3OPEA

Structural basis of auto-inhibitory mechanism of histone methyltransferase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
213
structure length
213
Chain Sequence
SYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Probable histone-lysine N-methyltransferase ASH1L
publication title Crystal structure of the human histone methyltransferase ASH1L catalytic domain and its implications for the regulatory mechanism
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3opeA00
5ARFA 3K5KA 3CBPA 3MEKA 3RIBA 1N3JA 3TG5A 3MO0A 4YNPA 1N6CA 3M58A 1N6AA 3RU0A 4E47A 3IHXA 5TH7A 4J7IA 4WUYA 4AU7A 3F9WA 2O8JA 3RJWA 4YNDA 5T0KA 3F9XA 3VUZA 3OXLA 4LDGA 3S7JA 4QEPA 5KJLA 3DALA 3N71A 1PEGA 3TG4A 3CBMA 4IJ8A 4JDSA 3S7FA 3S7DA 4QENA 3M55A 2G46A 3SWCA 4JLGA 3M57A 4YPAA 4IJDA 5T0MA 3F9YA 2IGQA 3SW9A 3QWWA 4J83A 2R3AA 5LSXA 4J8OA 3CBOA 3MO2A 3OXGA 3M54A 4YNMA 2F69A 3S8PA 1O9SA 3OPEA 4NVQA 4C1QA 3KMTA 5EX3A 5HQ8A 3M53A 5AYFA 3QWVA 5LSZA 4NJ5A 4FMUA 3KMAA 2RFIA 5T5GA 1ZKKA 5JIYA 5KJNA 1H3IA 5HI7A 1MVHA 3OOIA 4MI0A 4BUPA 5EG2A 3DB5A 3OXFA 2BQZA 1MVXA 5F6KC 4O6FA 5CCMA 4Z4PA 5F5EA 2W5YA 2W5ZA 3S7BA 3EP0A 3VV0A 4I51A 5TEGA 4O30A 2QPWA 1ML9A 5JHNA 5KJKA 3FPDA 4RZ0A 5F6LA 3BO5A 4J7FA 5KJMA 3QWPA 1MT6A 4YPUA 3HNAA 1XQHA 5TTFA 3M5AA 3M59A 3MO5A 3OS5A 4MI5A 3RQ4A 4H12A 3RAYA 3KMJA 4YPEA 5EX0A 5CCLA 4QEOA 1MUFA 5CPRB 5JJ0A 3PDNA 2JV0A 5JINA 3M56A 3F9ZA 5ARGA 5F59A
chains in the Genus database with same CATH superfamily
5ARFA 3K5KA 3CBPA 3MEKA 3RIBA 1N3JA 3TG5A 3MO0A 4YNPA 1N6CA 3M58A 1N6AA 3RU0A 4E47A 3IHXA 5TH7A 4J7IA 4WUYA 4AU7A 3F9WA 2O8JA 3RJWA 4YNDA 5T0KA 3F9XA 3VUZA 3OXLA 4LDGA 3S7JA 4QEPA 5KJLA 3DALA 3N71A 1PEGA 3TG4A 3CBMA 4IJ8A 4JDSA 3S7FA 3S7DA 4QENA 3M55A 2G46A 3SWCA 4JLGA 3M57A 4YPAA 4IJDA 5T0MA 3F9YA 2IGQA 3SW9A 3QWWA 4J83A 2R3AA 5LSXA 4J8OA 3CBOA 3MO2A 3OXGA 3M54A 4YNMA 2F69A 3S8PA 1O9SA 3OPEA 4NVQA 4C1QA 3KMTA 5EX3A 5HQ8A 3M53A 5AYFA 3QWVA 5LSZA 4NJ5A 4FMUA 3KMAA 2RFIA 5T5GA 1ZKKA 5JIYA 5KJNA 1H3IA 5HI7A 1MVHA 3OOIA 4MI0A 4BUPA 5EG2A 3DB5A 3OXFA 2BQZA 1MVXA 5F6KC 4O6FA 5CCMA 4Z4PA 5F5EA 2W5YA 2W5ZA 3S7BA 3EP0A 3VV0A 4I51A 5TEGA 4O30A 2QPWA 1ML9A 5JHNA 5KJKA 3FPDA 4RZ0A 5F6LA 3BO5A 4J7FA 5KJMA 3QWPA 1MT6A 4YPUA 3HNAA 1XQHA 5TTFA 3M5AA 3M59A 3MO5A 3OS5A 4MI5A 3RQ4A 4H12A 3RAYA 3KMJA 4YPEA 5EX0A 5CCLA 4QEOA 1MUFA 5CPRB 5JJ0A 3PDNA 2JV0A 5JINA 3M56A 3F9ZA 5ARGA 5F59A
chains in the Genus database with same CATH topology
