2BQZA

Crystal structure of a ternary complex of the human histone methyltransferase pr-set7 (also known as set8)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
161
structure length
161
Chain Sequence
RKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SET8 PROTEIN
publication title Specificity and Mechanism of the Histone Methyltransferase Pr-Set7
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 44
structure length 161
sequence length 161
chains with identical sequence E
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2005-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2bqzA00
3M56A 3KMTA 3N71A 4YNMA 3VV0A 2W5ZA 3OS5A 4WUYA 3S7FA 5JINA 4RZ0A 5KJMA 4I51A 5KJLA 3MO5A 5EG2A 1N3JA 2O8JA 5CCMA 4H12A 4O6FA 3S7BA 3DALA 4LDGA 3M57A 3EP0A 2F69A 2W5YA 4YNDA 3M59A 3SW9A 5ARFA 4AU7A 5KJNA 4NVQA 1ML9A 1MVHA 4BUPA 5TEGA 4C1QA 4NJ5A 3CBMA 5AYFA 3MO2A 3S7DA 5JIYA 5F6LA 4QEPA 5F6KC 3DB5A 4QENA 3M54A 4YPAA 3KMJA 4Z4PA 4JDSA 1ZKKA 5TTFA 3F9WA 4MI0A 3MO0A 5T0MA 3QWWA 3BO5A 3F9XA 4IJDA 5KJKA 1N6AA 1MUFA 4J7FA 3RJWA 4FMUA 3S8PA 1H3IA 3RAYA 3TG4A 3VUZA 3S7JA 4O30A 5F5EA 3TG5A 3PDNA 5T5GA 5JHNA 1N6CA 3F9ZA 5T0KA 3OXLA 5F59A 2QPWA 2JV0A 3QWVA 5TH7A 4IJ8A 3M5AA 5LSZA 3K5KA 4J83A 3HNAA 1PEGA 3FPDA 1MVXA 4YNPA 3QWPA 5EX3A 3M53A 5HI7A 2RFIA 5JJ0A 3F9YA 4YPUA 3RU0A 4QEOA 3SWCA 4YPEA 4E47A 1MT6A 4J8OA 5EX0A 5ARGA 3M58A 3OXFA 2R3AA 5CCLA 3RQ4A 4MI5A 5HQ8A 3KMAA 3MEKA 2IGQA 2G46A 3OPEA 1XQHA 1O9SA 2BQZA 4J7IA 3CBOA 3CBPA 3M55A 3OOIA 3OXGA 5LSXA 3RIBA 4JLGA 5CPRB 3IHXA
chains in the Genus database with same CATH superfamily
3M56A 3KMTA 3N71A 4YNMA 3VV0A 2W5ZA 3OS5A 4WUYA 3S7FA 5JINA 4RZ0A 5KJMA 4I51A 5KJLA 3MO5A 5EG2A 1N3JA 2O8JA 5CCMA 4H12A 4O6FA 3S7BA 3DALA 4LDGA 3M57A 3EP0A 2F69A 2W5YA 4YNDA 3M59A 3SW9A 5ARFA 4AU7A 5KJNA 4NVQA 1ML9A 1MVHA 4BUPA 5TEGA 4C1QA 4NJ5A 3CBMA 5AYFA 3MO2A 3S7DA 5JIYA 5F6LA 4QEPA 5F6KC 3DB5A 4QENA 3M54A 4YPAA 3KMJA 4Z4PA 4JDSA 1ZKKA 5TTFA 3F9WA 4MI0A 3MO0A 5T0MA 3QWWA 3BO5A 3F9XA 4IJDA 5KJKA 1N6AA 1MUFA 4J7FA 3RJWA 4FMUA 3S8PA 1H3IA 3RAYA 3TG4A 3VUZA 3S7JA 4O30A 5F5EA 3TG5A 3PDNA 5T5GA 5JHNA 1N6CA 3F9ZA 5T0KA 3OXLA 5F59A 2QPWA 2JV0A 3QWVA 5TH7A 4IJ8A 3M5AA 5LSZA 3K5KA 4J83A 3HNAA 1PEGA 3FPDA 1MVXA 4YNPA 3QWPA 5EX3A 3M53A 5HI7A 2RFIA 5JJ0A 3F9YA 4YPUA 3RU0A 4QEOA 3SWCA 4YPEA 4E47A 1MT6A 4J8OA 5EX0A 5ARGA 3M58A 3OXFA 2R3AA 5CCLA 3RQ4A 4MI5A 5HQ8A 3KMAA 3MEKA 2IGQA 2G46A 3OPEA 1XQHA 1O9SA 2BQZA 4J7IA 3CBOA 3CBPA 3M55A 3OOIA 3OXGA 5LSXA 3RIBA 4JLGA 5CPRB 3IHXA
chains in the Genus database with same CATH topology
