3KMAA

Crystal structure of vset under condition a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A612L protein
publication title Dimerization of a viral SET protein endows its function.
pubmed doi rcsb
molecule tags Viral protein
total genus 23
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3kmaA00
5F5EA 3S8PA 3OPEA 3IHXA 4LDGA 4YNPA 1XQHA 3M54A 3F9XA 3RAYA 5JINA 3MO5A 2IGQA 3K5KA 3RIBA 2O8JA 4J8OA 5ARFA 3CBMA 5AYFA 1N3JA 4AU7A 3DB5A 3OXFA 4J83A 1ZKKA 5T0MA 4NVQA 5JHNA 5KJKA 5CCMA 3BO5A 3PDNA 3VUZA 4YNDA 3QWVA 3F9WA 3TG4A 4JLGA 3M53A 4WUYA 1MT6A 4IJ8A 5LSXA 4I51A 3S7BA 4QEPA 3OS5A 3M59A 4J7FA 3M56A 4YNMA 3KMTA 5JIYA 4FMUA 4IJDA 4MI5A 3HNAA 3MEKA 1N6CA 5CCLA 3FPDA 5TEGA 4O30A 4QENA 3SWCA 3VV0A 5KJNA 3MO2A 5TH7A 3RJWA 2F69A 1ML9A 5T5GA 3EP0A 3RU0A 3CBPA 1O9SA 5KJLA 4JDSA 1H3IA 3OXGA 3S7DA 5LSZA 4H12A 3QWWA 1MUFA 4J7IA 4Z4PA 5JJ0A 4BUPA 2BQZA 3OOIA 5EX3A 4E47A 2R3AA 4YPAA 3SW9A 1N6AA 3M57A 4YPUA 3F9ZA 5T0KA 5ARGA 3M5AA 3KMAA 5HQ8A 3DALA 5KJMA 2QPWA 3RQ4A 3M58A 5TTFA 4MI0A 3TG5A 3F9YA 5F59A 3S7JA 2RFIA 2W5YA 2G46A 1PEGA 3OXLA 1MVXA 3QWPA 3MO0A 3N71A 3M55A 3KMJA 5CPRB 5EG2A 4O6FA 3CBOA 4C1QA 2JV0A 4RZ0A 1MVHA 2W5ZA 5HI7A 5F6LA 3S7FA 4NJ5A 4YPEA 5F6KC 5EX0A 4QEOA
chains in the Genus database with same CATH superfamily
5F5EA 3S8PA 3OPEA 3IHXA 4LDGA 4YNPA 1XQHA 3M54A 3F9XA 3RAYA 5JINA 3MO5A 2IGQA 3K5KA 3RIBA 2O8JA 4J8OA 5ARFA 3CBMA 5AYFA 1N3JA 4AU7A 3DB5A 3OXFA 4J83A 1ZKKA 5T0MA 4NVQA 5JHNA 5KJKA 5CCMA 3BO5A 3PDNA 3VUZA 4YNDA 3QWVA 3F9WA 3TG4A 4JLGA 3M53A 4WUYA 1MT6A 4IJ8A 5LSXA 4I51A 3S7BA 4QEPA 3OS5A 3M59A 4J7FA 3M56A 4YNMA 3KMTA 5JIYA 4FMUA 4IJDA 4MI5A 3HNAA 3MEKA 1N6CA 5CCLA 3FPDA 5TEGA 4O30A 4QENA 3SWCA 3VV0A 5KJNA 3MO2A 5TH7A 3RJWA 2F69A 1ML9A 5T5GA 3EP0A 3RU0A 3CBPA 1O9SA 5KJLA 4JDSA 1H3IA 3OXGA 3S7DA 5LSZA 4H12A 3QWWA 1MUFA 4J7IA 4Z4PA 5JJ0A 4BUPA 2BQZA 3OOIA 5EX3A 4E47A 2R3AA 4YPAA 3SW9A 1N6AA 3M57A 4YPUA 3F9ZA 5T0KA 5ARGA 3M5AA 3KMAA 5HQ8A 3DALA 5KJMA 2QPWA 3RQ4A 3M58A 5TTFA 4MI0A 3TG5A 3F9YA 5F59A 3S7JA 2RFIA 2W5YA 2G46A 1PEGA 3OXLA 1MVXA 3QWPA 3MO0A 3N71A 3M55A 3KMJA 5CPRB 5EG2A 4O6FA 3CBOA 4C1QA 2JV0A 4RZ0A 1MVHA 2W5ZA 5HI7A 5F6LA 3S7FA 4NJ5A 4YPEA 5F6KC 5EX0A 4QEOA
chains in the Genus database with same CATH topology