5ARFA 3K5KA 3CBPA 3MEKA 3RIBA 1N3JA 3TG5A 3MO0A 4YNPA 1N6CA 3M58A 1N6AA 3RU0A 4E47A 3IHXA 5TH7A 4J7IA 4WUYA 4AU7A 3F9WA 2O8JA 3RJWA 4YNDA 5T0KA 3F9XA 3VUZA 3OXLA 4LDGA 3S7JA 4QEPA 5KJLA 3DALA 3N71A 1PEGA 3TG4A 3CBMA 4IJ8A 4JDSA 3S7FA 3S7DA 4QENA 3M55A 2G46A 3SWCA 4JLGA 3M57A 4YPAA 4IJDA 5T0MA 3F9YA 2IGQA 3SW9A 3QWWA 4J83A 2R3AA 5LSXA 4J8OA 3CBOA 3MO2A 3OXGA 3M54A 4YNMA 2F69A 3S8PA 1O9SA 3OPEA 4NVQA 4C1QA 3KMTA 5EX3A 5HQ8A 3M53A 5AYFA 3QWVA 5LSZA 4NJ5A 4FMUA 3KMAA 2RFIA 5T5GA 1ZKKA 5JIYA 5KJNA 1H3IA 5HI7A 1MVHA 3OOIA 4MI0A 4BUPA 5EG2A 3DB5A 3OXFA 2BQZA 1MVXA 5F6KC 4O6FA 5CCMA 4Z4PA 5F5EA 2W5YA 2W5ZA 3S7BA 3EP0A 3VV0A 4I51A 5TEGA 4O30A 2QPWA 1ML9A 5JHNA 5KJKA 3FPDA 4RZ0A 5F6LA 3BO5A 4J7FA 5KJMA 3QWPA 1MT6A 4YPUA 3HNAA 1XQHA 5TTFA 3M5AA 3M59A 3MO5A 3OS5A 4MI5A 3RQ4A 4H12A 3RAYA 3KMJA 4YPEA 5EX0A 5CCLA 4QEOA 1MUFA 5CPRB 5JJ0A 3PDNA 2JV0A 5JINA 3M56A 3F9ZA 5ARGA 5F59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ARF A;  3K5K A;  3CBP A;  3MEK A;  3RIB A;  1N3J A;  3TG5 A;  3MO0 A;  4YNP A;  1N6C A;  3M58 A;  1N6A A;  3RU0 A;  4E47 A;  3IHX A;  5TH7 A;  4J7I A;  4WUY A;  4AU7 A;  3F9W A;  2O8J A;  3RJW A;  4YND A;  5T0K A;  3F9X A;  3VUZ A;  3OXL A;  4LDG A;  3S7J A;  4QEP A;  5KJL A;  3DAL A;  3N71 A;  1PEG A;  3TG4 A;  3CBM A;  4IJ8 A;  4JDS A;  3S7F A;  3S7D A;  4QEN A;  3M55 A;  2G46 A;  3SWC A;  4JLG A;  3M57 A;  4YPA A;  4IJD A;  5T0M A;  3F9Y A;  2IGQ A;  3SW9 A;  3QWW A;  4J83 A;  2R3A A;  5LSX A;  4J8O A;  3CBO A;  3MO2 A;  3OXG A;  3M54 A;  4YNM A;  2F69 A;  3S8P A;  1O9S A;  3OPE A;  4NVQ A;  4C1Q A;  3KMT A;  5EX3 A;  5HQ8 A;  3M53 A;  5AYF A;  3QWV A;  5LSZ A;  4NJ5 A;  4FMU A;  3KMA A;  2RFI A;  5T5G A;  1ZKK A;  5JIY A;  5KJN A;  1H3I A;  5HI7 A;  1MVH A;  3OOI A;  4MI0 A;  4BUP A;  5EG2 A;  3DB5 A;  3OXF A;  2BQZ A;  1MVX A;  5F6K C;  4O6F A;  5CCM A;  4Z4P A;  5F5E A;  2W5Y A;  2W5Z A;  3S7B A;  3EP0 A;  3VV0 A;  4I51 A;  5TEG A;  4O30 A;  2QPW A;  1ML9 A;  5JHN A;  5KJK A;  3FPD A;  4RZ0 A;  5F6L A;  3BO5 A;  4J7F A;  5KJM A;  3QWP A;  1MT6 A;  4YPU A;  3HNA A;  1XQH A;  5TTF A;  3M5A A;  3M59 A;  3MO5 A;  3OS5 A;  4MI5 A;  3RQ4 A;  4H12 A;  3RAY A;  3KMJ A;  4YPE A;  5EX0 A;  5CCL A;  4QEO A;  1MUF A;  5CPR B;  5JJ0 A;  3PDN A;  2JV0 A;  5JIN A;  3M56 A;  3F9Z A;  5ARG A;  5F59 A; 
#chains in the Genus database with same CATH topology
