3OPEA

Structural basis of auto-inhibitory mechanism of histone methyltransferase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
213
structure length
213
Chain Sequence
SYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the human histone methyltransferase ASH1L catalytic domain and its implications for the regulatory mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Probable histone-lysine N-methyltransferase ASH1L
total genus 40
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3opeA00
3S8PA 3OXFA 3OOIA 4YNMA 4YNPA 1N6AA 5TTFA 4QEPA 4FMUA 4J7IA 1MT6A 2W5ZA 3M59A 3OXLA 5EX3A 3S7BA 2G46A 3CBPA 1H3IA 4IJ8A 5CCMA 3CBMA 5EX0A 3MO0A 3EP0A 2O8JA 5KJNA 2W5YA 3S7DA 5KJKA 2BQZA 3MO2A 4RZ0A 4YPEA 4IJDA 3M5AA 3TG5A 4LDGA 5EG2A 4C1QA 5TEGA 3M58A 3M56A 5LSXA 5LSZA 5T0KA 5F59A 3QWVA 5T0MA 3HNAA 3OXGA 3M54A 3KMTA 4NJ5A 5JJ0A 3PDNA 4QENA 5ARGA 2QPWA 2IGQA 3K5KA 4YPAA 3KMJA 3QWWA 3BO5A 4YNDA 3FPDA 2JV0A 3F9YA 3RQ4A 3F9WA 5F6LA 5T5GA 3SWCA 3MEKA 4JDSA 5JIYA 3N71A 3KMAA 4MI0A 3DB5A 3OPEA 4YPUA 1MVXA 1ZKKA 3CBOA 3SW9A 3F9XA 1N6CA 3VV0A 5AYFA 5HQ8A 4MI5A 1MVHA 4NVQA 1PEGA 2R3AA 5TH7A 5F5EA 3F9ZA 4E47A 3M55A 5F6KC 5HI7A 4QEOA 3S7JA 2F69A 5ARFA 4JLGA 4J8OA 4J83A 5CCLA 1MUFA 3OS5A 3M53A 4WUYA 1XQHA 3TG4A 1ML9A 5CPRB 1O9SA 2RFIA 4O30A 3VUZA 3RAYA 4Z4PA 5JHNA 4I51A 3M57A 3MO5A 4AU7A 3DALA 3RU0A 5KJMA 3IHXA 3RIBA 4H12A 5JINA 4J7FA 1N3JA 3S7FA 5KJLA 3QWPA 4BUPA 3RJWA 4O6FA
chains in the Genus database with same CATH superfamily
3S8PA 3OXFA 3OOIA 4YNMA 4YNPA 1N6AA 5TTFA 4QEPA 4FMUA 4J7IA 1MT6A 2W5ZA 3M59A 3OXLA 5EX3A 3S7BA 2G46A 3CBPA 1H3IA 4IJ8A 5CCMA 3CBMA 5EX0A 3MO0A 3EP0A 2O8JA 5KJNA 2W5YA 3S7DA 5KJKA 2BQZA 3MO2A 4RZ0A 4YPEA 4IJDA 3M5AA 3TG5A 4LDGA 5EG2A 4C1QA 5TEGA 3M58A 3M56A 5LSXA 5LSZA 5T0KA 5F59A 3QWVA 5T0MA 3HNAA 3OXGA 3M54A 3KMTA 4NJ5A 5JJ0A 3PDNA 4QENA 5ARGA 2QPWA 2IGQA 3K5KA 4YPAA 3KMJA 3QWWA 3BO5A 4YNDA 3FPDA 2JV0A 3F9YA 3RQ4A 3F9WA 5F6LA 5T5GA 3SWCA 3MEKA 4JDSA 5JIYA 3N71A 3KMAA 4MI0A 3DB5A 3OPEA 4YPUA 1MVXA 1ZKKA 3CBOA 3SW9A 3F9XA 1N6CA 3VV0A 5AYFA 5HQ8A 4MI5A 1MVHA 4NVQA 1PEGA 2R3AA 5TH7A 5F5EA 3F9ZA 4E47A 3M55A 5F6KC 5HI7A 4QEOA 3S7JA 2F69A 5ARFA 4JLGA 4J8OA 4J83A 5CCLA 1MUFA 3OS5A 3M53A 4WUYA 1XQHA 3TG4A 1ML9A 5CPRB 1O9SA 2RFIA 4O30A 3VUZA 3RAYA 4Z4PA 5JHNA 4I51A 3M57A 3MO5A 4AU7A 3DALA 3RU0A 5KJMA 3IHXA 3RIBA 4H12A 5JINA 4J7FA 1N3JA 3S7FA 5KJLA 3QWPA 4BUPA 3RJWA 4O6FA
chains in the Genus database with same CATH topology
