2BQZA

Crystal structure of a ternary complex of the human histone methyltransferase pr-set7 (also known as set8)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
161
structure length
161
Chain Sequence
RKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Specificity and Mechanism of the Histone Methyltransferase Pr-Set7
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords SET8 PROTEIN
total genus 44
structure length 161
sequence length 161
chains with identical sequence E
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2005-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2bqzA00
3OPEA 3F9WA 4J8OA 1ZKKA 3OXLA 3M53A 4QEPA 4I51A 5F59A 3MO2A 3BO5A 3M59A 3KMAA 5CCLA 1N6AA 3TG4A 3S7BA 3S7DA 4IJ8A 3RIBA 5TEGA 1MVXA 5JIYA 3OXFA 5HI7A 3CBOA 5HQ8A 3M54A 1PEGA 5ARGA 5T5GA 2O8JA 1O9SA 4RZ0A 4NVQA 4YNPA 4J7FA 2QPWA 4YNDA 3S7JA 4FMUA 4QEOA 3KMTA 3TG5A 3DALA 4O6FA 3VUZA 4J7IA 3MO0A 3VV0A 1N6CA 5EX0A 3RQ4A 5F6LA 4IJDA 3SWCA 3M56A 3OS5A 5JHNA 5TTFA 4MI0A 1MT6A 3OOIA 1H3IA 2RFIA 5T0KA 3MEKA 3RAYA 3M5AA 5LSXA 5TH7A 2W5ZA 4NJ5A 4YPAA 5T0MA 5KJMA 2IGQA 3EP0A 4C1QA 2F69A 5JJ0A 3CBMA 4QENA 4WUYA 4BUPA 1MUFA 3SW9A 3RU0A 4J83A 4E47A 2JV0A 1N3JA 5LSZA 1ML9A 4JLGA 3N71A 3KMJA 4JDSA 3F9YA 2W5YA 3QWPA 5F5EA 4YPUA 3IHXA 4AU7A 5KJKA 3M55A 5EX3A 5JINA 3RJWA 5KJNA 3DB5A 3M58A 3QWVA 2BQZA 3OXGA 2R3AA 3HNAA 3PDNA 4Z4PA 4O30A 5F6KC 2G46A 4YNMA 4H12A 3MO5A 3S7FA 3K5KA 1MVHA 5CPRB 5CCMA 3F9XA 1XQHA 5AYFA 3FPDA 4LDGA 4MI5A 5KJLA 3QWWA 3S8PA 3CBPA 4YPEA 5EG2A 5ARFA 3M57A 3F9ZA
chains in the Genus database with same CATH superfamily
3OPEA 3F9WA 4J8OA 1ZKKA 3OXLA 3M53A 4QEPA 4I51A 5F59A 3MO2A 3BO5A 3M59A 3KMAA 5CCLA 1N6AA 3TG4A 3S7BA 3S7DA 4IJ8A 3RIBA 5TEGA 1MVXA 5JIYA 3OXFA 5HI7A 3CBOA 5HQ8A 3M54A 1PEGA 5ARGA 5T5GA 2O8JA 1O9SA 4RZ0A 4NVQA 4YNPA 4J7FA 2QPWA 4YNDA 3S7JA 4FMUA 4QEOA 3KMTA 3TG5A 3DALA 4O6FA 3VUZA 4J7IA 3MO0A 3VV0A 1N6CA 5EX0A 3RQ4A 5F6LA 4IJDA 3SWCA 3M56A 3OS5A 5JHNA 5TTFA 4MI0A 1MT6A 3OOIA 1H3IA 2RFIA 5T0KA 3MEKA 3RAYA 3M5AA 5LSXA 5TH7A 2W5ZA 4NJ5A 4YPAA 5T0MA 5KJMA 2IGQA 3EP0A 4C1QA 2F69A 5JJ0A 3CBMA 4QENA 4WUYA 4BUPA 1MUFA 3SW9A 3RU0A 4J83A 4E47A 2JV0A 1N3JA 5LSZA 1ML9A 4JLGA 3N71A 3KMJA 4JDSA 3F9YA 2W5YA 3QWPA 5F5EA 4YPUA 3IHXA 4AU7A 5KJKA 3M55A 5EX3A 5JINA 3RJWA 5KJNA 3DB5A 3M58A 3QWVA 2BQZA 3OXGA 2R3AA 3HNAA 3PDNA 4Z4PA 4O30A 5F6KC 2G46A 4YNMA 4H12A 3MO5A 3S7FA 3K5KA 1MVHA 5CPRB 5CCMA 3F9XA 1XQHA 5AYFA 3FPDA 4LDGA 4MI5A 5KJLA 3QWWA 3S8PA 3CBPA 4YPEA 5EG2A 5ARFA 3M57A 3F9ZA
chains in the Genus database with same CATH topology
