4QEOA

Crystal structure of kryptonite in complex with mchh dna, h3(1-15) peptide and sah
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
526
structure length
472
Chain Sequence
LEPHLKVTKCLRLFNKQYLLCVQAKLSRPDLKGVTEMIKAKAILYPRKIIGDLPGIDVGHRFFSRAEMCAVGFHNHWLNGIDYMSMEYEKEYSNYKLPLAVSIVMSGQYEDDLDNADTVTYTGQGGHNLTGNKRQIKDQLLERGNLALKHCCEYNVPVRVTRGHNCKSSYTKRVYTYDGLYKVEKFWAQKGVSGFTVYKYRLKRLEGQPELTTDIEGLVCEDISGGLEFKGIPATNRVDDSPVSPTSGFTYIKSLIIEPNVIIPKSSTGCNCRGSCTDSKKCACAKLNGGNFPYVDLNDGRLIESRDVVFECGPHCGCGPKCVNRTSQKRLRFNLEVFRSAKKGWAVRSWEYIPAGSPVCEYIGVVRRTADVNEYIFEIDCPEFCIDAGSTGNFARFINHSCEPNLFVQCVLSSHQDIRLARVVLFAADNISPMQELTYDYGYALDSVHGPDGKVKQLACYCGALNCRKRLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific SUV
publication title Mechanism of DNA Methylation-Directed Histone Methylation by KRYPTONITE.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 139
structure length 472
sequence length 526
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2014-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF02182 SAD_SRA SAD/SRA domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4qeoA03
3S7DA 1N6AA 3VUZA 2IGQA 5F5EA 5HQ8A 3MO2A 3RJWA 3F9WA 1MVHA 5F6KC 4IJDA 4QENA 5CCMA 4YPAA 3DALA 4C1QA 5LSXA 3BO5A 4BUPA 5HI7A 1MT6A 4NJ5A 3KMJA 3OXFA 5T0MA 1MVXA 3S8PA 4RZ0A 5T0KA 3M56A 4MI5A 5EG2A 1XQHA 3OS5A 4WUYA 4Z4PA 5KJKA 4H12A 3QWVA 5KJMA 2G46A 4QEPA 3M55A 1MUFA 3CBOA 3CBPA 4FMUA 3HNAA 2BQZA 3M5AA 3M57A 3M53A 4J7IA 5TEGA 3M58A 3S7BA 3TG5A 3DB5A 1N6CA 2F69A 4JLGA 4AU7A 5F6LA 3EP0A 4I51A 3RU0A 5CCLA 5JINA 5TH7A 2W5ZA 4E47A 5ARGA 4MI0A 5JIYA 3OPEA 1O9SA 3S7JA 1ZKKA 4J7FA 3IHXA 1PEGA 3OOIA 2O8JA 3CBMA 3PDNA 4J83A 3QWPA 2R3AA 4NVQA 5KJNA 4YNDA 3OXGA 3M54A 4O6FA 3FPDA 5KJLA 5JHNA 5TTFA 5LSZA 3MO0A 3SWCA 2W5YA 2RFIA 3QWWA 5T5GA 4YPUA 1H3IA 4O30A 3SW9A 3F9YA 4YNMA 5EX3A 5EX0A 4IJ8A 4YPEA 4J8OA 3RQ4A 4JDSA 4YNPA 3TG4A 3VV0A 5CPRB 3RAYA 5F59A 3K5KA 3N71A 2JV0A 3RIBA 3KMAA 3S7FA 1ML9A 4QEOA 1N3JA 5JJ0A 5AYFA 3MO5A 3OXLA 3F9ZA 3MEKA 3M59A 3KMTA 5ARFA 2QPWA 3F9XA 4LDGA