 5ARF A;  3K5K A;  3CBP A;  3MEK A;  3RIB A;  1N3J A;  3TG5 A;  3MO0 A;  4YNP A;  1N6C A;  3M58 A;  1N6A A;  3RU0 A;  4E47 A;  3IHX A;  5TH7 A;  4J7I A;  4WUY A;  4AU7 A;  3F9W A;  2O8J A;  3RJW A;  4YND A;  5T0K A;  3F9X A;  3VUZ A;  3OXL A;  4LDG A;  3S7J A;  4QEP A;  5KJL A;  3DAL A;  3N71 A;  1PEG A;  3TG4 A;  3CBM A;  4IJ8 A;  4JDS A;  3S7F A;  3S7D A;  4QEN A;  3M55 A;  2G46 A;  3SWC A;  4JLG A;  3M57 A;  4YPA A;  4IJD A;  5T0M A;  3F9Y A;  2IGQ A;  3SW9 A;  3QWW A;  4J83 A;  2R3A A;  5LSX A;  4J8O A;  3CBO A;  3MO2 A;  3OXG A;  3M54 A;  4YNM A;  2F69 A;  3S8P A;  1O9S A;  3OPE A;  4NVQ A;  4C1Q A;  3KMT A;  5EX3 A;  5HQ8 A;  3M53 A;  5AYF A;  3QWV A;  5LSZ A;  4NJ5 A;  4FMU A;  3KMA A;  2RFI A;  5T5G A;  1ZKK A;  5JIY A;  5KJN A;  1H3I A;  5HI7 A;  1MVH A;  3OOI A;  4MI0 A;  4BUP A;  5EG2 A;  3DB5 A;  3OXF A;  2BQZ A;  1MVX A;  5F6K C;  4O6F A;  5CCM A;  4Z4P A;  5F5E A;  2W5Y A;  2W5Z A;  3S7B A;  3EP0 A;  3VV0 A;  4I51 A;  5TEG A;  4O30 A;  2QPW A;  1ML9 A;  5JHN A;  5KJK A;  3FPD A;  4RZ0 A;  5F6L A;  3BO5 A;  4J7F A;  5KJM A;  3QWP A;  1MT6 A;  4YPU A;  3HNA A;  1XQH A;  5TTF A;  3M5A A;  3M59 A;  3MO5 A;  3OS5 A;  4MI5 A;  3RQ4 A;  4H12 A;  3RAY A;  3KMJ A;  4YPE A;  5EX0 A;  5CCL A;  4QEO A;  1MUF A;  5CPR B;  5JJ0 A;  3PDN A;  2JV0 A;  5JIN A;  3M56 A;  3F9Z A;  5ARG A;  5F59 A; 
#chains in the Genus database with same CATH homology
 5ARF A;  3K5K A;  3CBP A;  3MEK A;  3RIB A;  1N3J A;  3TG5 A;  3MO0 A;  4YNP A;  1N6C A;  3M58 A;  1N6A A;  3RU0 A;  4E47 A;  3IHX A;  5TH7 A;  4J7I A;  4WUY A;  4AU7 A;  3F9W A;  2O8J A;  3RJW A;  4YND A;  5T0K A;  3F9X A;  3VUZ A;  3OXL A;  4LDG A;  3S7J A;  4QEP A;  5KJL A;  3DAL A;  3N71 A;  1PEG A;  3TG4 A;  3CBM A;  4IJ8 A;  4JDS A;  3S7F A;  3S7D A;  4QEN A;  3M55 A;  2G46 A;  3SWC A;  4JLG A;  3M57 A;  4YPA A;  4IJD A;  5T0M A;  3F9Y A;  2IGQ A;  3SW9 A;  3QWW A;  4J83 A;  2R3A A;  5LSX A;  4J8O A;  3CBO A;  3MO2 A;  3OXG A;  3M54 A;  4YNM A;  2F69 A;  3S8P A;  1O9S A;  3OPE A;  4NVQ A;  4C1Q A;  3KMT A;  5EX3 A;  5HQ8 A;  3M53 A;  5AYF A;  3QWV A;  5LSZ A;  4NJ5 A;  4FMU A;  3KMA A;  2RFI A;  5T5G A;  1ZKK A;  5JIY A;  5KJN A;  1H3I A;  5HI7 A;  1MVH A;  3OOI A;  4MI0 A;  4BUP A;  5EG2 A;  3DB5 A;  3OXF A;  2BQZ A;  1MVX A;  5F6K C;  4O6F A;  5CCM A;  4Z4P A;  5F5E A;  2W5Y A;  2W5Z A;  3S7B A;  3EP0 A;  3VV0 A;  4I51 A;  5TEG A;  4O30 A;  2QPW A;  1ML9 A;  5JHN A;  5KJK A;  3FPD A;  4RZ0 A;  5F6L A;  3BO5 A;  4J7F A;  5KJM A;  3QWP A;  1MT6 A;  4YPU A;  3HNA A;  1XQH A;  5TTF A;  3M5A A;  3M59 A;  3MO5 A;  3OS5 A;  4MI5 A;  3RQ4 A;  4H12 A;  3RAY A;  3KMJ A;  4YPE A;  5EX0 A;  5CCL A;  4QEO A;  1MUF A;  5CPR B;  5JJ0 A;  3PDN A;  2JV0 A;  5JIN A;  3M56 A;  3F9Z A;  5ARG A;  5F59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...