5F5EA 3S8PA 3OPEA 3IHXA 4LDGA 4YNPA 1XQHA 3M54A 3F9XA 3RAYA 5JINA 3MO5A 2IGQA 3K5KA 3RIBA 2O8JA 4J8OA 5ARFA 3CBMA 5AYFA 1N3JA 4AU7A 3DB5A 3OXFA 4J83A 1ZKKA 5T0MA 4NVQA 5JHNA 5KJKA 5CCMA 3BO5A 3PDNA 3VUZA 4YNDA 3QWVA 3F9WA 3TG4A 4JLGA 3M53A 4WUYA 1MT6A 4IJ8A 5LSXA 4I51A 3S7BA 4QEPA 3OS5A 3M59A 4J7FA 3M56A 4YNMA 3KMTA 5JIYA 4FMUA 4IJDA 4MI5A 3HNAA 3MEKA 1N6CA 5CCLA 3FPDA 5TEGA 4O30A 4QENA 3SWCA 3VV0A 5KJNA 3MO2A 5TH7A 3RJWA 2F69A 1ML9A 5T5GA 3EP0A 3RU0A 3CBPA 1O9SA 5KJLA 4JDSA 1H3IA 3OXGA 3S7DA 5LSZA 4H12A 3QWWA 1MUFA 4J7IA 4Z4PA 5JJ0A 4BUPA 2BQZA 3OOIA 5EX3A 4E47A 2R3AA 4YPAA 3SW9A 1N6AA 3M57A 4YPUA 3F9ZA 5T0KA 5ARGA 3M5AA 3KMAA 5HQ8A 3DALA 5KJMA 2QPWA 3RQ4A 3M58A 5TTFA 4MI0A 3TG5A 3F9YA 5F59A 3S7JA 2RFIA 2W5YA 2G46A 1PEGA 3OXLA 1MVXA 3QWPA 3MO0A 3N71A 3M55A 3KMJA 5CPRB 5EG2A 4O6FA 3CBOA 4C1QA 2JV0A 4RZ0A 1MVHA 2W5ZA 5HI7A 5F6LA 3S7FA 4NJ5A 4YPEA 5F6KC 5EX0A 4QEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F5E A;  3S8P A;  3OPE A;  3IHX A;  4LDG A;  4YNP A;  1XQH A;  3M54 A;  3F9X A;  3RAY A;  5JIN A;  3MO5 A;  2IGQ A;  3K5K A;  3RIB A;  2O8J A;  4J8O A;  5ARF A;  3CBM A;  5AYF A;  1N3J A;  4AU7 A;  3DB5 A;  3OXF A;  4J83 A;  1ZKK A;  5T0M A;  4NVQ A;  5JHN A;  5KJK A;  5CCM A;  3BO5 A;  3PDN A;  3VUZ A;  4YND A;  3QWV A;  3F9W A;  3TG4 A;  4JLG A;  3M53 A;  4WUY A;  1MT6 A;  4IJ8 A;  5LSX A;  4I51 A;  3S7B A;  4QEP A;  3OS5 A;  3M59 A;  4J7F A;  3M56 A;  4YNM A;  3KMT A;  5JIY A;  4FMU A;  4IJD A;  4MI5 A;  3HNA A;  3MEK A;  1N6C A;  5CCL A;  3FPD A;  5TEG A;  4O30 A;  4QEN A;  3SWC A;  3VV0 A;  5KJN A;  3MO2 A;  5TH7 A;  3RJW A;  2F69 A;  1ML9 A;  5T5G A;  3EP0 A;  3RU0 A;  3CBP A;  1O9S A;  5KJL A;  4JDS A;  1H3I A;  3OXG A;  3S7D A;  5LSZ A;  4H12 A;  3QWW A;  1MUF A;  4J7I A;  4Z4P A;  5JJ0 A;  4BUP A;  2BQZ A;  3OOI A;  5EX3 A;  4E47 A;  2R3A A;  4YPA A;  3SW9 A;  1N6A A;  3M57 A;  4YPU A;  3F9Z A;  5T0K A;  5ARG A;  3M5A A;  3KMA A;  5HQ8 A;  3DAL A;  5KJM A;  2QPW A;  3RQ4 A;  3M58 A;  5TTF A;  4MI0 A;  3TG5 A;  3F9Y A;  5F59 A;  3S7J A;  2RFI A;  2W5Y A;  2G46 A;  1PEG A;  3OXL A;  1MVX A;  3QWP A;  3MO0 A;  3N71 A;  3M55 A;  3KMJ A;  5CPR B;  5EG2 A;  4O6F A;  3CBO A;  4C1Q A;  2JV0 A;  4RZ0 A;  1MVH A;  2W5Z A;  5HI7 A;  5F6L A;  3S7F A;  4NJ5 A;  4YPE A;  5F6K C;  5EX0 A;  4QEO A; 
#chains in the Genus database with same CATH topology