3OPEA 3F9WA 4J8OA 1ZKKA 3OXLA 3M53A 4QEPA 4I51A 5F59A 3MO2A 3BO5A 3M59A 3KMAA 5CCLA 1N6AA 3TG4A 3S7BA 3S7DA 4IJ8A 3RIBA 5TEGA 1MVXA 5JIYA 3OXFA 5HI7A 3CBOA 5HQ8A 3M54A 1PEGA 5ARGA 5T5GA 2O8JA 1O9SA 4RZ0A 4NVQA 4YNPA 4J7FA 2QPWA 4YNDA 3S7JA 4FMUA 4QEOA 3KMTA 3TG5A 3DALA 4O6FA 3VUZA 4J7IA 3MO0A 3VV0A 1N6CA 5EX0A 3RQ4A 5F6LA 4IJDA 3SWCA 3M56A 3OS5A 5JHNA 5TTFA 4MI0A 1MT6A 3OOIA 1H3IA 2RFIA 5T0KA 3MEKA 3RAYA 3M5AA 5LSXA 5TH7A 2W5ZA 4NJ5A 4YPAA 5T0MA 5KJMA 2IGQA 3EP0A 4C1QA 2F69A 5JJ0A 3CBMA 4QENA 4WUYA 4BUPA 1MUFA 3SW9A 3RU0A 4J83A 4E47A 2JV0A 1N3JA 5LSZA 1ML9A 4JLGA 3N71A 3KMJA 4JDSA 3F9YA 2W5YA 3QWPA 5F5EA 4YPUA 3IHXA 4AU7A 5KJKA 3M55A 5EX3A 5JINA 3RJWA 5KJNA 3DB5A 3M58A 3QWVA 2BQZA 3OXGA 2R3AA 3HNAA 3PDNA 4Z4PA 4O30A 5F6KC 2G46A 4YNMA 4H12A 3MO5A 3S7FA 3K5KA 1MVHA 5CPRB 5CCMA 3F9XA 1XQHA 5AYFA 3FPDA 4LDGA 4MI5A 5KJLA 3QWWA 3S8PA 3CBPA 4YPEA 5EG2A 5ARFA 3M57A 3F9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OPE A;  3F9W A;  4J8O A;  1ZKK A;  3OXL A;  3M53 A;  4QEP A;  4I51 A;  5F59 A;  3MO2 A;  3BO5 A;  3M59 A;  3KMA A;  5CCL A;  1N6A A;  3TG4 A;  3S7B A;  3S7D A;  4IJ8 A;  3RIB A;  5TEG A;  1MVX A;  5JIY A;  3OXF A;  5HI7 A;  3CBO A;  5HQ8 A;  3M54 A;  1PEG A;  5ARG A;  5T5G A;  2O8J A;  1O9S A;  4RZ0 A;  4NVQ A;  4YNP A;  4J7F A;  2QPW A;  4YND A;  3S7J A;  4FMU A;  4QEO A;  3KMT A;  3TG5 A;  3DAL A;  4O6F A;  3VUZ A;  4J7I A;  3MO0 A;  3VV0 A;  1N6C A;  5EX0 A;  3RQ4 A;  5F6L A;  4IJD A;  3SWC A;  3M56 A;  3OS5 A;  5JHN A;  5TTF A;  4MI0 A;  1MT6 A;  3OOI A;  1H3I A;  2RFI A;  5T0K A;  3MEK A;  3RAY A;  3M5A A;  5LSX A;  5TH7 A;  2W5Z A;  4NJ5 A;  4YPA A;  5T0M A;  5KJM A;  2IGQ A;  3EP0 A;  4C1Q A;  2F69 A;  5JJ0 A;  3CBM A;  4QEN A;  4WUY A;  4BUP A;  1MUF A;  3SW9 A;  3RU0 A;  4J83 A;  4E47 A;  2JV0 A;  1N3J A;  5LSZ A;  1ML9 A;  4JLG A;  3N71 A;  3KMJ A;  4JDS A;  3F9Y A;  2W5Y A;  3QWP A;  5F5E A;  4YPU A;  3IHX A;  4AU7 A;  5KJK A;  3M55 A;  5EX3 A;  5JIN A;  3RJW A;  5KJN A;  3DB5 A;  3M58 A;  3QWV A;  2BQZ A;  3OXG A;  2R3A A;  3HNA A;  3PDN A;  4Z4P A;  4O30 A;  5F6K C;  2G46 A;  4YNM A;  4H12 A;  3MO5 A;  3S7F A;  3K5K A;  1MVH A;  5CPR B;  5CCM A;  3F9X A;  1XQH A;  5AYF A;  3FPD A;  4LDG A;  4MI5 A;  5KJL A;  3QWW A;  3S8P A;  3CBP A;  4YPE A;  5EG2 A;  5ARF A;  3M57 A;  3F9Z A; 
#chains in the Genus database with same CATH topology
