3OPEA

Structural basis of auto-inhibitory mechanism of histone methyltransferase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
213
structure length
213
Chain Sequence
b'SYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable histone-lysine N-methyltransferase ASH1L
molecule tags Transferase
source organism Homo sapiens
publication title Crystal structure of the human histone methyltransferase ASH1L catalytic domain and its implications for the regulatory mechanism
pubmed doi rcsb
total genus 40
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3opeA00
4IJ8A 2BQZA 3OXLA 3M58A 4JDSA 4YNMA 2W5YA 5F6LA 3RIBA 2F69A 3S7DA 5TH7A 3PDNA 3K5KA 3N71A 4NJ5A 3EP0A 5TTFA 3HNAA 5T0MA 5EX0A 1MT6A 4WUYA 5F59A 4YPAA 3MEKA 4J7IA 4QEOA 3M59A 5F5EA 1N6CA 4O30A 4YNDA 1ML9A 5JIYA 3CBPA 5LSZA 5KJLA 3SWCA 3OS5A 4J8OA 5T0KA 1MVXA 5EX3A 3F9WA 4E47A 4IJDA 1XQHA 3M5AA 5EG2A 3IHXA 3S7BA 3KMJA 1MVHA 5JJ0A 3MO5A 5KJNA 3VUZA 3MO0A 4MI0A 3DB5A 4C1QA 2JV0A 5T5GA 5ARGA 3RJWA 3OPEA 3TG4A 4LDGA 5TEGA 3KMAA 3QWVA 5HQ8A 5CCMA 2QPWA 1N3JA 3F9ZA 3S7JA 4BUPA 4J83A 4O6FA 2G46A 4NVQA 5ARFA 3RU0A 3TG5A 2O8JA 4QEPA 3QWWA 3CBOA 5JINA 5JHNA 3OXGA 5CPRB 5HI7A 5LSXA 1MUFA 3VV0A 4H12A 4YPEA 5CCLA 4FMUA 3S7FA 3M57A 3FPDA 3M53A 1H3IA 4YPUA 3QWPA 5KJMA 3OOIA 1PEGA 3M56A 5F6KC 3CBMA 3SW9A 2RFIA 2R3AA 3MO2A 4RZ0A 4YNPA 3OXFA 3RAYA 3BO5A 3F9XA 4AU7A 4JLGA 3DALA 3RQ4A 5KJKA 4I51A 5AYFA 3M54A 4QENA 3KMTA 1O9SA 1N6AA 2W5ZA 3M55A 4J7FA 3F9YA 4Z4PA 1ZKKA 2IGQA 4MI5A 3S8PA
chains in the Genus database with same CATH superfamily
4IJ8A 2BQZA 3OXLA 3M58A 4JDSA 4YNMA 2W5YA 5F6LA 3RIBA 2F69A 3S7DA 5TH7A 3PDNA 3K5KA 3N71A 4NJ5A 3EP0A 5TTFA 3HNAA 5T0MA 5EX0A 1MT6A 4WUYA 5F59A 4YPAA 3MEKA 4J7IA 4QEOA 3M59A 5F5EA 1N6CA 4O30A 4YNDA 1ML9A 5JIYA 3CBPA 5LSZA 5KJLA 3SWCA 3OS5A 4J8OA 5T0KA 1MVXA 5EX3A 3F9WA 4E47A 4IJDA 1XQHA 3M5AA 5EG2A 3IHXA 3S7BA 3KMJA 1MVHA 5JJ0A 3MO5A 5KJNA 3VUZA 3MO0A 4MI0A 3DB5A 4C1QA 2JV0A 5T5GA 5ARGA 3RJWA 3OPEA 3TG4A 4LDGA 5TEGA 3KMAA 3QWVA 5HQ8A 5CCMA 2QPWA 1N3JA 3F9ZA 3S7JA 4BUPA 4J83A 4O6FA 2G46A 4NVQA 5ARFA 3RU0A 3TG5A 2O8JA 4QEPA 3QWWA 3CBOA 5JINA 5JHNA 3OXGA 5CPRB 5HI7A 5LSXA 1MUFA 3VV0A 4H12A 4YPEA 5CCLA 4FMUA 3S7FA 3M57A 3FPDA 3M53A 1H3IA 4YPUA 3QWPA 5KJMA 3OOIA 1PEGA 3M56A 5F6KC 3CBMA 3SW9A 2RFIA 2R3AA 3MO2A 4RZ0A 4YNPA 3OXFA 3RAYA 3BO5A 3F9XA 4AU7A 4JLGA 3DALA 3RQ4A 5KJKA 4I51A 5AYFA 3M54A 4QENA 3KMTA 1O9SA 1N6AA 2W5ZA 3M55A 4J7FA 3F9YA 4Z4PA 1ZKKA 2IGQA 4MI5A 3S8PA
chains in the Genus database with same CATH topology
