3OPEA

Structural basis of auto-inhibitory mechanism of histone methyltransferase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
213
structure length
213
Chain Sequence
SYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable histone-lysine N-methyltransferase ASH1L
publication title Crystal structure of the human histone methyltransferase ASH1L catalytic domain and its implications for the regulatory mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 40
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3opeA00
4IJ8A 5F6KC 5F6LA 3DB5A 4QEOA 3F9XA 3K5KA 5LSXA 3OXGA 3MEKA 3VV0A 4AU7A 5HQ8A 5KJKA 3HNAA 3M57A 5AYFA 5KJLA 2JV0A 3TG4A 3OPEA 3M56A 3OXLA 5TH7A 3S7FA 4QEPA 2QPWA 1N6CA 3IHXA 4YNMA 5CPRB 4NVQA 3QWVA 5LSZA 4YPUA 3EP0A 1N6AA 5HI7A 3OS5A 3S7JA 1MUFA 5ARFA 1O9SA 3S7DA 2BQZA 1ZKKA 2F69A 3F9YA 4MI5A 3M59A 4C1QA 2IGQA 1XQHA 3BO5A 3FPDA 2G46A 4NJ5A 5JINA 1MVHA 5F59A 5JJ0A 1ML9A 2O8JA 5EG2A 3VUZA 3CBMA 2RFIA 3QWWA 4IJDA 5EX3A 5JIYA 3RIBA 3SWCA 4WUYA 3TG5A 1PEGA 4YNDA 2R3AA 3RQ4A 3KMJA 4O6FA 3F9ZA 5ARGA 4FMUA 4J8OA 5TEGA 3SW9A 3M58A 5TTFA 4J7FA 3QWPA 1MT6A 3M53A 4MI0A 5CCMA 5T0KA 4J7IA 1H3IA 5KJNA 3F9WA 3M54A 5EX0A 3M5AA 3N71A 4O30A 4E47A 3KMAA 4Z4PA 4LDGA 1N3JA 5T5GA 3CBPA 3M55A 3MO2A 2W5YA 2W5ZA 3RJWA 5CCLA 4YPAA 4J83A 3PDNA 3OOIA 3RAYA 3KMTA 3S7BA 3MO5A 4BUPA 4RZ0A 4H12A 5KJMA 3CBOA 1MVXA 3OXFA 4JDSA 5JHNA 4YPEA 5F5EA 3DALA 3S8PA 4YNPA 4QENA 4JLGA 4I51A 5T0MA 3MO0A 3RU0A
chains in the Genus database with same CATH superfamily
4IJ8A 5F6KC 5F6LA 3DB5A 4QEOA 3F9XA 3K5KA 5LSXA 3OXGA 3MEKA 3VV0A 4AU7A 5HQ8A 5KJKA 3HNAA 3M57A 5AYFA 5KJLA 2JV0A 3TG4A 3OPEA 3M56A 3OXLA 5TH7A 3S7FA 4QEPA 2QPWA 1N6CA 3IHXA 4YNMA 5CPRB 4NVQA 3QWVA 5LSZA 4YPUA 3EP0A 1N6AA 5HI7A 3OS5A 3S7JA 1MUFA 5ARFA 1O9SA 3S7DA 2BQZA 1ZKKA 2F69A 3F9YA 4MI5A 3M59A 4C1QA 2IGQA 1XQHA 3BO5A 3FPDA 2G46A 4NJ5A 5JINA 1MVHA 5F59A 5JJ0A 1ML9A 2O8JA 5EG2A 3VUZA 3CBMA 2RFIA 3QWWA 4IJDA 5EX3A 5JIYA 3RIBA 3SWCA 4WUYA 3TG5A 1PEGA 4YNDA 2R3AA 3RQ4A 3KMJA 4O6FA 3F9ZA 5ARGA 4FMUA 4J8OA 5TEGA 3SW9A 3M58A 5TTFA 4J7FA 3QWPA 1MT6A 3M53A 4MI0A 5CCMA 5T0KA 4J7IA 1H3IA 5KJNA 3F9WA 3M54A 5EX0A 3M5AA 3N71A 4O30A 4E47A 3KMAA 4Z4PA 4LDGA 1N3JA 5T5GA 3CBPA 3M55A 3MO2A 2W5YA 2W5ZA 3RJWA 5CCLA 4YPAA 4J83A 3PDNA 3OOIA 3RAYA 3KMTA 3S7BA 3MO5A 4BUPA 4RZ0A 4H12A 5KJMA 3CBOA 1MVXA 3OXFA 4JDSA 5JHNA 4YPEA 5F5EA 3DALA 3S8PA 4YNPA 4QENA 4JLGA 4I51A 5T0MA 3MO0A 3RU0A
chains in the Genus database with same CATH topology