3M56A 3KMTA 3N71A 4YNMA 3VV0A 2W5ZA 3OS5A 4WUYA 3S7FA 5JINA 4RZ0A 5KJMA 4I51A 5KJLA 3MO5A 5EG2A 1N3JA 2O8JA 5CCMA 4H12A 4O6FA 3S7BA 3DALA 4LDGA 3M57A 3EP0A 2F69A 2W5YA 4YNDA 3M59A 3SW9A 5ARFA 4AU7A 5KJNA 4NVQA 1ML9A 1MVHA 4BUPA 5TEGA 4C1QA 4NJ5A 3CBMA 5AYFA 3MO2A 3S7DA 5JIYA 5F6LA 4QEPA 5F6KC 3DB5A 4QENA 3M54A 4YPAA 3KMJA 4Z4PA 4JDSA 1ZKKA 5TTFA 3F9WA 4MI0A 3MO0A 5T0MA 3QWWA 3BO5A 3F9XA 4IJDA 5KJKA 1N6AA 1MUFA 4J7FA 3RJWA 4FMUA 3S8PA 1H3IA 3RAYA 3TG4A 3VUZA 3S7JA 4O30A 5F5EA 3TG5A 3PDNA 5T5GA 5JHNA 1N6CA 3F9ZA 5T0KA 3OXLA 5F59A 2QPWA 2JV0A 3QWVA 5TH7A 4IJ8A 3M5AA 5LSZA 3K5KA 4J83A 3HNAA 1PEGA 3FPDA 1MVXA 4YNPA 3QWPA 5EX3A 3M53A 5HI7A 2RFIA 5JJ0A 3F9YA 4YPUA 3RU0A 4QEOA 3SWCA 4YPEA 4E47A 1MT6A 4J8OA 5EX0A 5ARGA 3M58A 3OXFA 2R3AA 5CCLA 3RQ4A 4MI5A 5HQ8A 3KMAA 3MEKA 2IGQA 2G46A 3OPEA 1XQHA 1O9SA 2BQZA 4J7IA 3CBOA 3CBPA 3M55A 3OOIA 3OXGA 5LSXA 3RIBA 4JLGA 5CPRB 3IHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M56 A;  3KMT A;  3N71 A;  4YNM A;  3VV0 A;  2W5Z A;  3OS5 A;  4WUY A;  3S7F A;  5JIN A;  4RZ0 A;  5KJM A;  4I51 A;  5KJL A;  3MO5 A;  5EG2 A;  1N3J A;  2O8J A;  5CCM A;  4H12 A;  4O6F A;  3S7B A;  3DAL A;  4LDG A;  3M57 A;  3EP0 A;  2F69 A;  2W5Y A;  4YND A;  3M59 A;  3SW9 A;  5ARF A;  4AU7 A;  5KJN A;  4NVQ A;  1ML9 A;  1MVH A;  4BUP A;  5TEG A;  4C1Q A;  4NJ5 A;  3CBM A;  5AYF A;  3MO2 A;  3S7D A;  5JIY A;  5F6L A;  4QEP A;  5F6K C;  3DB5 A;  4QEN A;  3M54 A;  4YPA A;  3KMJ A;  4Z4P A;  4JDS A;  1ZKK A;  5TTF A;  3F9W A;  4MI0 A;  3MO0 A;  5T0M A;  3QWW A;  3BO5 A;  3F9X A;  4IJD A;  5KJK A;  1N6A A;  1MUF A;  4J7F A;  3RJW A;  4FMU A;  3S8P A;  1H3I A;  3RAY A;  3TG4 A;  3VUZ A;  3S7J A;  4O30 A;  5F5E A;  3TG5 A;  3PDN A;  5T5G A;  5JHN A;  1N6C A;  3F9Z A;  5T0K A;  3OXL A;  5F59 A;  2QPW A;  2JV0 A;  3QWV A;  5TH7 A;  4IJ8 A;  3M5A A;  5LSZ A;  3K5K A;  4J83 A;  3HNA A;  1PEG A;  3FPD A;  1MVX A;  4YNP A;  3QWP A;  5EX3 A;  3M53 A;  5HI7 A;  2RFI A;  5JJ0 A;  3F9Y A;  4YPU A;  3RU0 A;  4QEO A;  3SWC A;  4YPE A;  4E47 A;  1MT6 A;  4J8O A;  5EX0 A;  5ARG A;  3M58 A;  3OXF A;  2R3A A;  5CCL A;  3RQ4 A;  4MI5 A;  5HQ8 A;  3KMA A;  3MEK A;  2IGQ A;  2G46 A;  3OPE A;  1XQH A;  1O9S A;  2BQZ A;  4J7I A;  3CBO A;  3CBP A;  3M55 A;  3OOI A;  3OXG A;  5LSX A;  3RIB A;  4JLG A;  5CPR B;  3IHX A; 
#chains in the Genus database with same CATH topology