chains in the Genus database with same CATH superfamily
3S7DA 1N6AA 3VUZA 2IGQA 5F5EA 5HQ8A 3MO2A 3RJWA 3F9WA 1MVHA 5F6KC 4IJDA 4QENA 5CCMA 4YPAA 3DALA 4C1QA 5LSXA 3BO5A 4BUPA 5HI7A 1MT6A 4NJ5A 3KMJA 3OXFA 5T0MA 1MVXA 3S8PA 4RZ0A 5T0KA 3M56A 4MI5A 5EG2A 1XQHA 3OS5A 4WUYA 4Z4PA 5KJKA 4H12A 3QWVA 5KJMA 2G46A 4QEPA 3M55A 1MUFA 3CBOA 3CBPA 4FMUA 3HNAA 2BQZA 3M5AA 3M57A 3M53A 4J7IA 5TEGA 3M58A 3S7BA 3TG5A 3DB5A 1N6CA 2F69A 4JLGA 4AU7A 5F6LA 3EP0A 4I51A 3RU0A 5CCLA 5JINA 5TH7A 2W5ZA 4E47A 5ARGA 4MI0A 5JIYA 3OPEA 1O9SA 3S7JA 1ZKKA 4J7FA 3IHXA 1PEGA 3OOIA 2O8JA 3CBMA 3PDNA 4J83A 3QWPA 2R3AA 4NVQA 5KJNA 4YNDA 3OXGA 3M54A 4O6FA 3FPDA 5KJLA 5JHNA 5TTFA 5LSZA 3MO0A 3SWCA 2W5YA 2RFIA 3QWWA 5T5GA 4YPUA 1H3IA 4O30A 3SW9A 3F9YA 4YNMA 5EX3A 5EX0A 4IJ8A 4YPEA 4J8OA 3RQ4A 4JDSA 4YNPA 3TG4A 3VV0A 5CPRB 3RAYA 5F59A 3K5KA 3N71A 2JV0A 3RIBA 3KMAA 3S7FA 1ML9A 4QEOA 1N3JA 5JJ0A 5AYFA 3MO5A 3OXLA 3F9ZA 3MEKA 3M59A 3KMTA 5ARFA 2QPWA 3F9XA 4LDGA
chains in the Genus database with same CATH topology
3S7DA 1N6AA 3VUZA 2IGQA 5F5EA 5HQ8A 3MO2A 3RJWA 3F9WA 1MVHA 5F6KC 4IJDA 4QENA 5CCMA 4YPAA 3DALA 4C1QA 5LSXA 3BO5A 4BUPA 5HI7A 1MT6A 4NJ5A 3KMJA 3OXFA 5T0MA 1MVXA 3S8PA 4RZ0A 5T0KA 3M56A 4MI5A 5EG2A 1XQHA 3OS5A 4WUYA 4Z4PA 5KJKA 4H12A 3QWVA 5KJMA 2G46A 4QEPA 3M55A 1MUFA 3CBOA 3CBPA 4FMUA 3HNAA 2BQZA 3M5AA 3M57A 3M53A 4J7IA 5TEGA 3M58A 3S7BA 3TG5A 3DB5A 1N6CA 2F69A 4JLGA 4AU7A 5F6LA 3EP0A 4I51A 3RU0A 5CCLA 5JINA 5TH7A 2W5ZA 4E47A 5ARGA 4MI0A 5JIYA 3OPEA 1O9SA 3S7JA 1ZKKA 4J7FA 3IHXA 1PEGA 3OOIA 2O8JA 3CBMA 3PDNA 4J83A 3QWPA 2R3AA 4NVQA 5KJNA 4YNDA 3OXGA 3M54A 4O6FA 3FPDA 5KJLA 5JHNA 5TTFA 5LSZA 3MO0A 3SWCA 2W5YA 2RFIA 3QWWA 5T5GA 4YPUA 1H3IA 4O30A 3SW9A 3F9YA 4YNMA 5EX3A 5EX0A 4IJ8A 4YPEA 4J8OA 3RQ4A 4JDSA 4YNPA 3TG4A 3VV0A 5CPRB 3RAYA 5F59A 3K5KA 3N71A 2JV0A 3RIBA 3KMAA 3S7FA 1ML9A 4QEOA 1N3JA 5JJ0A 5AYFA 3MO5A 3OXLA 3F9ZA 3MEKA 3M59A 3KMTA 5ARFA 2QPWA 3F9XA 4LDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S7D A;  1N6A A;  3VUZ A;  2IGQ A;  5F5E A;  5HQ8 A;  3MO2 A;  3RJW A;  3F9W A;  1MVH A;  5F6K C;  4IJD