4IJ8A 5F6KC 5F6LA 3DB5A 4QEOA 3F9XA 3K5KA 5LSXA 3OXGA 3MEKA 3VV0A 4AU7A 5HQ8A 5KJKA 3HNAA 3M57A 5AYFA 5KJLA 2JV0A 3TG4A 3OPEA 3M56A 3OXLA 5TH7A 3S7FA 4QEPA 2QPWA 1N6CA 3IHXA 4YNMA 5CPRB 4NVQA 3QWVA 5LSZA 4YPUA 3EP0A 1N6AA 5HI7A 3OS5A 3S7JA 1MUFA 5ARFA 1O9SA 3S7DA 2BQZA 1ZKKA 2F69A 3F9YA 4MI5A 3M59A 4C1QA 2IGQA 1XQHA 3BO5A 3FPDA 2G46A 4NJ5A 5JINA 1MVHA 5F59A 5JJ0A 1ML9A 2O8JA 5EG2A 3VUZA 3CBMA 2RFIA 3QWWA 4IJDA 5EX3A 5JIYA 3RIBA 3SWCA 4WUYA 3TG5A 1PEGA 4YNDA 2R3AA 3RQ4A 3KMJA 4O6FA 3F9ZA 5ARGA 4FMUA 4J8OA 5TEGA 3SW9A 3M58A 5TTFA 4J7FA 3QWPA 1MT6A 3M53A 4MI0A 5CCMA 5T0KA 4J7IA 1H3IA 5KJNA 3F9WA 3M54A 5EX0A 3M5AA 3N71A 4O30A 4E47A 3KMAA 4Z4PA 4LDGA 1N3JA 5T5GA 3CBPA 3M55A 3MO2A 2W5YA 2W5ZA 3RJWA 5CCLA 4YPAA 4J83A 3PDNA 3OOIA 3RAYA 3KMTA 3S7BA 3MO5A 4BUPA 4RZ0A 4H12A 5KJMA 3CBOA 1MVXA 3OXFA 4JDSA 5JHNA 4YPEA 5F5EA 3DALA 3S8PA 4YNPA 4QENA 4JLGA 4I51A 5T0MA 3MO0A 3RU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJ8 A;  5F6K C;  5F6L A;  3DB5 A;  4QEO A;  3F9X A;  3K5K A;  5LSX A;  3OXG A;  3MEK A;  3VV0 A;  4AU7 A;  5HQ8 A;  5KJK A;  3HNA A;  3M57 A;  5AYF A;  5KJL A;  2JV0 A;  3TG4 A;  3OPE A;  3M56 A;  3OXL A;  5TH7 A;  3S7F A;  4QEP A;  2QPW A;  1N6C A;  3IHX A;  4YNM A;  5CPR B;  4NVQ A;  3QWV A;  5LSZ A;  4YPU A;  3EP0 A;  1N6A A;  5HI7 A;  3OS5 A;  3S7J A;  1MUF A;  5ARF A;  1O9S A;  3S7D A;  2BQZ A;  1ZKK A;  2F69 A;  3F9Y A;  4MI5 A;  3M59 A;  4C1Q A;  2IGQ A;  1XQH A;  3BO5 A;  3FPD A;  2G46 A;  4NJ5 A;  5JIN A;  1MVH A;  5F59 A;  5JJ0 A;  1ML9 A;  2O8J A;  5EG2 A;  3VUZ A;  3CBM A;  2RFI A;  3QWW A;  4IJD A;  5EX3 A;  5JIY A;  3RIB A;  3SWC A;  4WUY A;  3TG5 A;  1PEG A;  4YND A;  2R3A A;  3RQ4 A;  3KMJ A;  4O6F A;  3F9Z A;  5ARG A;  4FMU A;  4J8O A;  5TEG A;  3SW9 A;  3M58 A;  5TTF A;  4J7F A;  3QWP A;  1MT6 A;  3M53 A;  4MI0 A;  5CCM A;  5T0K A;  4J7I A;  1H3I A;  5KJN A;  3F9W A;  3M54 A;  5EX0 A;  3M5A A;  3N71 A;  4O30 A;  4E47 A;  3KMA A;  4Z4P A;  4LDG A;  1N3J A;  5T5G A;  3CBP A;  3M55 A;  3MO2 A;  2W5Y A;  2W5Z A;  3RJW A;  5CCL A;  4YPA A;  4J83 A;  3PDN A;  3OOI A;  3RAY A;  3KMT A;  3S7B A;  3MO5 A;  4BUP A;  4RZ0 A;  4H12 A;  5KJM A;  3CBO A;  1MVX A;  3OXF A;  4JDS A;  5JHN A;  4YPE A;  5F5E A;  3DAL A;  3S8P A;  4YNP A;  4QEN A;  4JLG A;  4I51 A;  5T0M A;  3MO0 A;  3RU0 A; 
#chains in the Genus database with same CATH topology
