3KMAA

Crystal structure of vset under condition a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
b'MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A612L protein
publication title Dimerization of a viral SET protein endows its function.
pubmed doi rcsb
molecule tags Viral protein
total genus 23
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3kmaA00
5JHNA 3MO0A 1MVHA 4FMUA 4QEOA 5CCMA 4J83A 3S7JA 3QWPA 3OPEA 5HQ8A 3M55A 4MI5A 2F69A 3S7DA 4QEPA 4QENA 5LSZA 3RQ4A 3HNAA 3F9WA 3OXFA 5F5EA 5EG2A 2W5ZA 3DALA 5EX3A 5KJLA 5CPRB 4BUPA 3M58A 3M53A 4LDGA 5T0MA 1MT6A 3N71A 3TG5A 4YPEA 3VV0A 5JJ0A 3M57A 3DB5A 5KJNA 1ML9A 3F9ZA 3CBPA 3F9XA 3FPDA 2QPWA 3KMJA 3QWWA 3MO2A 4J8OA 3OOIA 3S8PA 4I51A 1ZKKA 2W5YA 1O9SA 5AYFA 3SWCA 3PDNA 4RZ0A 2RFIA 4E47A 4Z4PA 4J7FA 3RIBA 2BQZA 2IGQA 1MVXA 3S7BA 3M56A 3OS5A 4YPUA 3EP0A 3TG4A 5CCLA 4JLGA 5TEGA 3M59A 4IJ8A 5KJKA 4IJDA 4YNDA 3CBOA 2JV0A 4NVQA 2R3AA 3M54A 5EX0A 3VUZA 4NJ5A 1PEGA 3KMAA 1H3IA 3RU0A 4J7IA 3S7FA 3OXGA 3BO5A 5ARFA 1XQHA 1N6AA 1N3JA 3CBMA 5LSXA 4YNPA 5JIYA 4YNMA 5TH7A 5TTFA 4O30A 3M5AA 4YPAA 3SW9A 5F6LA 5JINA 5F6KC 2O8JA 5KJMA 2G46A 4AU7A 3IHXA 3QWVA 3OXLA 4C1QA 4JDSA 3MO5A 4H12A 5T5GA 3F9YA 4MI0A 3MEKA 3RJWA 3K5KA 1N6CA 5T0KA 5F59A 5HI7A 1MUFA 3KMTA 5ARGA 4O6FA 4WUYA 3RAYA
chains in the Genus database with same CATH superfamily
5JHNA 3MO0A 1MVHA 4FMUA 4QEOA 5CCMA 4J83A 3S7JA 3QWPA 3OPEA 5HQ8A 3M55A 4MI5A 2F69A 3S7DA 4QEPA 4QENA 5LSZA 3RQ4A 3HNAA 3F9WA 3OXFA 5F5EA 5EG2A 2W5ZA 3DALA 5EX3A 5KJLA 5CPRB 4BUPA 3M58A 3M53A 4LDGA 5T0MA 1MT6A 3N71A 3TG5A 4YPEA 3VV0A 5JJ0A 3M57A 3DB5A 5KJNA 1ML9A 3F9ZA 3CBPA 3F9XA 3FPDA 2QPWA 3KMJA 3QWWA 3MO2A 4J8OA 3OOIA 3S8PA 4I51A 1ZKKA 2W5YA 1O9SA 5AYFA 3SWCA 3PDNA 4RZ0A 2RFIA 4E47A 4Z4PA 4J7FA 3RIBA 2BQZA 2IGQA 1MVXA 3S7BA 3M56A 3OS5A 4YPUA 3EP0A 3TG4A 5CCLA 4JLGA 5TEGA 3M59A 4IJ8A 5KJKA 4IJDA 4YNDA 3CBOA 2JV0A 4NVQA 2R3AA 3M54A 5EX0A 3VUZA 4NJ5A 1PEGA 3KMAA 1H3IA 3RU0A 4J7IA 3S7FA 3OXGA 3BO5A 5ARFA 1XQHA 1N6AA 1N3JA 3CBMA 5LSXA 4YNPA 5JIYA 4YNMA 5TH7A 5TTFA 4O30A 3M5AA 4YPAA 3SW9A 5F6LA 5JINA 5F6KC 2O8JA 5KJMA 2G46A 4AU7A 3IHXA 3QWVA 3OXLA 4C1QA 4JDSA 3MO5A 4H12A 5T5GA 3F9YA 4MI0A 3MEKA 3RJWA 3K5KA 1N6CA 5T0KA 5F59A 5HI7A 1MUFA 3KMTA 5ARGA 4O6FA 4WUYA 3RAYA
chains in the Genus database with same CATH topology