4IJ8A 2BQZA 3OXLA 3M58A 4JDSA 4YNMA 2W5YA 5F6LA 3RIBA 2F69A 3S7DA 5TH7A 3PDNA 3K5KA 3N71A 4NJ5A 3EP0A 5TTFA 3HNAA 5T0MA 5EX0A 1MT6A 4WUYA 5F59A 4YPAA 3MEKA 4J7IA 4QEOA 3M59A 5F5EA 1N6CA 4O30A 4YNDA 1ML9A 5JIYA 3CBPA 5LSZA 5KJLA 3SWCA 3OS5A 4J8OA 5T0KA 1MVXA 5EX3A 3F9WA 4E47A 4IJDA 1XQHA 3M5AA 5EG2A 3IHXA 3S7BA 3KMJA 1MVHA 5JJ0A 3MO5A 5KJNA 3VUZA 3MO0A 4MI0A 3DB5A 4C1QA 2JV0A 5T5GA 5ARGA 3RJWA 3OPEA 3TG4A 4LDGA 5TEGA 3KMAA 3QWVA 5HQ8A 5CCMA 2QPWA 1N3JA 3F9ZA 3S7JA 4BUPA 4J83A 4O6FA 2G46A 4NVQA 5ARFA 3RU0A 3TG5A 2O8JA 4QEPA 3QWWA 3CBOA 5JINA 5JHNA 3OXGA 5CPRB 5HI7A 5LSXA 1MUFA 3VV0A 4H12A 4YPEA 5CCLA 4FMUA 3S7FA 3M57A 3FPDA 3M53A 1H3IA 4YPUA 3QWPA 5KJMA 3OOIA 1PEGA 3M56A 5F6KC 3CBMA 3SW9A 2RFIA 2R3AA 3MO2A 4RZ0A 4YNPA 3OXFA 3RAYA 3BO5A 3F9XA 4AU7A 4JLGA 3DALA 3RQ4A 5KJKA 4I51A 5AYFA 3M54A 4QENA 3KMTA 1O9SA 1N6AA 2W5ZA 3M55A 4J7FA 3F9YA 4Z4PA 1ZKKA 2IGQA 4MI5A 3S8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJ8 A;  2BQZ A;  3OXL A;  3M58 A;  4JDS A;  4YNM A;  2W5Y A;  5F6L A;  3RIB A;  2F69 A;  3S7D A;  5TH7 A;  3PDN A;  3K5K A;  3N71 A;  4NJ5 A;  3EP0 A;  5TTF A;  3HNA A;  5T0M A;  5EX0 A;  1MT6 A;  4WUY A;  5F59 A;  4YPA A;  3MEK A;  4J7I A;  4QEO A;  3M59 A;  5F5E A;  1N6C A;  4O30 A;  4YND A;  1ML9 A;  5JIY A;  3CBP A;  5LSZ A;  5KJL A;  3SWC A;  3OS5 A;  4J8O A;  5T0K A;  1MVX A;  5EX3 A;  3F9W A;  4E47 A;  4IJD A;  1XQH A;  3M5A A;  5EG2 A;  3IHX A;  3S7B A;  3KMJ A;  1MVH A;  5JJ0 A;  3MO5 A;  5KJN A;  3VUZ A;  3MO0 A;  4MI0 A;  3DB5 A;  4C1Q A;  2JV0 A;  5T5G A;  5ARG A;  3RJW A;  3OPE A;  3TG4 A;  4LDG A;  5TEG A;  3KMA A;  3QWV A;  5HQ8 A;  5CCM A;  2QPW A;  1N3J A;  3F9Z A;  3S7J A;  4BUP A;  4J83 A;  4O6F A;  2G46 A;  4NVQ A;  5ARF A;  3RU0 A;  3TG5 A;  2O8J A;  4QEP A;  3QWW A;  3CBO A;  5JIN A;  5JHN A;  3OXG A;  5CPR B;  5HI7 A;  5LSX A;  1MUF A;  3VV0 A;  4H12 A;  4YPE A;  5CCL A;  4FMU A;  3S7F A;  3M57 A;  3FPD A;  3M53 A;  1H3I A;  4YPU A;  3QWP A;  5KJM A;  3OOI A;  1PEG A;  3M56 A;  5F6K C;  3CBM A;  3SW9 A;  2RFI A;  2R3A A;  3MO2 A;  4RZ0 A;  4YNP A;  3OXF A;  3RAY A;  3BO5 A;  3F9X A;  4AU7 A;  4JLG A;  3DAL A;  3RQ4 A;  5KJK A;  4I51 A;  5AYF A;  3M54 A;  4QEN A;  3KMT A;  1O9S A;  1N6A A;  2W5Z A;  3M55 A;  4J7F A;  3F9Y A;  4Z4P A;  1ZKK A;  2IGQ A;  4MI5 A;  3S8P A; 
#chains in the Genus database with same CATH topology
