2BQZA

Crystal structure of a ternary complex of the human histone methyltransferase pr-set7 (also known as set8)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
161
structure length
161
Chain Sequence
RKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords SET8 PROTEIN
publication title Specificity and Mechanism of the Histone Methyltransferase Pr-Set7
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 161
sequence length 161
chains with identical sequence E
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2005-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2bqzA00
3OXGA 5CCMA 3CBOA 3OS5A 3OOIA 1H3IA 3M53A 3MO2A 3OXLA 4J83A 1N3JA 2JV0A 3K5KA 3SW9A 2O8JA 3S7DA 3RQ4A 4FMUA 4NJ5A 5EX0A 3MEKA 4JDSA 2W5ZA 3VV0A 4MI0A 2W5YA 2RFIA 3FPDA 3KMAA 4O6FA 3N71A 5LSZA 3CBPA 3M58A 4J7IA 2IGQA 3OXFA 5T5GA 5JIYA 5EG2A 3RJWA 3OPEA 5F6LA 3S8PA 3M54A 4C1QA 1MVXA 1ML9A 3IHXA 3F9XA 3SWCA 1O9SA 3KMTA 4QEPA 3VUZA 4YNMA 5JHNA 4Z4PA 4I51A 4YPAA 3BO5A 3M57A 4QEOA 4YPUA 5KJMA 1PEGA 5TEGA 5F59A 5F5EA 4O30A 5T0KA 3F9ZA 2F69A 5JINA 2BQZA 5KJKA 3QWPA 3QWVA 4AU7A 4RZ0A 5T0MA 5KJLA 1MUFA 5ARFA 2G46A 4JLGA 3TG4A 3DB5A 5AYFA 3RAYA 4IJ8A 1N6CA 1ZKKA 3S7BA 3CBMA 5ARGA 3MO0A 4E47A 4J8OA 4MI5A 5LSXA 1MT6A 5HQ8A 2R3AA 3M59A 3PDNA 4YPEA 5HI7A 3S7FA 5F6KC 4BUPA 5JJ0A 3RU0A 3RIBA 2QPWA 5CPRB 3S7JA 4YNPA 3HNAA 3KMJA 1XQHA 4IJDA 3DALA 1N6AA 3F9YA 3QWWA 1MVHA 4H12A 4WUYA 5CCLA 5KJNA 3M55A 3M5AA 3F9WA 5TTFA 4NVQA 4QENA 4J7FA 3EP0A 3M56A 3TG5A 4LDGA 3MO5A 4YNDA 5TH7A 5EX3A
chains in the Genus database with same CATH superfamily
3OXGA 5CCMA 3CBOA 3OS5A 3OOIA 1H3IA 3M53A 3MO2A 3OXLA 4J83A 1N3JA 2JV0A 3K5KA 3SW9A 2O8JA 3S7DA 3RQ4A 4FMUA 4NJ5A 5EX0A 3MEKA 4JDSA 2W5ZA 3VV0A 4MI0A 2W5YA 2RFIA 3FPDA 3KMAA 4O6FA 3N71A 5LSZA 3CBPA 3M58A 4J7IA 2IGQA 3OXFA 5T5GA 5JIYA 5EG2A 3RJWA 3OPEA 5F6LA 3S8PA 3M54A 4C1QA 1MVXA 1ML9A 3IHXA 3F9XA 3SWCA 1O9SA 3KMTA 4QEPA 3VUZA 4YNMA 5JHNA 4Z4PA 4I51A 4YPAA 3BO5A 3M57A 4QEOA 4YPUA 5KJMA 1PEGA 5TEGA 5F59A 5F5EA 4O30A 5T0KA 3F9ZA 2F69A 5JINA 2BQZA 5KJKA 3QWPA 3QWVA 4AU7A 4RZ0A 5T0MA 5KJLA 1MUFA 5ARFA 2G46A 4JLGA 3TG4A 3DB5A 5AYFA 3RAYA 4IJ8A 1N6CA 1ZKKA 3S7BA 3CBMA 5ARGA 3MO0A 4E47A 4J8OA 4MI5A 5LSXA 1MT6A 5HQ8A 2R3AA 3M59A 3PDNA 4YPEA 5HI7A 3S7FA 5F6KC 4BUPA 5JJ0A 3RU0A 3RIBA 2QPWA 5CPRB 3S7JA 4YNPA 3HNAA 3KMJA 1XQHA 4IJDA 3DALA 1N6AA 3F9YA 3QWWA 1MVHA 4H12A 4WUYA 5CCLA 5KJNA 3M55A 3M5AA 3F9WA 5TTFA 4NVQA 4QENA 4J7FA 3EP0A 3M56A 3TG5A 4LDGA 3MO5A 4YNDA 5TH7A 5EX3A
chains in the Genus database with same CATH topology