5JHNA 3MO0A 1MVHA 4FMUA 4QEOA 5CCMA 4J83A 3S7JA 3QWPA 3OPEA 5HQ8A 3M55A 4MI5A 2F69A 3S7DA 4QEPA 4QENA 5LSZA 3RQ4A 3HNAA 3F9WA 3OXFA 5F5EA 5EG2A 2W5ZA 3DALA 5EX3A 5KJLA 5CPRB 4BUPA 3M58A 3M53A 4LDGA 5T0MA 1MT6A 3N71A 3TG5A 4YPEA 3VV0A 5JJ0A 3M57A 3DB5A 5KJNA 1ML9A 3F9ZA 3CBPA 3F9XA 3FPDA 2QPWA 3KMJA 3QWWA 3MO2A 4J8OA 3OOIA 3S8PA 4I51A 1ZKKA 2W5YA 1O9SA 5AYFA 3SWCA 3PDNA 4RZ0A 2RFIA 4E47A 4Z4PA 4J7FA 3RIBA 2BQZA 2IGQA 1MVXA 3S7BA 3M56A 3OS5A 4YPUA 3EP0A 3TG4A 5CCLA 4JLGA 5TEGA 3M59A 4IJ8A 5KJKA 4IJDA 4YNDA 3CBOA 2JV0A 4NVQA 2R3AA 3M54A 5EX0A 3VUZA 4NJ5A 1PEGA 3KMAA 1H3IA 3RU0A 4J7IA 3S7FA 3OXGA 3BO5A 5ARFA 1XQHA 1N6AA 1N3JA 3CBMA 5LSXA 4YNPA 5JIYA 4YNMA 5TH7A 5TTFA 4O30A 3M5AA 4YPAA 3SW9A 5F6LA 5JINA 5F6KC 2O8JA 5KJMA 2G46A 4AU7A 3IHXA 3QWVA 3OXLA 4C1QA 4JDSA 3MO5A 4H12A 5T5GA 3F9YA 4MI0A 3MEKA 3RJWA 3K5KA 1N6CA 5T0KA 5F59A 5HI7A 1MUFA 3KMTA 5ARGA 4O6FA 4WUYA 3RAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JHN A;  3MO0 A;  1MVH A;  4FMU A;  4QEO A;  5CCM A;  4J83 A;  3S7J A;  3QWP A;  3OPE A;  5HQ8 A;  3M55 A;  4MI5 A;  2F69 A;  3S7D A;  4QEP A;  4QEN A;  5LSZ A;  3RQ4 A;  3HNA A;  3F9W A;  3OXF A;  5F5E A;  5EG2 A;  2W5Z A;  3DAL A;  5EX3 A;  5KJL A;  5CPR B;  4BUP A;  3M58 A;  3M53 A;  4LDG A;  5T0M A;  1MT6 A;  3N71 A;  3TG5 A;  4YPE A;  3VV0 A;  5JJ0 A;  3M57 A;  3DB5 A;  5KJN A;  1ML9 A;  3F9Z A;  3CBP A;  3F9X A;  3FPD A;  2QPW A;  3KMJ A;  3QWW A;  3MO2 A;  4J8O A;  3OOI A;  3S8P A;  4I51 A;  1ZKK A;  2W5Y A;  1O9S A;  5AYF A;  3SWC A;  3PDN A;  4RZ0 A;  2RFI A;  4E47 A;  4Z4P A;  4J7F A;  3RIB A;  2BQZ A;  2IGQ A;  1MVX A;  3S7B A;  3M56 A;  3OS5 A;  4YPU A;  3EP0 A;  3TG4 A;  5CCL A;  4JLG A;  5TEG A;  3M59 A;  4IJ8 A;  5KJK A;  4IJD A;  4YND A;  3CBO A;  2JV0 A;  4NVQ A;  2R3A A;  3M54 A;  5EX0 A;  3VUZ A;  4NJ5 A;  1PEG A;  3KMA A;  1H3I A;  3RU0 A;  4J7I A;  3S7F A;  3OXG A;  3BO5 A;  5ARF A;  1XQH A;  1N6A A;  1N3J A;  3CBM A;  5LSX A;  4YNP A;  5JIY A;  4YNM A;  5TH7 A;  5TTF A;  4O30 A;  3M5A A;  4YPA A;  3SW9 A;  5F6L A;  5JIN A;  5F6K C;  2O8J A;  5KJM A;  2G46 A;  4AU7 A;  3IHX A;  3QWV A;  3OXL A;  4C1Q A;  4JDS A;  3MO5 A;  4H12 A;  5T5G A;  3F9Y A;  4MI0 A;  3MEK A;  3RJW A;  3K5K A;  1N6C A;  5T0K A;  5F59 A;  5HI7 A;  1MUF A;  3KMT A;  5ARG A;  4O6F A;  4WUY A;  3RAY A; 
#chains in the Genus database with same CATH topology