3S8PA 3OXFA 3OOIA 4YNMA 4YNPA 1N6AA 5TTFA 4QEPA 4FMUA 4J7IA 1MT6A 2W5ZA 3M59A 3OXLA 5EX3A 3S7BA 2G46A 3CBPA 1H3IA 4IJ8A 5CCMA 3CBMA 5EX0A 3MO0A 3EP0A 2O8JA 5KJNA 2W5YA 3S7DA 5KJKA 2BQZA 3MO2A 4RZ0A 4YPEA 4IJDA 3M5AA 3TG5A 4LDGA 5EG2A 4C1QA 5TEGA 3M58A 3M56A 5LSXA 5LSZA 5T0KA 5F59A 3QWVA 5T0MA 3HNAA 3OXGA 3M54A 3KMTA 4NJ5A 5JJ0A 3PDNA 4QENA 5ARGA 2QPWA 2IGQA 3K5KA 4YPAA 3KMJA 3QWWA 3BO5A 4YNDA 3FPDA 2JV0A 3F9YA 3RQ4A 3F9WA 5F6LA 5T5GA 3SWCA 3MEKA 4JDSA 5JIYA 3N71A 3KMAA 4MI0A 3DB5A 3OPEA 4YPUA 1MVXA 1ZKKA 3CBOA 3SW9A 3F9XA 1N6CA 3VV0A 5AYFA 5HQ8A 4MI5A 1MVHA 4NVQA 1PEGA 2R3AA 5TH7A 5F5EA 3F9ZA 4E47A 3M55A 5F6KC 5HI7A 4QEOA 3S7JA 2F69A 5ARFA 4JLGA 4J8OA 4J83A 5CCLA 1MUFA 3OS5A 3M53A 4WUYA 1XQHA 3TG4A 1ML9A 5CPRB 1O9SA 2RFIA 4O30A 3VUZA 3RAYA 4Z4PA 5JHNA 4I51A 3M57A 3MO5A 4AU7A 3DALA 3RU0A 5KJMA 3IHXA 3RIBA 4H12A 5JINA 4J7FA 1N3JA 3S7FA 5KJLA 3QWPA 4BUPA 3RJWA 4O6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S8P A;  3OXF A;  3OOI A;  4YNM A;  4YNP A;  1N6A A;  5TTF A;  4QEP A;  4FMU A;  4J7I A;  1MT6 A;  2W5Z A;  3M59 A;  3OXL A;  5EX3 A;  3S7B A;  2G46 A;  3CBP A;  1H3I A;  4IJ8 A;  5CCM A;  3CBM A;  5EX0 A;  3MO0 A;  3EP0 A;  2O8J A;  5KJN A;  2W5Y A;  3S7D A;  5KJK A;  2BQZ A;  3MO2 A;  4RZ0 A;  4YPE A;  4IJD A;  3M5A A;  3TG5 A;  4LDG A;  5EG2 A;  4C1Q A;  5TEG A;  3M58 A;  3M56 A;  5LSX A;  5LSZ A;  5T0K A;  5F59 A;  3QWV A;  5T0M A;  3HNA A;  3OXG A;  3M54 A;  3KMT A;  4NJ5 A;  5JJ0 A;  3PDN A;  4QEN A;  5ARG A;  2QPW A;  2IGQ A;  3K5K A;  4YPA A;  3KMJ A;  3QWW A;  3BO5 A;  4YND A;  3FPD A;  2JV0 A;  3F9Y A;  3RQ4 A;  3F9W A;  5F6L A;  5T5G A;  3SWC A;  3MEK A;  4JDS A;  5JIY A;  3N71 A;  3KMA A;  4MI0 A;  3DB5 A;  3OPE A;  4YPU A;  1MVX A;  1ZKK A;  3CBO A;  3SW9 A;  3F9X A;  1N6C A;  3VV0 A;  5AYF A;  5HQ8 A;  4MI5 A;  1MVH A;  4NVQ A;  1PEG A;  2R3A A;  5TH7 A;  5F5E A;  3F9Z A;  4E47 A;  3M55 A;  5F6K C;  5HI7 A;  4QEO A;  3S7J A;  2F69 A;  5ARF A;  4JLG A;  4J8O A;  4J83 A;  5CCL A;  1MUF A;  3OS5 A;  3M53 A;  4WUY A;  1XQH A;  3TG4 A;  1ML9 A;  5CPR B;  1O9S A;  2RFI A;  4O30 A;  3VUZ A;  3RAY A;  4Z4P A;  5JHN A;  4I51 A;  3M57 A;  3MO5 A;  4AU7 A;  3DAL A;  3RU0 A;  5KJM A;  3IHX A;  3RIB A;  4H12 A;  5JIN A;  4J7F A;  1N3J A;  3S7F A;  5KJL A;  3QWP A;  4BUP A;  3RJW A;  4O6F A; 
#chains in the Genus database with same CATH topology
