4QEOA

Crystal structure of kryptonite in complex with mchh dna, h3(1-15) peptide and sah
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
526
structure length
472
Chain Sequence
LEPHLKVTKCLRLFNKQYLLCVQAKLSRPDLKGVTEMIKAKAILYPRKIIGDLPGIDVGHRFFSRAEMCAVGFHNHWLNGIDYMSMEYEKEYSNYKLPLAVSIVMSGQYEDDLDNADTVTYTGQGGHNLTGNKRQIKDQLLERGNLALKHCCEYNVPVRVTRGHNCKSSYTKRVYTYDGLYKVEKFWAQKGVSGFTVYKYRLKRLEGQPELTTDIEGLVCEDISGGLEFKGIPATNRVDDSPVSPTSGFTYIKSLIIEPNVIIPKSSTGCNCRGSCTDSKKCACAKLNGGNFPYVDLNDGRLIESRDVVFECGPHCGCGPKCVNRTSQKRLRFNLEVFRSAKKGWAVRSWEYIPAGSPVCEYIGVVRRTADVNEYIFEIDCPEFCIDAGSTGNFARFINHSCEPNLFVQCVLSSHQDIRLARVVLFAADNISPMQELTYDYGYALDSVHGPDGKVKQLACYCGALNCRKRLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific SUV
publication title Mechanism of DNA Methylation-Directed Histone Methylation by KRYPTONITE.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription/dna
total genus 139
structure length 472
sequence length 526
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2014-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF02182 SAD_SRA SAD/SRA domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4qeoA03
5EX3A 4H12A 4JLGA 1MVHA 3MO0A 5ARGA 5KJKA 2R3AA 4O6FA 5HQ8A 3OXFA 5F6LA 5F59A 5LSZA 3F9ZA 4J83A 4J8OA 2RFIA 3CBMA 3DALA 3M56A 3OPEA 4IJDA 4WUYA 4YPUA 5T0MA 2G46A 1N3JA 1MUFA 3K5KA 1N6CA 3F9WA 1H3IA 4NVQA 5JJ0A 2W5YA 5KJLA 5LSXA 3FPDA 4O30A 3OXLA 3S8PA 4MI5A 3N71A 3EP0A 4YNPA 3VUZA 4QENA 3IHXA 4IJ8A 3DB5A 2IGQA 5KJNA 4NJ5A 4YPAA 1PEGA 1ZKKA 1MT6A 4YNMA 3HNAA 3OOIA 5ARFA 2F69A 4LDGA 4BUPA 4FMUA 5T0KA 5F6KC 3PDNA 3OS5A 5TH7A 4YPEA 2BQZA 4MI0A 5T5GA 3VV0A 3F9XA 3TG4A 4J7FA 3RQ4A 4QEOA 3QWPA 5TEGA 3M53A 5EX0A 5JINA 5EG2A 3KMTA 5CPRB 3M57A 3SWCA 1O9SA 1N6AA 3M54A 3S7JA 3MO2A 2W5ZA 3RU0A 3MEKA 3MO5A 4RZ0A 4I51A 3S7DA 5CCMA 3RAYA 3CBPA 3QWWA 5JIYA 3BO5A 3CBOA 3S7FA 1XQHA 3TG5A 5AYFA 3RIBA 3QWVA 3F9YA 3S7BA 4JDSA 4C1QA 5CCLA 2O8JA 3M5AA 3OXGA 3RJWA 4Z4PA 5HI7A 5KJMA 3KMAA 4QEPA 4YNDA 1ML9A 3M58A 1MVXA 4J7IA 4E47A 5F5EA 3M59A 5JHNA 4AU7A 5TTFA 3M55A 3SW9A 3KMJA 2QPWA 2JV0A
