3KMAA

Crystal structure of vset under condition a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords A612L protein
publication title Dimerization of a viral SET protein endows its function.
pubmed doi rcsb
total genus 23
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3kmaA00
5KJLA 3N71A 3S7DA 5JINA 4O30A 4NJ5A 4AU7A 5CPRB 5F5EA 2G46A 3S7BA 5CCMA 3QWVA 3RAYA 4J8OA 3DB5A 3FPDA 4YNMA 5F59A 4MI0A 2F69A 4QEPA 3M59A 2W5ZA 3RIBA 3MEKA 1ZKKA 4H12A 5T0MA 3BO5A 4YNDA 3VV0A 3F9WA 4MI5A 2QPWA 1N6CA 5JJ0A 5F6LA 3KMAA 4YPEA 5T0KA 3TG4A 3QWWA 2O8JA 4BUPA 3CBPA 1N3JA 3M56A 3KMTA 3M5AA 5EX0A 3RQ4A 3OXFA 3M54A 5JIYA 4O6FA 5TEGA 4IJ8A 2R3AA 1PEGA 5KJKA 5EG2A 5ARGA 3MO2A 4QEOA 5EX3A 5AYFA 4J7FA 1XQHA 3PDNA 4IJDA 4RZ0A 4FMUA 3M57A 5HQ8A 4YPAA 4YNPA 3SW9A 3M55A 2W5YA 5TH7A 2IGQA 5ARFA 3CBOA 4YPUA 1N6AA 3DALA 4JDSA 3SWCA 4C1QA 4J7IA 3HNAA 3F9XA 5JHNA 5TTFA 4QENA 3MO5A 3OS5A 4I51A 1MVHA 4JLGA 4Z4PA 3OXLA 4J83A 3CBMA 3VUZA 1H3IA 1MVXA 5T5GA 2JV0A 3S7JA 3EP0A 3IHXA 4WUYA 3RJWA 5CCLA 5KJMA 4E47A 1MUFA 1ML9A 3S8PA 1MT6A 3S7FA 3OXGA 5LSZA 3KMJA 3OOIA 3MO0A 3M58A 3RU0A 3F9YA 3TG5A 2RFIA 5F6KC 1O9SA 5LSXA 5KJNA 3OPEA 4LDGA 3QWPA 4NVQA 3F9ZA 2BQZA 5HI7A 3M53A 3K5KA
chains in the Genus database with same CATH superfamily
5KJLA 3N71A 3S7DA 5JINA 4O30A 4NJ5A 4AU7A 5CPRB 5F5EA 2G46A 3S7BA 5CCMA 3QWVA 3RAYA 4J8OA 3DB5A 3FPDA 4YNMA 5F59A 4MI0A 2F69A 4QEPA 3M59A 2W5ZA 3RIBA 3MEKA 1ZKKA 4H12A 5T0MA 3BO5A 4YNDA 3VV0A 3F9WA 4MI5A 2QPWA 1N6CA 5JJ0A 5F6LA 3KMAA 4YPEA 5T0KA 3TG4A 3QWWA 2O8JA 4BUPA 3CBPA 1N3JA 3M56A 3KMTA 3M5AA 5EX0A 3RQ4A 3OXFA 3M54A 5JIYA 4O6FA 5TEGA 4IJ8A 2R3AA 1PEGA 5KJKA 5EG2A 5ARGA 3MO2A 4QEOA 5EX3A 5AYFA 4J7FA 1XQHA 3PDNA 4IJDA 4RZ0A 4FMUA 3M57A 5HQ8A 4YPAA 4YNPA 3SW9A 3M55A 2W5YA 5TH7A 2IGQA 5ARFA 3CBOA 4YPUA 1N6AA 3DALA 4JDSA 3SWCA 4C1QA 4J7IA 3HNAA 3F9XA 5JHNA 5TTFA 4QENA 3MO5A 3OS5A 4I51A 1MVHA 4JLGA 4Z4PA 3OXLA 4J83A 3CBMA 3VUZA 1H3IA 1MVXA 5T5GA 2JV0A 3S7JA 3EP0A 3IHXA 4WUYA 3RJWA 5CCLA 5KJMA 4E47A 1MUFA 1ML9A 3S8PA 1MT6A 3S7FA 3OXGA 5LSZA 3KMJA 3OOIA 3MO0A 3M58A 3RU0A 3F9YA 3TG5A 2RFIA 5F6KC 1O9SA 5LSXA 5KJNA 3OPEA 4LDGA 3QWPA 4NVQA 3F9ZA 2BQZA 5HI7A 3M53A 3K5KA
chains in the Genus database with same CATH topology