A;  4QEN A;  5CCM A;  4YPA A;  3DAL A;  4C1Q A;  5LSX A;  3BO5 A;  4BUP A;  5HI7 A;  1MT6 A;  4NJ5 A;  3KMJ A;  3OXF A;  5T0M A;  1MVX A;  3S8P A;  4RZ0 A;  5T0K A;  3M56 A;  4MI5 A;  5EG2 A;  1XQH A;  3OS5 A;  4WUY A;  4Z4P A;  5KJK A;  4H12 A;  3QWV A;  5KJM A;  2G46 A;  4QEP A;  3M55 A;  1MUF A;  3CBO A;  3CBP A;  4FMU A;  3HNA A;  2BQZ A;  3M5A A;  3M57 A;  3M53 A;  4J7I A;  5TEG A;  3M58 A;  3S7B A;  3TG5 A;  3DB5 A;  1N6C A;  2F69 A;  4JLG A;  4AU7 A;  5F6L A;  3EP0 A;  4I51 A;  3RU0 A;  5CCL A;  5JIN A;  5TH7 A;  2W5Z A;  4E47 A;  5ARG A;  4MI0 A;  5JIY A;  3OPE A;  1O9S A;  3S7J A;  1ZKK A;  4J7F A;  3IHX A;  1PEG A;  3OOI A;  2O8J A;  3CBM A;  3PDN A;  4J83 A;  3QWP A;  2R3A A;  4NVQ A;  5KJN A;  4YND A;  3OXG A;  3M54 A;  4O6F A;  3FPD A;  5KJL A;  5JHN A;  5TTF A;  5LSZ A;  3MO0 A;  3SWC A;  2W5Y A;  2RFI A;  3QWW A;  5T5G A;  4YPU A;  1H3I A;  4O30 A;  3SW9 A;  3F9Y A;  4YNM A;  5EX3 A;  5EX0 A;  4IJ8 A;  4YPE A;  4J8O A;  3RQ4 A;  4JDS A;  4YNP A;  3TG4 A;  3VV0 A;  5CPR B;  3RAY A;  5F59 A;  3K5K A;  3N71 A;  2JV0 A;  3RIB A;  3KMA A;  3S7F A;  1ML9 A;  4QEO A;  1N3J A;  5JJ0 A;  5AYF A;  3MO5 A;  3OXL A;  3F9Z A;  3MEK A;  3M59 A;  3KMT A;  5ARF A;  2QPW A;  3F9X A;  4LDG A; 
#chains in the Genus database with same CATH topology
 3S7D A;  1N6A A;  3VUZ A;  2IGQ A;  5F5E A;  5HQ8 A;  3MO2 A;  3RJW A;  3F9W A;  1MVH A;  5F6K C;  4IJD A;  4QEN A;  5CCM A;  4YPA A;  3DAL A;  4C1Q A;  5LSX A;  3BO5 A;  4BUP A;  5HI7 A;  1MT6 A;  4NJ5 A;  3KMJ A;  3OXF A;  5T0M A;  1MVX A;  3S8P A;  4RZ0 A;  5T0K A;  3M56 A;  4MI5 A;  5EG2 A;  1XQH A;  3OS5 A;  4WUY A;  4Z4P A;  5KJK A;  4H12 A;  3QWV A;  5KJM A;  2G46 A;  4QEP A;  3M55 A;  1MUF A;  3CBO A;  3CBP A;  4FMU A;  3HNA A;  2BQZ A;  3M5A A;  3M57 A;  3M53 A;  4J7I A;  5TEG A;  3M58 A;  3S7B A;  3TG5 A;  3DB5 A;  1N6C A;  2F69 A;  4JLG A;  4AU7 A;  5F6L A;  3EP0 A;  4I51 A;  3RU0 A;  5CCL A;  5JIN A;  5TH7 A;  2W5Z A;  4E47 A;  5ARG A;  4MI0 A;  5JIY A;  3OPE A;  1O9S A;  3S7J A;  1ZKK A;  4J7F A;  3IHX A;  1PEG