3OPEA

Structural basis of auto-inhibitory mechanism of histone methyltransferase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
213
structure length
213
Chain Sequence
SYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable histone-lysine N-methyltransferase ASH1L
publication title Crystal structure of the human histone methyltransferase ASH1L catalytic domain and its implications for the regulatory mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 40
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3opeA00
4QEPA 3VV0A 5JHNA 3DALA 5HQ8A 5TH7A 3S8PA 4J83A 4RZ0A 4LDGA 4Z4PA 1PEGA 4MI0A 3VUZA 3HNAA 3DB5A 3M57A 3IHXA 3KMTA 3M56A 5JJ0A 1MVHA 3RQ4A 1XQHA 5F59A 5AYFA 4QENA 3F9XA 5ARGA 3OOIA 5KJNA 3M58A 3EP0A 2JV0A 3RJWA 4J8OA 3S7DA 3QWWA 4J7FA 3RIBA 3F9ZA 5JINA 5LSXA 3TG5A 5T0KA 4J7IA 4WUYA 3S7BA 2G46A 1MVXA 4YNDA 3S7FA 1O9SA 5F5EA 3F9WA 3OPEA 3M5AA 4YNMA 3MO0A 3MEKA 3K5KA 5F6LA 1N3JA 3MO2A 3CBMA 3F9YA 1H3IA 3M53A 4YPEA 5TEGA 5CPRB 3OXFA 3OXLA 1N6AA 3SWCA 5HI7A 3CBOA 3OS5A 5CCLA 3QWPA 2W5YA 2R3AA 4BUPA 4IJ8A 5EG2A 5EX3A 5T0MA 1N6CA 4O6FA 5T5GA 5ARFA 4O30A 3M55A 3RAYA 4H12A 4C1QA 4I51A 3PDNA 5F6KC 4QEOA 5JIYA 1ZKKA 4NJ5A 3KMJA 4JDSA 3CBPA 4YPAA 5KJKA 2BQZA 3RU0A 3S7JA 4YNPA 2RFIA 3N71A 5EX0A 3BO5A 3FPDA 3TG4A 2QPWA 4IJDA 2O8JA 3M54A 2F69A 1MT6A 5CCMA 3SW9A 5KJLA 4E47A 1MUFA 2W5ZA 4AU7A 5KJMA 4NVQA 3QWVA 3MO5A 4MI5A 3KMAA 5LSZA 4FMUA 3M59A 5TTFA 3OXGA 4JLGA 2IGQA 4YPUA 1ML9A
chains in the Genus database with same CATH superfamily
4QEPA 3VV0A 5JHNA 3DALA 5HQ8A 5TH7A 3S8PA 4J83A 4RZ0A 4LDGA 4Z4PA 1PEGA 4MI0A 3VUZA 3HNAA 3DB5A 3M57A 3IHXA 3KMTA 3M56A 5JJ0A 1MVHA 3RQ4A 1XQHA 5F59A 5AYFA 4QENA 3F9XA 5ARGA 3OOIA 5KJNA 3M58A 3EP0A 2JV0A 3RJWA 4J8OA 3S7DA 3QWWA 4J7FA 3RIBA 3F9ZA 5JINA 5LSXA 3TG5A 5T0KA 4J7IA 4WUYA 3S7BA 2G46A 1MVXA 4YNDA 3S7FA 1O9SA 5F5EA 3F9WA 3OPEA 3M5AA 4YNMA 3MO0A 3MEKA 3K5KA 5F6LA 1N3JA 3MO2A 3CBMA 3F9YA 1H3IA 3M53A 4YPEA 5TEGA 5CPRB 3OXFA 3OXLA 1N6AA 3SWCA 5HI7A 3CBOA 3OS5A 5CCLA 3QWPA 2W5YA 2R3AA 4BUPA 4IJ8A 5EG2A 5EX3A 5T0MA 1N6CA 4O6FA 5T5GA 5ARFA 4O30A 3M55A 3RAYA 4H12A 4C1QA 4I51A 3PDNA 5F6KC 4QEOA 5JIYA 1ZKKA 4NJ5A 3KMJA 4JDSA 3CBPA 4YPAA 5KJKA 2BQZA 3RU0A 3S7JA 4YNPA 2RFIA 3N71A 5EX0A 3BO5A 3FPDA 3TG4A 2QPWA 4IJDA 2O8JA 3M54A 2F69A 1MT6A 5CCMA 3SW9A 5KJLA 4E47A 1MUFA 2W5ZA 4AU7A 5KJMA 4NVQA 3QWVA 3MO5A 4MI5A 3KMAA 5LSZA 4FMUA 3M59A 5TTFA 3OXGA 4JLGA 2IGQA 4YPUA 1ML9A
chains in the Genus database with same CATH topology