 4IJ8 A;  2BQZ A;  3OXL A;  3M58 A;  4JDS A;  4YNM A;  2W5Y A;  5F6L A;  3RIB A;  2F69 A;  3S7D A;  5TH7 A;  3PDN A;  3K5K A;  3N71 A;  4NJ5 A;  3EP0 A;  5TTF A;  3HNA A;  5T0M A;  5EX0 A;  1MT6 A;  4WUY A;  5F59 A;  4YPA A;  3MEK A;  4J7I A;  4QEO A;  3M59 A;  5F5E A;  1N6C A;  4O30 A;  4YND A;  1ML9 A;  5JIY A;  3CBP A;  5LSZ A;  5KJL A;  3SWC A;  3OS5 A;  4J8O A;  5T0K A;  1MVX A;  5EX3 A;  3F9W A;  4E47 A;  4IJD A;  1XQH A;  3M5A A;  5EG2 A;  3IHX A;  3S7B A;  3KMJ A;  1MVH A;  5JJ0 A;  3MO5 A;  5KJN A;  3VUZ A;  3MO0 A;  4MI0 A;  3DB5 A;  4C1Q A;  2JV0 A;  5T5G A;  5ARG A;  3RJW A;  3OPE A;  3TG4 A;  4LDG A;  5TEG A;  3KMA A;  3QWV A;  5HQ8 A;  5CCM A;  2QPW A;  1N3J A;  3F9Z A;  3S7J A;  4BUP A;  4J83 A;  4O6F A;  2G46 A;  4NVQ A;  5ARF A;  3RU0 A;  3TG5 A;  2O8J A;  4QEP A;  3QWW A;  3CBO A;  5JIN A;  5JHN A;  3OXG A;  5CPR B;  5HI7 A;  5LSX A;  1MUF A;  3VV0 A;  4H12 A;  4YPE A;  5CCL A;  4FMU A;  3S7F A;  3M57 A;  3FPD A;  3M53 A;  1H3I A;  4YPU A;  3QWP A;  5KJM A;  3OOI A;  1PEG A;  3M56 A;  5F6K C;  3CBM A;  3SW9 A;  2RFI A;  2R3A A;  3MO2 A;  4RZ0 A;  4YNP A;  3OXF A;  3RAY A;  3BO5 A;  3F9X A;  4AU7 A;  4JLG A;  3DAL A;  3RQ4 A;  5KJK A;  4I51 A;  5AYF A;  3M54 A;  4QEN A;  3KMT A;  1O9S A;  1N6A A;  2W5Z A;  3M55 A;  4J7F A;  3F9Y A;  4Z4P A;  1ZKK A;  2IGQ A;  4MI5 A;  3S8P A; 
#chains in the Genus database with same CATH homology
 4IJ8 A;  2BQZ A;  3OXL A;  3M58 A;  4JDS A;  4YNM A;  2W5Y A;  5F6L A;  3RIB A;  2F69 A;  3S7D A;  5TH7 A;  3PDN A;  3K5K A;  3N71 A;  4NJ5 A;  3EP0 A;  5TTF A;  3HNA A;  5T0M A;  5EX0 A;  1MT6 A;  4WUY A;  5F59 A;  4YPA A;  3MEK A;  4J7I A;  4QEO A;  3M59 A;  5F5E A;  1N6C A;  4O30 A;  4YND A;  1ML9 A;  5JIY A;  3CBP A;  5LSZ A;  5KJL A;  3SWC A;  3OS5 A;  4J8O A;  5T0K A;  1MVX A;  5EX3 A;  3F9W A;  4E47 A;  4IJD A;  1XQH A;  3M5A A;  5EG2 A;  3IHX A;  3S7B A;  3KMJ A;  1MVH A;  5JJ0 A;  3MO5 A;  5KJN A;  3VUZ A;  3MO0 A;  4MI0 A;  3DB5 A;  4C1Q A;  2JV0 A;  5T5G A;  5ARG A;  3RJW A;  3OPE A;  3TG4 A;  4LDG A;  5TEG A;  3KMA A;  3QWV A;  5HQ8 A;  5CCM A;  2QPW A;  1N3J A;  3F9Z A;  3S7J A;  4BUP A;  4J83 A;  4O6F A;  2G46 A;  4NVQ A;  5ARF A;  3RU0 A;  3TG5 A;  2O8J A;  4QEP A;  3QWW A;  3CBO A;  5JIN A;  5JHN A;  3OXG A;  5CPR B;  5HI7 A;  5LSX A;  1MUF A;  3VV0 A;  4H12 A;  4YPE A;  5CCL A;  4FMU A;  3S7F A;  3M57 A;  3FPD A;  3M53 A;  1H3I A;  4YPU A;  3QWP A;  5KJM A;  3OOI A;  1PEG A;  3M56 A;  5F6K C;  3CBM A;  3SW9 A;  2RFI A;  2R3A A;  3MO2 A;  4RZ0 A;  4YNP A;  3OXF A;  3RAY A;  3BO5 A;  3F9X A;  4AU7 A;  4JLG A;  3DAL A;  3RQ4 A;  5KJK A;  4I51 A;  5AYF A;  3M54 A;  4QEN A;  3KMT A;  1O9S A;  1N6A A;  2W5Z A;  3M55 A;  4J7F A;  3F9Y A;  4Z4P A;  1ZKK A;  2IGQ A;  4MI5 A;  3S8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...