 5JHN A;  3MO0 A;  1MVH A;  4FMU A;  4QEO A;  5CCM A;  4J83 A;  3S7J A;  3QWP A;  3OPE A;  5HQ8 A;  3M55 A;  4MI5 A;  2F69 A;  3S7D A;  4QEP A;  4QEN A;  5LSZ A;  3RQ4 A;  3HNA A;  3F9W A;  3OXF A;  5F5E A;  5EG2 A;  2W5Z A;  3DAL A;  5EX3 A;  5KJL A;  5CPR B;  4BUP A;  3M58 A;  3M53 A;  4LDG A;  5T0M A;  1MT6 A;  3N71 A;  3TG5 A;  4YPE A;  3VV0 A;  5JJ0 A;  3M57 A;  3DB5 A;  5KJN A;  1ML9 A;  3F9Z A;  3CBP A;  3F9X A;  3FPD A;  2QPW A;  3KMJ A;  3QWW A;  3MO2 A;  4J8O A;  3OOI A;  3S8P A;  4I51 A;  1ZKK A;  2W5Y A;  1O9S A;  5AYF A;  3SWC A;  3PDN A;  4RZ0 A;  2RFI A;  4E47 A;  4Z4P A;  4J7F A;  3RIB A;  2BQZ A;  2IGQ A;  1MVX A;  3S7B A;  3M56 A;  3OS5 A;  4YPU A;  3EP0 A;  3TG4 A;  5CCL A;  4JLG A;  5TEG A;  3M59 A;  4IJ8 A;  5KJK A;  4IJD A;  4YND A;  3CBO A;  2JV0 A;  4NVQ A;  2R3A A;  3M54 A;  5EX0 A;  3VUZ A;  4NJ5 A;  1PEG A;  3KMA A;  1H3I A;  3RU0 A;  4J7I A;  3S7F A;  3OXG A;  3BO5 A;  5ARF A;  1XQH A;  1N6A A;  1N3J A;  3CBM A;  5LSX A;  4YNP A;  5JIY A;  4YNM A;  5TH7 A;  5TTF A;  4O30 A;  3M5A A;  4YPA A;  3SW9 A;  5F6L A;  5JIN A;  5F6K C;  2O8J A;  5KJM A;  2G46 A;  4AU7 A;  3IHX A;  3QWV A;  3OXL A;  4C1Q A;  4JDS A;  3MO5 A;  4H12 A;  5T5G A;  3F9Y A;  4MI0 A;  3MEK A;  3RJW A;  3K5K A;  1N6C A;  5T0K A;  5F59 A;  5HI7 A;  1MUF A;  3KMT A;  5ARG A;  4O6F A;  4WUY A;  3RAY A; 
#chains in the Genus database with same CATH homology
 5JHN A;  3MO0 A;  1MVH A;  4FMU A;  4QEO A;  5CCM A;  4J83 A;  3S7J A;  3QWP A;  3OPE A;  5HQ8 A;  3M55 A;  4MI5 A;  2F69 A;  3S7D A;  4QEP A;  4QEN A;  5LSZ A;  3RQ4 A;  3HNA A;  3F9W A;  3OXF A;  5F5E A;  5EG2 A;  2W5Z A;  3DAL A;  5EX3 A;  5KJL A;  5CPR B;  4BUP A;  3M58 A;  3M53 A;  4LDG A;  5T0M A;  1MT6 A;  3N71 A;  3TG5 A;  4YPE A;  3VV0 A;  5JJ0 A;  3M57 A;  3DB5 A;  5KJN A;  1ML9 A;  3F9Z A;  3CBP A;  3F9X A;  3FPD A;  2QPW A;  3KMJ A;  3QWW A;  3MO2 A;  4J8O A;  3OOI A;  3S8P A;  4I51 A;  1ZKK A;  2W5Y A;  1O9S A;  5AYF A;  3SWC A;  3PDN A;  4RZ0 A;  2RFI A;  4E47 A;  4Z4P A;  4J7F A;  3RIB A;  2BQZ A;  2IGQ A;  1MVX A;  3S7B A;  3M56 A;  3OS5 A;  4YPU A;  3EP0 A;  3TG4 A;  5CCL A;  4JLG A;  5TEG A;  3M59 A;  4IJ8 A;  5KJK A;  4IJD A;  4YND A;  3CBO A;  2JV0 A;  4NVQ A;  2R3A A;  3M54 A;  5EX0 A;  3VUZ A;  4NJ5 A;  1PEG A;  3KMA A;  1H3I A;  3RU0 A;  4J7I A;  3S7F A;  3OXG A;  3BO5 A;  5ARF A;  1XQH A;  1N6A A;  1N3J A;  3CBM A;  5LSX A;  4YNP A;  5JIY A;  4YNM A;  5TH7 A;  5TTF A;  4O30 A;  3M5A A;  4YPA A;  3SW9 A;  5F6L A;  5JIN A;  5F6K C;  2O8J A;  5KJM A;  2G46 A;  4AU7 A;  3IHX A;  3QWV A;  3OXL A;  4C1Q A;  4JDS A;  3MO5 A;  4H12 A;  5T5G A;  3F9Y A;  4MI0 A;  3MEK A;  3RJW A;  3K5K A;  1N6C A;  5T0K A;  5F59 A;  5HI7 A;  1MUF A;  3KMT A;  5ARG A;  4O6F A;  4WUY A;  3RAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...