4QEPA 3VV0A 5JHNA 3DALA 5HQ8A 5TH7A 3S8PA 4J83A 4RZ0A 4LDGA 4Z4PA 1PEGA 4MI0A 3VUZA 3HNAA 3DB5A 3M57A 3IHXA 3KMTA 3M56A 5JJ0A 1MVHA 3RQ4A 1XQHA 5F59A 5AYFA 4QENA 3F9XA 5ARGA 3OOIA 5KJNA 3M58A 3EP0A 2JV0A 3RJWA 4J8OA 3S7DA 3QWWA 4J7FA 3RIBA 3F9ZA 5JINA 5LSXA 3TG5A 5T0KA 4J7IA 4WUYA 3S7BA 2G46A 1MVXA 4YNDA 3S7FA 1O9SA 5F5EA 3F9WA 3OPEA 3M5AA 4YNMA 3MO0A 3MEKA 3K5KA 5F6LA 1N3JA 3MO2A 3CBMA 3F9YA 1H3IA 3M53A 4YPEA 5TEGA 5CPRB 3OXFA 3OXLA 1N6AA 3SWCA 5HI7A 3CBOA 3OS5A 5CCLA 3QWPA 2W5YA 2R3AA 4BUPA 4IJ8A 5EG2A 5EX3A 5T0MA 1N6CA 4O6FA 5T5GA 5ARFA 4O30A 3M55A 3RAYA 4H12A 4C1QA 4I51A 3PDNA 5F6KC 4QEOA 5JIYA 1ZKKA 4NJ5A 3KMJA 4JDSA 3CBPA 4YPAA 5KJKA 2BQZA 3RU0A 3S7JA 4YNPA 2RFIA 3N71A 5EX0A 3BO5A 3FPDA 3TG4A 2QPWA 4IJDA 2O8JA 3M54A 2F69A 1MT6A 5CCMA 3SW9A 5KJLA 4E47A 1MUFA 2W5ZA 4AU7A 5KJMA 4NVQA 3QWVA 3MO5A 4MI5A 3KMAA 5LSZA 4FMUA 3M59A 5TTFA 3OXGA 4JLGA 2IGQA 4YPUA 1ML9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QEP A;  3VV0 A;  5JHN A;  3DAL A;  5HQ8 A;  5TH7 A;  3S8P A;  4J83 A;  4RZ0 A;  4LDG A;  4Z4P A;  1PEG A;  4MI0 A;  3VUZ A;  3HNA A;  3DB5 A;  3M57 A;  3IHX A;  3KMT A;  3M56 A;  5JJ0 A;  1MVH A;  3RQ4 A;  1XQH A;  5F59 A;  5AYF A;  4QEN A;  3F9X A;  5ARG A;  3OOI A;  5KJN A;  3M58 A;  3EP0 A;  2JV0 A;  3RJW A;  4J8O A;  3S7D A;  3QWW A;  4J7F A;  3RIB A;  3F9Z A;  5JIN A;  5LSX A;  3TG5 A;  5T0K A;  4J7I A;  4WUY A;  3S7B A;  2G46 A;  1MVX A;  4YND A;  3S7F A;  1O9S A;  5F5E A;  3F9W A;  3OPE A;  3M5A A;  4YNM A;  3MO0 A;  3MEK A;  3K5K A;  5F6L A;  1N3J A;  3MO2 A;  3CBM A;  3F9Y A;  1H3I A;  3M53 A;  4YPE A;  5TEG A;  5CPR B;  3OXF A;  3OXL A;  1N6A A;  3SWC A;  5HI7 A;  3CBO A;  3OS5 A;  5CCL A;  3QWP A;  2W5Y A;  2R3A A;  4BUP A;  4IJ8 A;  5EG2 A;  5EX3 A;  5T0M A;  1N6C A;  4O6F A;  5T5G A;  5ARF A;  4O30 A;  3M55 A;  3RAY A;  4H12 A;  4C1Q A;  4I51 A;  3PDN A;  5F6K C;  4QEO A;  5JIY A;  1ZKK A;  4NJ5 A;  3KMJ A;  4JDS A;  3CBP A;  4YPA A;  5KJK A;  2BQZ A;  3RU0 A;  3S7J A;  4YNP A;  2RFI A;  3N71 A;  5EX0 A;  3BO5 A;  3FPD A;  3TG4 A;  2QPW A;  4IJD A;  2O8J A;  3M54 A;  2F69 A;  1MT6 A;  5CCM A;  3SW9 A;  5KJL A;  4E47 A;  1MUF A;  2W5Z A;  4AU7 A;  5KJM A;  4NVQ A;  3QWV A;  3MO5 A;  4MI5 A;  3KMA A;  5LSZ A;  4FMU A;  3M59 A;  5TTF A;  3OXG A;  4JLG A;  2IGQ A;  4YPU A;  1ML9 A; 
#chains in the Genus database with same CATH topology