 4IJ8 A;  5F6K C;  5F6L A;  3DB5 A;  4QEO A;  3F9X A;  3K5K A;  5LSX A;  3OXG A;  3MEK A;  3VV0 A;  4AU7 A;  5HQ8 A;  5KJK A;  3HNA A;  3M57 A;  5AYF A;  5KJL A;  2JV0 A;  3TG4 A;  3OPE A;  3M56 A;  3OXL A;  5TH7 A;  3S7F A;  4QEP A;  2QPW A;  1N6C A;  3IHX A;  4YNM A;  5CPR B;  4NVQ A;  3QWV A;  5LSZ A;  4YPU A;  3EP0 A;  1N6A A;  5HI7 A;  3OS5 A;  3S7J A;  1MUF A;  5ARF A;  1O9S A;  3S7D A;  2BQZ A;  1ZKK A;  2F69 A;  3F9Y A;  4MI5 A;  3M59 A;  4C1Q A;  2IGQ A;  1XQH A;  3BO5 A;  3FPD A;  2G46 A;  4NJ5 A;  5JIN A;  1MVH A;  5F59 A;  5JJ0 A;  1ML9 A;  2O8J A;  5EG2 A;  3VUZ A;  3CBM A;  2RFI A;  3QWW A;  4IJD A;  5EX3 A;  5JIY A;  3RIB A;  3SWC A;  4WUY A;  3TG5 A;  1PEG A;  4YND A;  2R3A A;  3RQ4 A;  3KMJ A;  4O6F A;  3F9Z A;  5ARG A;  4FMU A;  4J8O A;  5TEG A;  3SW9 A;  3M58 A;  5TTF A;  4J7F A;  3QWP A;  1MT6 A;  3M53 A;  4MI0 A;  5CCM A;  5T0K A;  4J7I A;  1H3I A;  5KJN A;  3F9W A;  3M54 A;  5EX0 A;  3M5A A;  3N71 A;  4O30 A;  4E47 A;  3KMA A;  4Z4P A;  4LDG A;  1N3J A;  5T5G A;  3CBP A;  3M55 A;  3MO2 A;  2W5Y A;  2W5Z A;  3RJW A;  5CCL A;  4YPA A;  4J83 A;  3PDN A;  3OOI A;  3RAY A;  3KMT A;  3S7B A;  3MO5 A;  4BUP A;  4RZ0 A;  4H12 A;  5KJM A;  3CBO A;  1MVX A;  3OXF A;  4JDS A;  5JHN A;  4YPE A;  5F5E A;  3DAL A;  3S8P A;  4YNP A;  4QEN A;  4JLG A;  4I51 A;  5T0M A;  3MO0 A;  3RU0 A; 
#chains in the Genus database with same CATH homology
 4IJ8 A;  5F6K C;  5F6L A;  3DB5 A;  4QEO A;  3F9X A;  3K5K A;  5LSX A;  3OXG A;  3MEK A;  3VV0 A;  4AU7 A;  5HQ8 A;  5KJK A;  3HNA A;  3M57 A;  5AYF A;  5KJL A;  2JV0 A;  3TG4 A;  3OPE A;  3M56 A;  3OXL A;  5TH7 A;  3S7F A;  4QEP A;  2QPW A;  1N6C A;  3IHX A;  4YNM A;  5CPR B;  4NVQ A;  3QWV A;  5LSZ A;  4YPU A;  3EP0 A;  1N6A A;  5HI7 A;  3OS5 A;  3S7J A;  1MUF A;  5ARF A;  1O9S A;  3S7D A;  2BQZ A;  1ZKK A;  2F69 A;  3F9Y A;  4MI5 A;  3M59 A;  4C1Q A;  2IGQ A;  1XQH A;  3BO5 A;  3FPD A;  2G46 A;  4NJ5 A;  5JIN A;  1MVH A;  5F59 A;  5JJ0 A;  1ML9 A;  2O8J A;  5EG2 A;  3VUZ A;  3CBM A;  2RFI A;  3QWW A;  4IJD A;  5EX3 A;  5JIY A;  3RIB A;  3SWC A;  4WUY A;  3TG5 A;  1PEG A;  4YND A;  2R3A A;  3RQ4 A;  3KMJ A;  4O6F A;  3F9Z A;  5ARG A;  4FMU A;  4J8O A;  5TEG A;  3SW9 A;  3M58 A;  5TTF A;  4J7F A;  3QWP A;  1MT6 A;  3M53 A;  4MI0 A;  5CCM A;  5T0K A;  4J7I A;  1H3I A;  5KJN A;  3F9W A;  3M54 A;  5EX0 A;  3M5A A;  3N71 A;  4O30 A;  4E47 A;  3KMA A;  4Z4P A;  4LDG A;  1N3J A;  5T5G A;  3CBP A;  3M55 A;  3MO2 A;  2W5Y A;  2W5Z A;  3RJW A;  5CCL A;  4YPA A;  4J83 A;  3PDN A;  3OOI A;  3RAY A;  3KMT A;  3S7B A;  3MO5 A;  4BUP A;  4RZ0 A;  4H12 A;  5KJM A;  3CBO A;  1MVX A;  3OXF A;  4JDS A;  5JHN A;  4YPE A;  5F5E A;  3DAL A;  3S8P A;  4YNP A;  4QEN A;  4JLG A;  4I51 A;  5T0M A;  3MO0 A;  3RU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...