5KJLA 3N71A 3S7DA 5JINA 4O30A 4NJ5A 4AU7A 5CPRB 5F5EA 2G46A 3S7BA 5CCMA 3QWVA 3RAYA 4J8OA 3DB5A 3FPDA 4YNMA 5F59A 4MI0A 2F69A 4QEPA 3M59A 2W5ZA 3RIBA 3MEKA 1ZKKA 4H12A 5T0MA 3BO5A 4YNDA 3VV0A 3F9WA 4MI5A 2QPWA 1N6CA 5JJ0A 5F6LA 3KMAA 4YPEA 5T0KA 3TG4A 3QWWA 2O8JA 4BUPA 3CBPA 1N3JA 3M56A 3KMTA 3M5AA 5EX0A 3RQ4A 3OXFA 3M54A 5JIYA 4O6FA 5TEGA 4IJ8A 2R3AA 1PEGA 5KJKA 5EG2A 5ARGA 3MO2A 4QEOA 5EX3A 5AYFA 4J7FA 1XQHA 3PDNA 4IJDA 4RZ0A 4FMUA 3M57A 5HQ8A 4YPAA 4YNPA 3SW9A 3M55A 2W5YA 5TH7A 2IGQA 5ARFA 3CBOA 4YPUA 1N6AA 3DALA 4JDSA 3SWCA 4C1QA 4J7IA 3HNAA 3F9XA 5JHNA 5TTFA 4QENA 3MO5A 3OS5A 4I51A 1MVHA 4JLGA 4Z4PA 3OXLA 4J83A 3CBMA 3VUZA 1H3IA 1MVXA 5T5GA 2JV0A 3S7JA 3EP0A 3IHXA 4WUYA 3RJWA 5CCLA 5KJMA 4E47A 1MUFA 1ML9A 3S8PA 1MT6A 3S7FA 3OXGA 5LSZA 3KMJA 3OOIA 3MO0A 3M58A 3RU0A 3F9YA 3TG5A 2RFIA 5F6KC 1O9SA 5LSXA 5KJNA 3OPEA 4LDGA 3QWPA 4NVQA 3F9ZA 2BQZA 5HI7A 3M53A 3K5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KJL A;  3N71 A;  3S7D A;  5JIN A;  4O30 A;  4NJ5 A;  4AU7 A;  5CPR B;  5F5E A;  2G46 A;  3S7B A;  5CCM A;  3QWV A;  3RAY A;  4J8O A;  3DB5 A;  3FPD A;  4YNM A;  5F59 A;  4MI0 A;  2F69 A;  4QEP A;  3M59 A;  2W5Z A;  3RIB A;  3MEK A;  1ZKK A;  4H12 A;  5T0M A;  3BO5 A;  4YND A;  3VV0 A;  3F9W A;  4MI5 A;  2QPW A;  1N6C A;  5JJ0 A;  5F6L A;  3KMA A;  4YPE A;  5T0K A;  3TG4 A;  3QWW A;  2O8J A;  4BUP A;  3CBP A;  1N3J A;  3M56 A;  3KMT A;  3M5A A;  5EX0 A;  3RQ4 A;  3OXF A;  3M54 A;  5JIY A;  4O6F A;  5TEG A;  4IJ8 A;  2R3A A;  1PEG A;  5KJK A;  5EG2 A;  5ARG A;  3MO2 A;  4QEO A;  5EX3 A;  5AYF A;  4J7F A;  1XQH A;  3PDN A;  4IJD A;  4RZ0 A;  4FMU A;  3M57 A;  5HQ8 A;  4YPA A;  4YNP A;  3SW9 A;  3M55 A;  2W5Y A;  5TH7 A;  2IGQ A;  5ARF A;  3CBO A;  4YPU A;  1N6A A;  3DAL A;  4JDS A;  3SWC A;  4C1Q A;  4J7I A;  3HNA A;  3F9X A;  5JHN A;  5TTF A;  4QEN A;  3MO5 A;  3OS5 A;  4I51 A;  1MVH A;  4JLG A;  4Z4P A;  3OXL A;  4J83 A;  3CBM A;  3VUZ A;  1H3I A;  1MVX A;  5T5G A;  2JV0 A;  3S7J A;  3EP0 A;  3IHX A;  4WUY A;  3RJW A;  5CCL A;  5KJM A;  4E47 A;  1MUF A;  1ML9 A;  3S8P A;  1MT6 A;  3S7F A;  3OXG A;  5LSZ A;  3KMJ A;  3OOI A;  3MO0 A;  3M58 A;  3RU0 A;  3F9Y A;  3TG5 A;  2RFI A;  5F6K C;  1O9S A;  5LSX A;  5KJN A;  3OPE A;  4LDG A;  3QWP A;  4NVQ A;  3F9Z A;  2BQZ A;  5HI7 A;  3M53 A;  3K5K A; 
#chains in the Genus database with same CATH topology