 4QEP A;  3VV0 A;  5JHN A;  3DAL A;  5HQ8 A;  5TH7 A;  3S8P A;  4J83 A;  4RZ0 A;  4LDG A;  4Z4P A;  1PEG A;  4MI0 A;  3VUZ A;  3HNA A;  3DB5 A;  3M57 A;  3IHX A;  3KMT A;  3M56 A;  5JJ0 A;  1MVH A;  3RQ4 A;  1XQH A;  5F59 A;  5AYF A;  4QEN A;  3F9X A;  5ARG A;  3OOI A;  5KJN A;  3M58 A;  3EP0 A;  2JV0 A;  3RJW A;  4J8O A;  3S7D A;  3QWW A;  4J7F A;  3RIB A;  3F9Z A;  5JIN A;  5LSX A;  3TG5 A;  5T0K A;  4J7I A;  4WUY A;  3S7B A;  2G46 A;  1MVX A;  4YND A;  3S7F A;  1O9S A;  5F5E A;  3F9W A;  3OPE A;  3M5A A;  4YNM A;  3MO0 A;  3MEK A;  3K5K A;  5F6L A;  1N3J A;  3MO2 A;  3CBM A;  3F9Y A;  1H3I A;  3M53 A;  4YPE A;  5TEG A;  5CPR B;  3OXF A;  3OXL A;  1N6A A;  3SWC A;  5HI7 A;  3CBO A;  3OS5 A;  5CCL A;  3QWP A;  2W5Y A;  2R3A A;  4BUP A;  4IJ8 A;  5EG2 A;  5EX3 A;  5T0M A;  1N6C A;  4O6F A;  5T5G A;  5ARF A;  4O30 A;  3M55 A;  3RAY A;  4H12 A;  4C1Q A;  4I51 A;  3PDN A;  5F6K C;  4QEO A;  5JIY A;  1ZKK A;  4NJ5 A;  3KMJ A;  4JDS A;  3CBP A;  4YPA A;  5KJK A;  2BQZ A;  3RU0 A;  3S7J A;  4YNP A;  2RFI A;  3N71 A;  5EX0 A;  3BO5 A;  3FPD A;  3TG4 A;  2QPW A;  4IJD A;  2O8J A;  3M54 A;  2F69 A;  1MT6 A;  5CCM A;  3SW9 A;  5KJL A;  4E47 A;  1MUF A;  2W5Z A;  4AU7 A;  5KJM A;  4NVQ A;  3QWV A;  3MO5 A;  4MI5 A;  3KMA A;  5LSZ A;  4FMU A;  3M59 A;  5TTF A;  3OXG A;  4JLG A;  2IGQ A;  4YPU A;  1ML9 A; 
#chains in the Genus database with same CATH homology
 4QEP A;  3VV0 A;  5JHN A;  3DAL A;  5HQ8 A;  5TH7 A;  3S8P A;  4J83 A;  4RZ0 A;  4LDG A;  4Z4P A;  1PEG A;  4MI0 A;  3VUZ A;  3HNA A;  3DB5 A;  3M57 A;  3IHX A;  3KMT A;  3M56 A;  5JJ0 A;  1MVH A;  3RQ4 A;  1XQH A;  5F59 A;  5AYF A;  4QEN A;  3F9X A;  5ARG A;  3OOI A;  5KJN A;  3M58 A;  3EP0 A;  2JV0 A;  3RJW A;  4J8O A;  3S7D A;  3QWW A;  4J7F A;  3RIB A;  3F9Z A;  5JIN A;  5LSX A;  3TG5 A;  5T0K A;  4J7I A;  4WUY A;  3S7B A;  2G46 A;  1MVX A;  4YND A;  3S7F A;  1O9S A;  5F5E A;  3F9W A;  3OPE A;  3M5A A;  4YNM A;  3MO0 A;  3MEK A;  3K5K A;  5F6L A;  1N3J A;  3MO2 A;  3CBM A;  3F9Y A;  1H3I A;  3M53 A;  4YPE A;  5TEG A;  5CPR B;  3OXF A;  3OXL A;  1N6A A;  3SWC A;  5HI7 A;  3CBO A;  3OS5 A;  5CCL A;  3QWP A;  2W5Y A;  2R3A A;  4BUP A;  4IJ8 A;  5EG2 A;  5EX3 A;  5T0M A;  1N6C A;  4O6F A;  5T5G A;  5ARF A;  4O30 A;  3M55 A;  3RAY A;  4H12 A;  4C1Q A;  4I51 A;  3PDN A;  5F6K C;  4QEO A;  5JIY A;  1ZKK A;  4NJ5 A;  3KMJ A;  4JDS A;  3CBP A;  4YPA A;  5KJK A;  2BQZ A;  3RU0 A;  3S7J A;  4YNP A;  2RFI A;  3N71 A;  5EX0 A;  3BO5 A;  3FPD A;  3TG4 A;  2QPW A;  4IJD A;  2O8J A;  3M54 A;  2F69 A;  1MT6 A;  5CCM A;  3SW9 A;  5KJL A;  4E47 A;  1MUF A;  2W5Z A;  4AU7 A;  5KJM A;  4NVQ A;  3QWV A;  3MO5 A;  4MI5 A;  3KMA A;  5LSZ A;  4FMU A;  3M59 A;  5TTF A;  3OXG A;  4JLG A;  2IGQ A;  4YPU A;  1ML9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...