chains in the Genus database with same CATH superfamily
5EX3A 4H12A 4JLGA 1MVHA 3MO0A 5ARGA 5KJKA 2R3AA 4O6FA 5HQ8A 3OXFA 5F6LA 5F59A 5LSZA 3F9ZA 4J83A 4J8OA 2RFIA 3CBMA 3DALA 3M56A 3OPEA 4IJDA 4WUYA 4YPUA 5T0MA 2G46A 1N3JA 1MUFA 3K5KA 1N6CA 3F9WA 1H3IA 4NVQA 5JJ0A 2W5YA 5KJLA 5LSXA 3FPDA 4O30A 3OXLA 3S8PA 4MI5A 3N71A 3EP0A 4YNPA 3VUZA 4QENA 3IHXA 4IJ8A 3DB5A 2IGQA 5KJNA 4NJ5A 4YPAA 1PEGA 1ZKKA 1MT6A 4YNMA 3HNAA 3OOIA 5ARFA 2F69A 4LDGA 4BUPA 4FMUA 5T0KA 5F6KC 3PDNA 3OS5A 5TH7A 4YPEA 2BQZA 4MI0A 5T5GA 3VV0A 3F9XA 3TG4A 4J7FA 3RQ4A 4QEOA 3QWPA 5TEGA 3M53A 5EX0A 5JINA 5EG2A 3KMTA 5CPRB 3M57A 3SWCA 1O9SA 1N6AA 3M54A 3S7JA 3MO2A 2W5ZA 3RU0A 3MEKA 3MO5A 4RZ0A 4I51A 3S7DA 5CCMA 3RAYA 3CBPA 3QWWA 5JIYA 3BO5A 3CBOA 3S7FA 1XQHA 3TG5A 5AYFA 3RIBA 3QWVA 3F9YA 3S7BA 4JDSA 4C1QA 5CCLA 2O8JA 3M5AA 3OXGA 3RJWA 4Z4PA 5HI7A 5KJMA 3KMAA 4QEPA 4YNDA 1ML9A 3M58A 1MVXA 4J7IA 4E47A 5F5EA 3M59A 5JHNA 4AU7A 5TTFA 3M55A 3SW9A 3KMJA 2QPWA 2JV0A
chains in the Genus database with same CATH topology
5EX3A 4H12A 4JLGA 1MVHA 3MO0A 5ARGA 5KJKA 2R3AA 4O6FA 5HQ8A 3OXFA 5F6LA 5F59A 5LSZA 3F9ZA 4J83A 4J8OA 2RFIA 3CBMA 3DALA 3M56A 3OPEA 4IJDA 4WUYA 4YPUA 5T0MA 2G46A 1N3JA 1MUFA 3K5KA 1N6CA 3F9WA 1H3IA 4NVQA 5JJ0A 2W5YA 5KJLA 5LSXA 3FPDA 4O30A 3OXLA 3S8PA 4MI5A 3N71A 3EP0A 4YNPA 3VUZA 4QENA 3IHXA 4IJ8A 3DB5A 2IGQA 5KJNA 4NJ5A 4YPAA 1PEGA 1ZKKA 1MT6A 4YNMA 3HNAA 3OOIA 5ARFA 2F69A 4LDGA 4BUPA 4FMUA 5T0KA 5F6KC 3PDNA 3OS5A 5TH7A 4YPEA 2BQZA 4MI0A 5T5GA 3VV0A 3F9XA 3TG4A 4J7FA 3RQ4A 4QEOA 3QWPA 5TEGA 3M53A 5EX0A 5JINA 5EG2A 3KMTA 5CPRB 3M57A 3SWCA 1O9SA 1N6AA 3M54A 3S7JA 3MO2A 2W5ZA 3RU0A 3MEKA 3MO5A 4RZ0A 4I51A 3S7DA 5CCMA 3RAYA 3CBPA 3QWWA 5JIYA 3BO5A 3CBOA 3S7FA 1XQHA 3TG5A 5AYFA 3RIBA 3QWVA 3F9YA 3S7BA 4JDSA 4C1QA 5CCLA 2O8JA 3M5AA 3OXGA 3RJWA 4Z4PA 5HI7A 5KJMA 3KMAA 4QEPA 4YNDA 1ML9A 3M58A 1MVXA 4J7IA 4E47A 5F5EA 3M59A 5JHNA 4AU7A 5TTFA 3M55A 3SW9A 3KMJA 2QPWA 2JV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EX3 A;  4H12 A;  4JLG A;  1MVH A;  3MO0 A;  5ARG A;  5KJK A;  2R3A A;  4O6F A;  5HQ8 A;  3OXF