 3M56 A;  3KMT A;  3N71 A;  4YNM A;  3VV0 A;  2W5Z A;  3OS5 A;  4WUY A;  3S7F A;  5JIN A;  4RZ0 A;  5KJM A;  4I51 A;  5KJL A;  3MO5 A;  5EG2 A;  1N3J A;  2O8J A;  5CCM A;  4H12 A;  4O6F A;  3S7B A;  3DAL A;  4LDG A;  3M57 A;  3EP0 A;  2F69 A;  2W5Y A;  4YND A;  3M59 A;  3SW9 A;  5ARF A;  4AU7 A;  5KJN A;  4NVQ A;  1ML9 A;  1MVH A;  4BUP A;  5TEG A;  4C1Q A;  4NJ5 A;  3CBM A;  5AYF A;  3MO2 A;  3S7D A;  5JIY A;  5F6L A;  4QEP A;  5F6K C;  3DB5 A;  4QEN A;  3M54 A;  4YPA A;  3KMJ A;  4Z4P A;  4JDS A;  1ZKK A;  5TTF A;  3F9W A;  4MI0 A;  3MO0 A;  5T0M A;  3QWW A;  3BO5 A;  3F9X A;  4IJD A;  5KJK A;  1N6A A;  1MUF A;  4J7F A;  3RJW A;  4FMU A;  3S8P A;  1H3I A;  3RAY A;  3TG4 A;  3VUZ A;  3S7J A;  4O30 A;  5F5E A;  3TG5 A;  3PDN A;  5T5G A;  5JHN A;  1N6C A;  3F9Z A;  5T0K A;  3OXL A;  5F59 A;  2QPW A;  2JV0 A;  3QWV A;  5TH7 A;  4IJ8 A;  3M5A A;  5LSZ A;  3K5K A;  4J83 A;  3HNA A;  1PEG A;  3FPD A;  1MVX A;  4YNP A;  3QWP A;  5EX3 A;  3M53 A;  5HI7 A;  2RFI A;  5JJ0 A;  3F9Y A;  4YPU A;  3RU0 A;  4QEO A;  3SWC A;  4YPE A;  4E47 A;  1MT6 A;  4J8O A;  5EX0 A;  5ARG A;  3M58 A;  3OXF A;  2R3A A;  5CCL A;  3RQ4 A;  4MI5 A;  5HQ8 A;  3KMA A;  3MEK A;  2IGQ A;  2G46 A;  3OPE A;  1XQH A;  1O9S A;  2BQZ A;  4J7I A;  3CBO A;  3CBP A;  3M55 A;  3OOI A;  3OXG A;  5LSX A;  3RIB A;  4JLG A;  5CPR B;  3IHX A; 
#chains in the Genus database with same CATH homology
 3M56 A;  3KMT A;  3N71 A;  4YNM A;  3VV0 A;  2W5Z A;  3OS5 A;  4WUY A;  3S7F A;  5JIN A;  4RZ0 A;  5KJM A;  4I51 A;  5KJL A;  3MO5 A;  5EG2 A;  1N3J A;  2O8J A;  5CCM A;  4H12 A;  4O6F A;  3S7B A;  3DAL A;  4LDG A;  3M57 A;  3EP0 A;  2F69 A;  2W5Y A;  4YND A;  3M59 A;  3SW9 A;  5ARF A;  4AU7 A;  5KJN A;  4NVQ A;  1ML9 A;  1MVH A;  4BUP A;  5TEG A;  4C1Q A;  4NJ5 A;  3CBM A;  5AYF A;  3MO2 A;  3S7D A;  5JIY A;  5F6L A;  4QEP A;  5F6K C;  3DB5 A;  4QEN A;  3M54 A;  4YPA A;  3KMJ A;  4Z4P A;  4JDS A;  1ZKK A;  5TTF A;  3F9W A;  4MI0 A;  3MO0 A;  5T0M A;  3QWW A;  3BO5 A;  3F9X A;  4IJD A;  5KJK A;  1N6A A;  1MUF A;  4J7F A;  3RJW A;  4FMU A;  3S8P A;  1H3I A;  3RAY A;  3TG4 A;  3VUZ A;  3S7J A;  4O30 A;  5F5E A;  3TG5 A;  3PDN A;  5T5G A;  5JHN A;  1N6C A;  3F9Z A;  5T0K A;  3OXL A;  5F59 A;  2QPW A;  2JV0 A;  3QWV A;  5TH7 A;  4IJ8 A;  3M5A A;  5LSZ A;  3K5K A;  4J83 A;  3HNA A;  1PEG A;  3FPD A;  1MVX A;  4YNP A;  3QWP A;  5EX3 A;  3M53 A;  5HI7 A;  2RFI A;  5JJ0 A;  3F9Y A;  4YPU A;  3RU0 A;  4QEO A;  3SWC A;  4YPE A;  4E47 A;  1MT6 A;  4J8O A;  5EX0 A;  5ARG A;  3M58 A;  3OXF A;  2R3A A;  5CCL A;  3RQ4 A;  4MI5 A;  5HQ8 A;  3KMA A;  3MEK A;  2IGQ A;  2G46 A;  3OPE A;  1XQH A;  1O9S A;  2BQZ A;  4J7I A;  3CBO A;  3CBP A;  3M55 A;  3OOI A;  3OXG A;  5LSX A;  3RIB A;  4JLG A;  5CPR B;  3IHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...