3OXGA 5CCMA 3CBOA 3OS5A 3OOIA 1H3IA 3M53A 3MO2A 3OXLA 4J83A 1N3JA 2JV0A 3K5KA 3SW9A 2O8JA 3S7DA 3RQ4A 4FMUA 4NJ5A 5EX0A 3MEKA 4JDSA 2W5ZA 3VV0A 4MI0A 2W5YA 2RFIA 3FPDA 3KMAA 4O6FA 3N71A 5LSZA 3CBPA 3M58A 4J7IA 2IGQA 3OXFA 5T5GA 5JIYA 5EG2A 3RJWA 3OPEA 5F6LA 3S8PA 3M54A 4C1QA 1MVXA 1ML9A 3IHXA 3F9XA 3SWCA 1O9SA 3KMTA 4QEPA 3VUZA 4YNMA 5JHNA 4Z4PA 4I51A 4YPAA 3BO5A 3M57A 4QEOA 4YPUA 5KJMA 1PEGA 5TEGA 5F59A 5F5EA 4O30A 5T0KA 3F9ZA 2F69A 5JINA 2BQZA 5KJKA 3QWPA 3QWVA 4AU7A 4RZ0A 5T0MA 5KJLA 1MUFA 5ARFA 2G46A 4JLGA 3TG4A 3DB5A 5AYFA 3RAYA 4IJ8A 1N6CA 1ZKKA 3S7BA 3CBMA 5ARGA 3MO0A 4E47A 4J8OA 4MI5A 5LSXA 1MT6A 5HQ8A 2R3AA 3M59A 3PDNA 4YPEA 5HI7A 3S7FA 5F6KC 4BUPA 5JJ0A 3RU0A 3RIBA 2QPWA 5CPRB 3S7JA 4YNPA 3HNAA 3KMJA 1XQHA 4IJDA 3DALA 1N6AA 3F9YA 3QWWA 1MVHA 4H12A 4WUYA 5CCLA 5KJNA 3M55A 3M5AA 3F9WA 5TTFA 4NVQA 4QENA 4J7FA 3EP0A 3M56A 3TG5A 4LDGA 3MO5A 4YNDA 5TH7A 5EX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OXG A;  5CCM A;  3CBO A;  3OS5 A;  3OOI A;  1H3I A;  3M53 A;  3MO2 A;  3OXL A;  4J83 A;  1N3J A;  2JV0 A;  3K5K A;  3SW9 A;  2O8J A;  3S7D A;  3RQ4 A;  4FMU A;  4NJ5 A;  5EX0 A;  3MEK A;  4JDS A;  2W5Z A;  3VV0 A;  4MI0 A;  2W5Y A;  2RFI A;  3FPD A;  3KMA A;  4O6F A;  3N71 A;  5LSZ A;  3CBP A;  3M58 A;  4J7I A;  2IGQ A;  3OXF A;  5T5G A;  5JIY A;  5EG2 A;  3RJW A;  3OPE A;  5F6L A;  3S8P A;  3M54 A;  4C1Q A;  1MVX A;  1ML9 A;  3IHX A;  3F9X A;  3SWC A;  1O9S A;  3KMT A;  4QEP A;  3VUZ A;  4YNM A;  5JHN A;  4Z4P A;  4I51 A;  4YPA A;  3BO5 A;  3M57 A;  4QEO A;  4YPU A;  5KJM A;  1PEG A;  5TEG A;  5F59 A;  5F5E A;  4O30 A;  5T0K A;  3F9Z A;  2F69 A;  5JIN A;  2BQZ A;  5KJK A;  3QWP A;  3QWV A;  4AU7 A;  4RZ0 A;  5T0M A;  5KJL A;  1MUF A;  5ARF A;  2G46 A;  4JLG A;  3TG4 A;  3DB5 A;  5AYF A;  3RAY A;  4IJ8 A;  1N6C A;  1ZKK A;  3S7B A;  3CBM A;  5ARG A;  3MO0 A;  4E47 A;  4J8O A;  4MI5 A;  5LSX A;  1MT6 A;  5HQ8 A;  2R3A A;  3M59 A;  3PDN A;  4YPE A;  5HI7 A;  3S7F A;  5F6K C;  4BUP A;  5JJ0 A;  3RU0 A;  3RIB A;  2QPW A;  5CPR B;  3S7J A;  4YNP A;  3HNA A;  3KMJ A;  1XQH A;  4IJD A;  3DAL A;  1N6A A;  3F9Y A;  3QWW A;  1MVH A;  4H12 A;  4WUY A;  5CCL A;  5KJN A;  3M55 A;  3M5A A;  3F9W A;  5TTF A;  4NVQ A;  4QEN A;  4J7F A;  3EP0 A;  3M56 A;  3TG5 A;  4LDG A;  3MO5 A;  4YND A;  5TH7 A;  5EX3 A; 
#chains in the Genus database with same CATH topology