A;  5F6L A;  5F59 A;  5LSZ A;  3F9Z A;  4J83 A;  4J8O A;  2RFI A;  3CBM A;  3DAL A;  3M56 A;  3OPE A;  4IJD A;  4WUY A;  4YPU A;  5T0M A;  2G46 A;  1N3J A;  1MUF A;  3K5K A;  1N6C A;  3F9W A;  1H3I A;  4NVQ A;  5JJ0 A;  2W5Y A;  5KJL A;  5LSX A;  3FPD A;  4O30 A;  3OXL A;  3S8P A;  4MI5 A;  3N71 A;  3EP0 A;  4YNP A;  3VUZ A;  4QEN A;  3IHX A;  4IJ8 A;  3DB5 A;  2IGQ A;  5KJN A;  4NJ5 A;  4YPA A;  1PEG A;  1ZKK A;  1MT6 A;  4YNM A;  3HNA A;  3OOI A;  5ARF A;  2F69 A;  4LDG A;  4BUP A;  4FMU A;  5T0K A;  5F6K C;  3PDN A;  3OS5 A;  5TH7 A;  4YPE A;  2BQZ A;  4MI0 A;  5T5G A;  3VV0 A;  3F9X A;  3TG4 A;  4J7F A;  3RQ4 A;  4QEO A;  3QWP A;  5TEG A;  3M53 A;  5EX0 A;  5JIN A;  5EG2 A;  3KMT A;  5CPR B;  3M57 A;  3SWC A;  1O9S A;  1N6A A;  3M54 A;  3S7J A;  3MO2 A;  2W5Z A;  3RU0 A;  3MEK A;  3MO5 A;  4RZ0 A;  4I51 A;  3S7D A;  5CCM A;  3RAY A;  3CBP A;  3QWW A;  5JIY A;  3BO5 A;  3CBO A;  3S7F A;  1XQH A;  3TG5 A;  5AYF A;  3RIB A;  3QWV A;  3F9Y A;  3S7B A;  4JDS A;  4C1Q A;  5CCL A;  2O8J A;  3M5A A;  3OXG A;  3RJW A;  4Z4P A;  5HI7 A;  5KJM A;  3KMA A;  4QEP A;  4YND A;  1ML9 A;  3M58 A;  1MVX A;  4J7I A;  4E47 A;  5F5E A;  3M59 A;  5JHN A;  4AU7 A;  5TTF A;  3M55 A;  3SW9 A;  3KMJ A;  2QPW A;  2JV0 A; 
#chains in the Genus database with same CATH topology
 5EX3 A;  4H12 A;  4JLG A;  1MVH A;  3MO0 A;  5ARG A;  5KJK A;  2R3A A;  4O6F A;  5HQ8 A;  3OXF A;  5F6L A;  5F59 A;  5LSZ A;  3F9Z A;  4J83 A;  4J8O A;  2RFI A;  3CBM A;  3DAL A;  3M56 A;  3OPE A;  4IJD A;  4WUY A;  4YPU A;  5T0M A;  2G46 A;  1N3J A;  1MUF A;  3K5K A;  1N6C A;  3F9W A;  1H3I A;  4NVQ A;  5JJ0 A;  2W5Y A;  5KJL A;  5LSX A;  3FPD A;  4O30 A;  3OXL A;  3S8P A;  4MI5 A;  3N71 A;  3EP0 A;  4YNP A;  3VUZ A;  4QEN A;  3IHX A;  4IJ8 A;  3DB5 A;  2IGQ A;  5KJN A;  4NJ5 A;  4YPA A;  1PEG A;  1ZKK A;  1MT6 A;  4YNM A;  3HNA A;  3OOI A;  5ARF A;  2F69 A;  4LDG A;  4BUP A;  4FMU A;  5T0K A;  5F6K C;  3PDN A;  3OS5 A;  5TH7 A;  4YPE A;  2BQZ A;  4MI0 A;  5T5G A;  3VV0 A;  3F9X A;  3TG4 A;  4J7F A;  3RQ4 A;  4QEO A;  