPA A;  3DB5 A;  3TG4 A;  4JLG A;  3MO2 A;  1XQH A;  4RZ0 A;  3DAL A;  5TTF A;  4QEP A;  3N71 A;  2RFI A;  5JHN A;  5AYF A;  4QEN A;  4NJ5 A;  3RJW A;  3M55 A;  4J7I A;  1O9S A;  2W5Y A;  4C1Q A;  5ARG A;  3QWV A;  5EX3 A;  1MUF A;  3M54 A;  3S8P A;  5KJM A;  3M53 A;  4MI5 A;  4E47 A;  3CBP A;  3F9Z A;  1MVX A;  2F69 A;  5JIY A;  3QWW A;  3S7D A;  4YND A;  3CBM A;  3SW9 A;  3MO0 A;  5CCM A;  5JJ0 A;  3M57 A;  4JDS A;  5LSX A;  4FMU A;  5T5G A;  3VUZ A;  3FPD A;  4H12 A;  4J8O A;  4YPU A;  4MI0 A;  1N3J A;  1ZKK A;  3MEK A;  3BO5 A;  3OS5 A;  4IJ8 A;  5F6K C;  4YPE A;  3OXG A;  3S7J A;  3RAY A;  5HI7 A;  2IGQ A;  4O30 A;  3F9W A;  3OXL A;  4LDG A;  1N6A A;  4WUY A;  4IJD A;  5LSZ A;  2QPW A;  2BQZ A;  5EX0 A;  2R3A A;  3M59 A; 
#chains in the Genus database with same CATH topology
 4J83 A;  5F59 A;  3F9X A;  5F6L A;  4BUP A;  3KMA A;  2W5Z A;  3M58 A;  3RQ4 A;  3IHX A;  3TG5 A;  4I51 A;  3OPE A;  3OXF A;  4YNP A;  3PDN A;  1N6C A;  2G46 A;  1MT6 A;  3F9Y A;  5T0K A;  1MVH A;  3KMJ A;  5CCL A;  5EG2 A;  5KJN A;  5ARF A;  3HNA A;  4YNM A;  4Z4P A;  3OOI A;  5TH7 A;  1PEG A;  3MO5 A;  4QEO A;  3S7B A;  2JV0 A;  3RIB A;  5F5E A;  3RU0 A;  4NVQ A;  5JIN A;  3VV0 A;  3M5A A;  5KJL A;  5T0M A;  5HQ8 A;  4J7F A;  3SWC A;  3EP0 A;  3KMT A;  3M56 A;  3QWP A;  2O8J A;  4AU7 A;  3S7F A;  3K5K A;  5TEG A;  4O6F A;  5KJK A;  3CBO A;  1H3I A;  1ML9 A;  5CPR B;  4YPA A;  3DB5 A;  3TG4 A;  4JLG A;  3MO2 A;  1XQH A;  4RZ0 A;  3DAL A;  5TTF A;  4QEP A;  3N71 A;  2RFI A;  5JHN A;  5AYF A;  4QEN A;  4NJ5 A;  3RJW A;  3M55 A;  4J7I A;  1O9S A;  2W5Y A;  4C1Q A;  5ARG A;  3QWV A;  5EX3 A;  1MUF A;  3M54 A;  3S8P A;  5KJM A;  3M53 A;  4MI5 A;  4E47 A;  3CBP A;  3F9Z A;  1MVX A;  2F69 A;  5JIY A;  3QWW A;  3S7D A;  4YND A;  3CBM A;  3SW9 A;  3MO0 A;  5CCM A;  5JJ0 A;  3M57 A;  4JDS A;  5LSX A;  4FMU A;  5T5G A;  3VUZ A;  3FPD A;  4H12 A;  4J8O A;  4YPU A;  4MI0 A;  1N3J A;  1ZKK A;  3MEK A;  3BO5 A;  3OS5 A;  4IJ8 A;  5F6K C;  4YPE A;  3OXG A;  3S7J A;  3RAY A;  5HI7 A;  2IGQ A;  4O30 A;  3F9W A;  3OXL A;  4LDG A;  1N6A A;  4WUY A;  4IJD A;  5LSZ A;  2QPW A;  2BQZ A;  5EX0 A;  2R3A A;  3M59 A; 
#chains in the Genus database with same CATH homology
 4J83 A;  5F59 A;  3F9X A;  5F6L A;  4BUP A;  3KMA A;  2W5Z A;  3M58 A;  3RQ4 A;  3IHX A;  3TG5 A;  4I51 A;  3OPE A;  3OXF A;  4YNP A;  3PDN A;  1N6C A;  2G46 A;  1MT6 A;  3F9Y A;  5T0K A;  1MVH A;  3KMJ A;  5CCL A;  5EG2 A;  5KJN A;  5ARF A;  3HNA A;  4YNM A;  4Z4P A;  3OOI A;  5TH7 A;  1PEG A;  3MO5 A;  4QEO A;  3S7B A;  2JV0 A;  3RIB A;  5F5E A;  3RU0 A;  4NVQ A;  5JIN A;  3VV0 A;  3M5A A;  5KJL A;  5T0M A;  5HQ8 A;  4J7F A;  3SWC A;  3EP0 A;  3KMT A;  3M56 A;  3QWP A;  2O8J A;  4AU7 A;  3S7F A;  3K5K A;  5TEG A;  4O6F A;  5KJK A;  3CBO A;  1H3I A;  1ML9 A;  5CPR B;  4YPA A;  3DB5 A;  3TG4 A;  4JLG A;  3MO2 A;  1XQH A;  4RZ0 A;  3DAL A;  5TTF A;  4QEP A;  3N71 A;  2RFI A;  5JHN A;  5AYF A;  4QEN A;  4NJ5 A;  3RJW A;  3M55 A;  4J7I A;  1O9S A;  2W5Y A;  4C1Q A;  5ARG A;  3QWV A;  5EX3 A;  1MUF A;  3M54 A;  3S8P A;  5KJM A;  3M53 A;  4MI5 A;  4E47 A;  3CBP A;  3F9Z A;  1MVX A;  2F69 A;  5JIY A;  3QWW A;  3S7D A;  4YND A;  3CBM A;  3SW9 A;  3MO0 A;  5CCM A;  5JJ0 A;  3M57 A;  4JDS A;  5LSX A;  4FMU A;  5T5G A;  3VUZ A;  3FPD A;  4H12 A;  4J8O A;  4YPU A;  4MI0 A;  1N3J A;  1ZKK A;  3MEK A;  3BO5 A;  3OS5 A;  4IJ8 A;  5F6K C;  4YPE A;  3OXG A;  3S7J A;  3RAY A;  5HI7 A;  2IGQ A;  4O30 A;  3F9W A;  3OXL A;  4LDG A;  1N6A A;  4WUY A;  4IJD A;  5LSZ A;  2QPW A;  2BQZ A;  5EX0 A;  2R3A A;  3M59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...