 5KJL A;  3N71 A;  3S7D A;  5JIN A;  4O30 A;  4NJ5 A;  4AU7 A;  5CPR B;  5F5E A;  2G46 A;  3S7B A;  5CCM A;  3QWV A;  3RAY A;  4J8O A;  3DB5 A;  3FPD A;  4YNM A;  5F59 A;  4MI0 A;  2F69 A;  4QEP A;  3M59 A;  2W5Z A;  3RIB A;  3MEK A;  1ZKK A;  4H12 A;  5T0M A;  3BO5 A;  4YND A;  3VV0 A;  3F9W A;  4MI5 A;  2QPW A;  1N6C A;  5JJ0 A;  5F6L A;  3KMA A;  4YPE A;  5T0K A;  3TG4 A;  3QWW A;  2O8J A;  4BUP A;  3CBP A;  1N3J A;  3M56 A;  3KMT A;  3M5A A;  5EX0 A;  3RQ4 A;  3OXF A;  3M54 A;  5JIY A;  4O6F A;  5TEG A;  4IJ8 A;  2R3A A;  1PEG A;  5KJK A;  5EG2 A;  5ARG A;  3MO2 A;  4QEO A;  5EX3 A;  5AYF A;  4J7F A;  1XQH A;  3PDN A;  4IJD A;  4RZ0 A;  4FMU A;  3M57 A;  5HQ8 A;  4YPA A;  4YNP A;  3SW9 A;  3M55 A;  2W5Y A;  5TH7 A;  2IGQ A;  5ARF A;  3CBO A;  4YPU A;  1N6A A;  3DAL A;  4JDS A;  3SWC A;  4C1Q A;  4J7I A;  3HNA A;  3F9X A;  5JHN A;  5TTF A;  4QEN A;  3MO5 A;  3OS5 A;  4I51 A;  1MVH A;  4JLG A;  4Z4P A;  3OXL A;  4J83 A;  3CBM A;  3VUZ A;  1H3I A;  1MVX A;  5T5G A;  2JV0 A;  3S7J A;  3EP0 A;  3IHX A;  4WUY A;  3RJW A;  5CCL A;  5KJM A;  4E47 A;  1MUF A;  1ML9 A;  3S8P A;  1MT6 A;  3S7F A;  3OXG A;  5LSZ A;  3KMJ A;  3OOI A;  3MO0 A;  3M58 A;  3RU0 A;  3F9Y A;  3TG5 A;  2RFI A;  5F6K C;  1O9S A;  5LSX A;  5KJN A;  3OPE A;  4LDG A;  3QWP A;  4NVQ A;  3F9Z A;  2BQZ A;  5HI7 A;  3M53 A;  3K5K A; 
#chains in the Genus database with same CATH homology
 5KJL A;  3N71 A;  3S7D A;  5JIN A;  4O30 A;  4NJ5 A;  4AU7 A;  5CPR B;  5F5E A;  2G46 A;  3S7B A;  5CCM A;  3QWV A;  3RAY A;  4J8O A;  3DB5 A;  3FPD A;  4YNM A;  5F59 A;  4MI0 A;  2F69 A;  4QEP A;  3M59 A;  2W5Z A;  3RIB A;  3MEK A;  1ZKK A;  4H12 A;  5T0M A;  3BO5 A;  4YND A;  3VV0 A;  3F9W A;  4MI5 A;  2QPW A;  1N6C A;  5JJ0 A;  5F6L A;  3KMA A;  4YPE A;  5T0K A;  3TG4 A;  3QWW A;  2O8J A;  4BUP A;  3CBP A;  1N3J A;  3M56 A;  3KMT A;  3M5A A;  5EX0 A;  3RQ4 A;  3OXF A;  3M54 A;  5JIY A;  4O6F A;  5TEG A;  4IJ8 A;  2R3A A;  1PEG A;  5KJK A;  5EG2 A;  5ARG A;  3MO2 A;  4QEO A;  5EX3 A;  5AYF A;  4J7F A;  1XQH A;  3PDN A;  4IJD A;  4RZ0 A;  4FMU A;  3M57 A;  5HQ8 A;  4YPA A;  4YNP A;  3SW9 A;  3M55 A;  2W5Y A;  5TH7 A;  2IGQ A;  5ARF A;  3CBO A;  4YPU A;  1N6A A;  3DAL A;  4JDS A;  3SWC A;  4C1Q A;  4J7I A;  3HNA A;  3F9X A;  5JHN A;  5TTF A;  4QEN A;  3MO5 A;  3OS5 A;  4I51 A;  1MVH A;  4JLG A;  4Z4P A;  3OXL A;  4J83 A;  3CBM A;  3VUZ A;  1H3I A;  1MVX A;  5T5G A;  2JV0 A;  3S7J A;  3EP0 A;  3IHX A;  4WUY A;  3RJW A;  5CCL A;  5KJM A;  4E47 A;  1MUF A;  1ML9 A;  3S8P A;  1MT6 A;  3S7F A;  3OXG A;  5LSZ A;  3KMJ A;  3OOI A;  3MO0 A;  3M58 A;  3RU0 A;  3F9Y A;  3TG5 A;  2RFI A;  5F6K C;  1O9S A;  5LSX A;  5KJN A;  3OPE A;  4LDG A;  3QWP A;  4NVQ A;  3F9Z A;  2BQZ A;  5HI7 A;  3M53 A;  3K5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...