3QWP A;  5TEG A;  3M53 A;  5EX0 A;  5JIN A;  5EG2 A;  3KMT A;  5CPR B;  3M57 A;  3SWC A;  1O9S A;  1N6A A;  3M54 A;  3S7J A;  3MO2 A;  2W5Z A;  3RU0 A;  3MEK A;  3MO5 A;  4RZ0 A;  4I51 A;  3S7D A;  5CCM A;  3RAY A;  3CBP A;  3QWW A;  5JIY A;  3BO5 A;  3CBO A;  3S7F A;  1XQH A;  3TG5 A;  5AYF A;  3RIB A;  3QWV A;  3F9Y A;  3S7B A;  4JDS A;  4C1Q A;  5CCL A;  2O8J A;  3M5A A;  3OXG A;  3RJW A;  4Z4P A;  5HI7 A;  5KJM A;  3KMA A;  4QEP A;  4YND A;  1ML9 A;  3M58 A;  1MVX A;  4J7I A;  4E47 A;  5F5E A;  3M59 A;  5JHN A;  4AU7 A;  5TTF A;  3M55 A;  3SW9 A;  3KMJ A;  2QPW A;  2JV0 A; 
#chains in the Genus database with same CATH homology
 5EX3 A;  4H12 A;  4JLG A;  1MVH A;  3MO0 A;  5ARG A;  5KJK A;  2R3A A;  4O6F A;  5HQ8 A;  3OXF A;  5F6L A;  5F59 A;  5LSZ A;  3F9Z A;  4J83 A;  4J8O A;  2RFI A;  3CBM A;  3DAL A;  3M56 A;  3OPE A;  4IJD A;  4WUY A;  4YPU A;  5T0M A;  2G46 A;  1N3J A;  1MUF A;  3K5K A;  1N6C A;  3F9W A;  1H3I A;  4NVQ A;  5JJ0 A;  2W5Y A;  5KJL A;  5LSX A;  3FPD A;  4O30 A;  3OXL A;  3S8P A;  4MI5 A;  3N71 A;  3EP0 A;  4YNP A;  3VUZ A;  4QEN A;  3IHX A;  4IJ8 A;  3DB5 A;  2IGQ A;  5KJN A;  4NJ5 A;  4YPA A;  1PEG A;  1ZKK A;  1MT6 A;  4YNM A;  3HNA A;  3OOI A;  5ARF A;  2F69 A;  4LDG A;  4BUP A;  4FMU A;  5T0K A;  5F6K C;  3PDN A;  3OS5 A;  5TH7 A;  4YPE A;  2BQZ A;  4MI0 A;  5T5G A;  3VV0 A;  3F9X A;  3TG4 A;  4J7F A;  3RQ4 A;  4QEO A;  3QWP A;  5TEG A;  3M53 A;  5EX0 A;  5JIN A;  5EG2 A;  3KMT A;  5CPR B;  3M57 A;  3SWC A;  1O9S A;  1N6A A;  3M54 A;  3S7J A;  3MO2 A;  2W5Z A;  3RU0 A;  3MEK A;  3MO5 A;  4RZ0 A;  4I51 A;  3S7D A;  5CCM A;  3RAY A;  3CBP A;  3QWW A;  5JIY A;  3BO5 A;  3CBO A;  3S7F A;  1XQH A;  3TG5 A;  5AYF A;  3RIB A;  3QWV A;  3F9Y A;  3S7B A;  4JDS A;  4C1Q A;  5CCL A;  2O8J A;  3M5A A;  3OXG A;  3RJW A;  4Z4P A;  5HI7 A;  5KJM A;  3KMA A;  4QEP A;  4YND A;  1ML9 A;  3M58 A;  1MVX A;  4J7I A;  4E47 A;  5F5E A;  3M59 A;  5JHN A;  4AU7 A;  5TTF A;  3M55 A;  3SW9 A;  3KMJ A;  2QPW A;  2JV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...