 3S8P A;  3OXF A;  3OOI A;  4YNM A;  4YNP A;  1N6A A;  5TTF A;  4QEP A;  4FMU A;  4J7I A;  1MT6 A;  2W5Z A;  3M59 A;  3OXL A;  5EX3 A;  3S7B A;  2G46 A;  3CBP A;  1H3I A;  4IJ8 A;  5CCM A;  3CBM A;  5EX0 A;  3MO0 A;  3EP0 A;  2O8J A;  5KJN A;  2W5Y A;  3S7D A;  5KJK A;  2BQZ A;  3MO2 A;  4RZ0 A;  4YPE A;  4IJD A;  3M5A A;  3TG5 A;  4LDG A;  5EG2 A;  4C1Q A;  5TEG A;  3M58 A;  3M56 A;  5LSX A;  5LSZ A;  5T0K A;  5F59 A;  3QWV A;  5T0M A;  3HNA A;  3OXG A;  3M54 A;  3KMT A;  4NJ5 A;  5JJ0 A;  3PDN A;  4QEN A;  5ARG A;  2QPW A;  2IGQ A;  3K5K A;  4YPA A;  3KMJ A;  3QWW A;  3BO5 A;  4YND A;  3FPD A;  2JV0 A;  3F9Y A;  3RQ4 A;  3F9W A;  5F6L A;  5T5G A;  3SWC A;  3MEK A;  4JDS A;  5JIY A;  3N71 A;  3KMA A;  4MI0 A;  3DB5 A;  3OPE A;  4YPU A;  1MVX A;  1ZKK A;  3CBO A;  3SW9 A;  3F9X A;  1N6C A;  3VV0 A;  5AYF A;  5HQ8 A;  4MI5 A;  1MVH A;  4NVQ A;  1PEG A;  2R3A A;  5TH7 A;  5F5E A;  3F9Z A;  4E47 A;  3M55 A;  5F6K C;  5HI7 A;  4QEO A;  3S7J A;  2F69 A;  5ARF A;  4JLG A;  4J8O A;  4J83 A;  5CCL A;  1MUF A;  3OS5 A;  3M53 A;  4WUY A;  1XQH A;  3TG4 A;  1ML9 A;  5CPR B;  1O9S A;  2RFI A;  4O30 A;  3VUZ A;  3RAY A;  4Z4P A;  5JHN A;  4I51 A;  3M57 A;  3MO5 A;  4AU7 A;  3DAL A;  3RU0 A;  5KJM A;  3IHX A;  3RIB A;  4H12 A;  5JIN A;  4J7F A;  1N3J A;  3S7F A;  5KJL A;  3QWP A;  4BUP A;  3RJW A;  4O6F A; 
#chains in the Genus database with same CATH homology
 3S8P A;  3OXF A;  3OOI A;  4YNM A;  4YNP A;  1N6A A;  5TTF A;  4QEP A;  4FMU A;  4J7I A;  1MT6 A;  2W5Z A;  3M59 A;  3OXL A;  5EX3 A;  3S7B A;  2G46 A;  3CBP A;  1H3I A;  4IJ8 A;  5CCM A;  3CBM A;  5EX0 A;  3MO0 A;  3EP0 A;  2O8J A;  5KJN A;  2W5Y A;  3S7D A;  5KJK A;  2BQZ A;  3MO2 A;  4RZ0 A;  4YPE A;  4IJD A;  3M5A A;  3TG5 A;  4LDG A;  5EG2 A;  4C1Q A;  5TEG A;  3M58 A;  3M56 A;  5LSX A;  5LSZ A;  5T0K A;  5F59 A;  3QWV A;  5T0M A;  3HNA A;  3OXG A;  3M54 A;  3KMT A;  4NJ5 A;  5JJ0 A;  3PDN A;  4QEN A;  5ARG A;  2QPW A;  2IGQ A;  3K5K A;  4YPA A;  3KMJ A;  3QWW A;  3BO5 A;  4YND A;  3FPD A;  2JV0 A;  3F9Y A;  3RQ4 A;  3F9W A;  5F6L A;  5T5G A;  3SWC A;  3MEK A;  4JDS A;  5JIY A;  3N71 A;  3KMA A;  4MI0 A;  3DB5 A;  3OPE A;  4YPU A;  1MVX A;  1ZKK A;  3CBO A;  3SW9 A;  3F9X A;  1N6C A;  3VV0 A;  5AYF A;  5HQ8 A;  4MI5 A;  1MVH A;  4NVQ A;  1PEG A;  2R3A A;  5TH7 A;  5F5E A;  3F9Z A;  4E47 A;  3M55 A;  5F6K C;  5HI7 A;  4QEO A;  3S7J A;  2F69 A;  5ARF A;  4JLG A;  4J8O A;  4J83 A;  5CCL A;  1MUF A;  3OS5 A;  3M53 A;  4WUY A;  1XQH A;  3TG4 A;  1ML9 A;  5CPR B;  1O9S A;  2RFI A;  4O30 A;  3VUZ A;  3RAY A;  4Z4P A;  5JHN A;  4I51 A;  3M57 A;  3MO5 A;  4AU7 A;  3DAL A;  3RU0 A;  5KJM A;  3IHX A;  3RIB A;  4H12 A;  5JIN A;  4J7F A;  1N3J A;  3S7F A;  5KJL A;  3QWP A;  4BUP A;  3RJW A;  4O6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...