A;  3OOI A;  2O8J A;  3CBM A;  3PDN A;  4J83 A;  3QWP A;  2R3A A;  4NVQ A;  5KJN A;  4YND A;  3OXG A;  3M54 A;  4O6F A;  3FPD A;  5KJL A;  5JHN A;  5TTF A;  5LSZ A;  3MO0 A;  3SWC A;  2W5Y A;  2RFI A;  3QWW A;  5T5G A;  4YPU A;  1H3I A;  4O30 A;  3SW9 A;  3F9Y A;  4YNM A;  5EX3 A;  5EX0 A;  4IJ8 A;  4YPE A;  4J8O A;  3RQ4 A;  4JDS A;  4YNP A;  3TG4 A;  3VV0 A;  5CPR B;  3RAY A;  5F59 A;  3K5K A;  3N71 A;  2JV0 A;  3RIB A;  3KMA A;  3S7F A;  1ML9 A;  4QEO A;  1N3J A;  5JJ0 A;  5AYF A;  3MO5 A;  3OXL A;  3F9Z A;  3MEK A;  3M59 A;  3KMT A;  5ARF A;  2QPW A;  3F9X A;  4LDG A; 
#chains in the Genus database with same CATH homology
 3S7D A;  1N6A A;  3VUZ A;  2IGQ A;  5F5E A;  5HQ8 A;  3MO2 A;  3RJW A;  3F9W A;  1MVH A;  5F6K C;  4IJD A;  4QEN A;  5CCM A;  4YPA A;  3DAL A;  4C1Q A;  5LSX A;  3BO5 A;  4BUP A;  5HI7 A;  1MT6 A;  4NJ5 A;  3KMJ A;  3OXF A;  5T0M A;  1MVX A;  3S8P A;  4RZ0 A;  5T0K A;  3M56 A;  4MI5 A;  5EG2 A;  1XQH A;  3OS5 A;  4WUY A;  4Z4P A;  5KJK A;  4H12 A;  3QWV A;  5KJM A;  2G46 A;  4QEP A;  3M55 A;  1MUF A;  3CBO A;  3CBP A;  4FMU A;  3HNA A;  2BQZ A;  3M5A A;  3M57 A;  3M53 A;  4J7I A;  5TEG A;  3M58 A;  3S7B A;  3TG5 A;  3DB5 A;  1N6C A;  2F69 A;  4JLG A;  4AU7 A;  5F6L A;  3EP0 A;  4I51 A;  3RU0 A;  5CCL A;  5JIN A;  5TH7 A;  2W5Z A;  4E47 A;  5ARG A;  4MI0 A;  5JIY A;  3OPE A;  1O9S A;  3S7J A;  1ZKK A;  4J7F A;  3IHX A;  1PEG A;  3OOI A;  2O8J A;  3CBM A;  3PDN A;  4J83 A;  3QWP A;  2R3A A;  4NVQ A;  5KJN A;  4YND A;  3OXG A;  3M54 A;  4O6F A;  3FPD A;  5KJL A;  5JHN A;  5TTF A;  5LSZ A;  3MO0 A;  3SWC A;  2W5Y A;  2RFI A;  3QWW A;  5T5G A;  4YPU A;  1H3I A;  4O30 A;  3SW9 A;  3F9Y A;  4YNM A;  5EX3 A;  5EX0 A;  4IJ8 A;  4YPE A;  4J8O A;  3RQ4 A;  4JDS A;  4YNP A;  3TG4 A;  3VV0 A;  5CPR B;  3RAY A;  5F59 A;  3K5K A;  3N71 A;  2JV0 A;  3RIB A;  3KMA A;  3S7F A;  1ML9 A;  4QEO A;  1N3J A;  5JJ0 A;  5AYF A;  3MO5 A;  3OXL A;  3F9Z A;  3MEK A;  3M59 A;  3KMT A;  5ARF A;  2QPW A;  3F9X A;  4LDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...