 3OXG A;  5CCM A;  3CBO A;  3OS5 A;  3OOI A;  1H3I A;  3M53 A;  3MO2 A;  3OXL A;  4J83 A;  1N3J A;  2JV0 A;  3K5K A;  3SW9 A;  2O8J A;  3S7D A;  3RQ4 A;  4FMU A;  4NJ5 A;  5EX0 A;  3MEK A;  4JDS A;  2W5Z A;  3VV0 A;  4MI0 A;  2W5Y A;  2RFI A;  3FPD A;  3KMA A;  4O6F A;  3N71 A;  5LSZ A;  3CBP A;  3M58 A;  4J7I A;  2IGQ A;  3OXF A;  5T5G A;  5JIY A;  5EG2 A;  3RJW A;  3OPE A;  5F6L A;  3S8P A;  3M54 A;  4C1Q A;  1MVX A;  1ML9 A;  3IHX A;  3F9X A;  3SWC A;  1O9S A;  3KMT A;  4QEP A;  3VUZ A;  4YNM A;  5JHN A;  4Z4P A;  4I51 A;  4YPA A;  3BO5 A;  3M57 A;  4QEO A;  4YPU A;  5KJM A;  1PEG A;  5TEG A;  5F59 A;  5F5E A;  4O30 A;  5T0K A;  3F9Z A;  2F69 A;  5JIN A;  2BQZ A;  5KJK A;  3QWP A;  3QWV A;  4AU7 A;  4RZ0 A;  5T0M A;  5KJL A;  1MUF A;  5ARF A;  2G46 A;  4JLG A;  3TG4 A;  3DB5 A;  5AYF A;  3RAY A;  4IJ8 A;  1N6C A;  1ZKK A;  3S7B A;  3CBM A;  5ARG A;  3MO0 A;  4E47 A;  4J8O A;  4MI5 A;  5LSX A;  1MT6 A;  5HQ8 A;  2R3A A;  3M59 A;  3PDN A;  4YPE A;  5HI7 A;  3S7F A;  5F6K C;  4BUP A;  5JJ0 A;  3RU0 A;  3RIB A;  2QPW A;  5CPR B;  3S7J A;  4YNP A;  3HNA A;  3KMJ A;  1XQH A;  4IJD A;  3DAL A;  1N6A A;  3F9Y A;  3QWW A;  1MVH A;  4H12 A;  4WUY A;  5CCL A;  5KJN A;  3M55 A;  3M5A A;  3F9W A;  5TTF A;  4NVQ A;  4QEN A;  4J7F A;  3EP0 A;  3M56 A;  3TG5 A;  4LDG A;  3MO5 A;  4YND A;  5TH7 A;  5EX3 A; 
#chains in the Genus database with same CATH homology
 3OXG A;  5CCM A;  3CBO A;  3OS5 A;  3OOI A;  1H3I A;  3M53 A;  3MO2 A;  3OXL A;  4J83 A;  1N3J A;  2JV0 A;  3K5K A;  3SW9 A;  2O8J A;  3S7D A;  3RQ4 A;  4FMU A;  4NJ5 A;  5EX0 A;  3MEK A;  4JDS A;  2W5Z A;  3VV0 A;  4MI0 A;  2W5Y A;  2RFI A;  3FPD A;  3KMA A;  4O6F A;  3N71 A;  5LSZ A;  3CBP A;  3M58 A;  4J7I A;  2IGQ A;  3OXF A;  5T5G A;  5JIY A;  5EG2 A;  3RJW A;  3OPE A;  5F6L A;  3S8P A;  3M54 A;  4C1Q A;  1MVX A;  1ML9 A;  3IHX A;  3F9X A;  3SWC A;  1O9S A;  3KMT A;  4QEP A;  3VUZ A;  4YNM A;  5JHN A;  4Z4P A;  4I51 A;  4YPA A;  3BO5 A;  3M57 A;  4QEO A;  4YPU A;  5KJM A;  1PEG A;  5TEG A;  5F59 A;  5F5E A;  4O30 A;  5T0K A;  3F9Z A;  2F69 A;  5JIN A;  2BQZ A;  5KJK A;  3QWP A;  3QWV A;  4AU7 A;  4RZ0 A;  5T0M A;  5KJL A;  1MUF A;  5ARF A;  2G46 A;  4JLG A;  3TG4 A;  3DB5 A;  5AYF A;  3RAY A;  4IJ8 A;  1N6C A;  1ZKK A;  3S7B A;  3CBM A;  5ARG A;  3MO0 A;  4E47 A;  4J8O A;  4MI5 A;  5LSX A;  1MT6 A;  5HQ8 A;  2R3A A;  3M59 A;  3PDN A;  4YPE A;  5HI7 A;  3S7F A;  5F6K C;  4BUP A;  5JJ0 A;  3RU0 A;  3RIB A;  2QPW A;  5CPR B;  3S7J A;  4YNP A;  3HNA A;  3KMJ A;  1XQH A;  4IJD A;  3DAL A;  1N6A A;  3F9Y A;  3QWW A;  1MVH A;  4H12 A;  4WUY A;  5CCL A;  5KJN A;  3M55 A;  3M5A A;  3F9W A;  5TTF A;  4NVQ A;  4QEN A;  4J7F A;  3EP0 A;  3M56 A;  3TG5 A;  4LDG A;  3MO5 A;  4YND A;  5TH7 A;  5EX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...