 3OPE A;  3F9W A;  4J8O A;  1ZKK A;  3OXL A;  3M53 A;  4QEP A;  4I51 A;  5F59 A;  3MO2 A;  3BO5 A;  3M59 A;  3KMA A;  5CCL A;  1N6A A;  3TG4 A;  3S7B A;  3S7D A;  4IJ8 A;  3RIB A;  5TEG A;  1MVX A;  5JIY A;  3OXF A;  5HI7 A;  3CBO A;  5HQ8 A;  3M54 A;  1PEG A;  5ARG A;  5T5G A;  2O8J A;  1O9S A;  4RZ0 A;  4NVQ A;  4YNP A;  4J7F A;  2QPW A;  4YND A;  3S7J A;  4FMU A;  4QEO A;  3KMT A;  3TG5 A;  3DAL A;  4O6F A;  3VUZ A;  4J7I A;  3MO0 A;  3VV0 A;  1N6C A;  5EX0 A;  3RQ4 A;  5F6L A;  4IJD A;  3SWC A;  3M56 A;  3OS5 A;  5JHN A;  5TTF A;  4MI0 A;  1MT6 A;  3OOI A;  1H3I A;  2RFI A;  5T0K A;  3MEK A;  3RAY A;  3M5A A;  5LSX A;  5TH7 A;  2W5Z A;  4NJ5 A;  4YPA A;  5T0M A;  5KJM A;  2IGQ A;  3EP0 A;  4C1Q A;  2F69 A;  5JJ0 A;  3CBM A;  4QEN A;  4WUY A;  4BUP A;  1MUF A;  3SW9 A;  3RU0 A;  4J83 A;  4E47 A;  2JV0 A;  1N3J A;  5LSZ A;  1ML9 A;  4JLG A;  3N71 A;  3KMJ A;  4JDS A;  3F9Y A;  2W5Y A;  3QWP A;  5F5E A;  4YPU A;  3IHX A;  4AU7 A;  5KJK A;  3M55 A;  5EX3 A;  5JIN A;  3RJW A;  5KJN A;  3DB5 A;  3M58 A;  3QWV A;  2BQZ A;  3OXG A;  2R3A A;  3HNA A;  3PDN A;  4Z4P A;  4O30 A;  5F6K C;  2G46 A;  4YNM A;  4H12 A;  3MO5 A;  3S7F A;  3K5K A;  1MVH A;  5CPR B;  5CCM A;  3F9X A;  1XQH A;  5AYF A;  3FPD A;  4LDG A;  4MI5 A;  5KJL A;  3QWW A;  3S8P A;  3CBP A;  4YPE A;  5EG2 A;  5ARF A;  3M57 A;  3F9Z A; 
#chains in the Genus database with same CATH homology
 3OPE A;  3F9W A;  4J8O A;  1ZKK A;  3OXL A;  3M53 A;  4QEP A;  4I51 A;  5F59 A;  3MO2 A;  3BO5 A;  3M59 A;  3KMA A;  5CCL A;  1N6A A;  3TG4 A;  3S7B A;  3S7D A;  4IJ8 A;  3RIB A;  5TEG A;  1MVX A;  5JIY A;  3OXF A;  5HI7 A;  3CBO A;  5HQ8 A;  3M54 A;  1PEG A;  5ARG A;  5T5G A;  2O8J A;  1O9S A;  4RZ0 A;  4NVQ A;  4YNP A;  4J7F A;  2QPW A;  4YND A;  3S7J A;  4FMU A;  4QEO A;  3KMT A;  3TG5 A;  3DAL A;  4O6F A;  3VUZ A;  4J7I A;  3MO0 A;  3VV0 A;  1N6C A;  5EX0 A;  3RQ4 A;  5F6L A;  4IJD A;  3SWC A;  3M56 A;  3OS5 A;  5JHN A;  5TTF A;  4MI0 A;  1MT6 A;  3OOI A;  1H3I A;  2RFI A;  5T0K A;  3MEK A;  3RAY A;  3M5A A;  5LSX A;  5TH7 A;  2W5Z A;  4NJ5 A;  4YPA A;  5T0M A;  5KJM A;  2IGQ A;  3EP0 A;  4C1Q A;  2F69 A;  5JJ0 A;  3CBM A;  4QEN A;  4WUY A;  4BUP A;  1MUF A;  3SW9 A;  3RU0 A;  4J83 A;  4E47 A;  2JV0 A;  1N3J A;  5LSZ A;  1ML9 A;  4JLG A;  3N71 A;  3KMJ A;  4JDS A;  3F9Y A;  2W5Y A;  3QWP A;  5F5E A;  4YPU A;  3IHX A;  4AU7 A;  5KJK A;  3M55 A;  5EX3 A;  5JIN A;  3RJW A;  5KJN A;  3DB5 A;  3M58 A;  3QWV A;  2BQZ A;  3OXG A;  2R3A A;  3HNA A;  3PDN A;  4Z4P A;  4O30 A;  5F6K C;  2G46 A;  4YNM A;  4H12 A;  3MO5 A;  3S7F A;  3K5K A;  1MVH A;  5CPR B;  5CCM A;  3F9X A;  1XQH A;  5AYF A;  3FPD A;  4LDG A;  4MI5 A;  5KJL A;  3QWW A;  3S8P A;  3CBP A;  4YPE A;  5EG2 A;  5ARF A;  3M57 A;  3F9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...