 5F5E A;  3S8P A;  3OPE A;  3IHX A;  4LDG A;  4YNP A;  1XQH A;  3M54 A;  3F9X A;  3RAY A;  5JIN A;  3MO5 A;  2IGQ A;  3K5K A;  3RIB A;  2O8J A;  4J8O A;  5ARF A;  3CBM A;  5AYF A;  1N3J A;  4AU7 A;  3DB5 A;  3OXF A;  4J83 A;  1ZKK A;  5T0M A;  4NVQ A;  5JHN A;  5KJK A;  5CCM A;  3BO5 A;  3PDN A;  3VUZ A;  4YND A;  3QWV A;  3F9W A;  3TG4 A;  4JLG A;  3M53 A;  4WUY A;  1MT6 A;  4IJ8 A;  5LSX A;  4I51 A;  3S7B A;  4QEP A;  3OS5 A;  3M59 A;  4J7F A;  3M56 A;  4YNM A;  3KMT A;  5JIY A;  4FMU A;  4IJD A;  4MI5 A;  3HNA A;  3MEK A;  1N6C A;  5CCL A;  3FPD A;  5TEG A;  4O30 A;  4QEN A;  3SWC A;  3VV0 A;  5KJN A;  3MO2 A;  5TH7 A;  3RJW A;  2F69 A;  1ML9 A;  5T5G A;  3EP0 A;  3RU0 A;  3CBP A;  1O9S A;  5KJL A;  4JDS A;  1H3I A;  3OXG A;  3S7D A;  5LSZ A;  4H12 A;  3QWW A;  1MUF A;  4J7I A;  4Z4P A;  5JJ0 A;  4BUP A;  2BQZ A;  3OOI A;  5EX3 A;  4E47 A;  2R3A A;  4YPA A;  3SW9 A;  1N6A A;  3M57 A;  4YPU A;  3F9Z A;  5T0K A;  5ARG A;  3M5A A;  3KMA A;  5HQ8 A;  3DAL A;  5KJM A;  2QPW A;  3RQ4 A;  3M58 A;  5TTF A;  4MI0 A;  3TG5 A;  3F9Y A;  5F59 A;  3S7J A;  2RFI A;  2W5Y A;  2G46 A;  1PEG A;  3OXL A;  1MVX A;  3QWP A;  3MO0 A;  3N71 A;  3M55 A;  3KMJ A;  5CPR B;  5EG2 A;  4O6F A;  3CBO A;  4C1Q A;  2JV0 A;  4RZ0 A;  1MVH A;  2W5Z A;  5HI7 A;  5F6L A;  3S7F A;  4NJ5 A;  4YPE A;  5F6K C;  5EX0 A;  4QEO A; 
#chains in the Genus database with same CATH homology
 5F5E A;  3S8P A;  3OPE A;  3IHX A;  4LDG A;  4YNP A;  1XQH A;  3M54 A;  3F9X A;  3RAY A;  5JIN A;  3MO5 A;  2IGQ A;  3K5K A;  3RIB A;  2O8J A;  4J8O A;  5ARF A;  3CBM A;  5AYF A;  1N3J A;  4AU7 A;  3DB5 A;  3OXF A;  4J83 A;  1ZKK A;  5T0M A;  4NVQ A;  5JHN A;  5KJK A;  5CCM A;  3BO5 A;  3PDN A;  3VUZ A;  4YND A;  3QWV A;  3F9W A;  3TG4 A;  4JLG A;  3M53 A;  4WUY A;  1MT6 A;  4IJ8 A;  5LSX A;  4I51 A;  3S7B A;  4QEP A;  3OS5 A;  3M59 A;  4J7F A;  3M56 A;  4YNM A;  3KMT A;  5JIY A;  4FMU A;  4IJD A;  4MI5 A;  3HNA A;  3MEK A;  1N6C A;  5CCL A;  3FPD A;  5TEG A;  4O30 A;  4QEN A;  3SWC A;  3VV0 A;  5KJN A;  3MO2 A;  5TH7 A;  3RJW A;  2F69 A;  1ML9 A;  5T5G A;  3EP0 A;  3RU0 A;  3CBP A;  1O9S A;  5KJL A;  4JDS A;  1H3I A;  3OXG A;  3S7D A;  5LSZ A;  4H12 A;  3QWW A;  1MUF A;  4J7I A;  4Z4P A;  5JJ0 A;  4BUP A;  2BQZ A;  3OOI A;  5EX3 A;  4E47 A;  2R3A A;  4YPA A;  3SW9 A;  1N6A A;  3M57 A;  4YPU A;  3F9Z A;  5T0K A;  5ARG A;  3M5A A;  3KMA A;  5HQ8 A;  3DAL A;  5KJM A;  2QPW A;  3RQ4 A;  3M58 A;  5TTF A;  4MI0 A;  3TG5 A;  3F9Y A;  5F59 A;  3S7J A;  2RFI A;  2W5Y A;  2G46 A;  1PEG A;  3OXL A;  1MVX A;  3QWP A;  3MO0 A;  3N71 A;  3M55 A;  3KMJ A;  5CPR B;  5EG2 A;  4O6F A;  3CBO A;  4C1Q A;  2JV0 A;  4RZ0 A;  1MVH A;  2W5Z A;  5HI7 A;  5F6L A;  3S7F A;  4NJ5 A;  4YPE A;  5F6K C;  5EX0 A;  4QEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...