4QEOA

Crystal structure of kryptonite in complex with mchh dna, h3(1-15) peptide and sah
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
526
structure length
472
Chain Sequence
LEPHLKVTKCLRLFNKQYLLCVQAKLSRPDLKGVTEMIKAKAILYPRKIIGDLPGIDVGHRFFSRAEMCAVGFHNHWLNGIDYMSMEYEKEYSNYKLPLAVSIVMSGQYEDDLDNADTVTYTGQGGHNLTGNKRQIKDQLLERGNLALKHCCEYNVPVRVTRGHNCKSSYTKRVYTYDGLYKVEKFWAQKGVSGFTVYKYRLKRLEGQPELTTDIEGLVCEDISGGLEFKGIPATNRVDDSPVSPTSGFTYIKSLIIEPNVIIPKSSTGCNCRGSCTDSKKCACAKLNGGNFPYVDLNDGRLIESRDVVFECGPHCGCGPKCVNRTSQKRLRFNLEVFRSAKKGWAVRSWEYIPAGSPVCEYIGVVRRTADVNEYIFEIDCPEFCIDAGSTGNFARFINHSCEPNLFVQCVLSSHQDIRLARVVLFAADNISPMQELTYDYGYALDSVHGPDGKVKQLACYCGALNCRKRLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific SUV
publication title Mechanism of DNA Methylation-Directed Histone Methylation by KRYPTONITE.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription/dna
total genus 139
structure length 472
sequence length 526
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2014-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF02182 SAD_SRA SAD/SRA domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4qeoA03
5KJNA 4QEPA 4YPAA 1ZKKA 3M59A 1MVXA 3RJWA 5CPRB 3VV0A 1N3JA 4O6FA 2O8JA 5T0KA 4IJ8A 5KJLA 3M5AA 1XQHA 3M57A 1N6AA 3OXLA 3VUZA 4C1QA 3BO5A 5ARGA 5EG2A 3RU0A 3S8PA 3MO2A 3K5KA 1H3IA 3S7DA 2W5ZA 3EP0A 3S7FA 5HQ8A 3PDNA 5TH7A 4NVQA 5TEGA 2F69A 3RIBA 4FMUA 1PEGA 5T0MA 5T5GA 2QPWA 3KMTA 3CBMA 4H12A 4MI0A 4J8OA 3M58A 4I51A 4Z4PA 3QWPA 3OXGA 2IGQA 3DALA 5F5EA 1MVHA 3QWVA 3CBOA 5HI7A 5KJKA 3OXFA 5JINA 3F9XA 1ML9A 3SW9A 4LDGA 4NJ5A 3MO0A 3M55A 5F59A 3MEKA 4QENA 5EX3A 1MUFA 5LSXA 3M53A 3RAYA 1O9SA 3RQ4A 4WUYA 3S7JA 3HNAA 4O30A 4YNDA 3M56A 5JIYA 2W5YA 4YNPA 4AU7A 5ARFA 4IJDA 5LSZA 5CCMA 1N6CA 1MT6A 3M54A 5AYFA 2G46A 3S7BA 4JDSA 4BUPA 3TG4A 5CCLA 3KMAA 3F9YA 4J7FA 5JHNA 3OS5A 3TG5A 4E47A 4JLGA 5F6KC 3N71A 4J7IA 4YPUA 3KMJA 4YNMA 5EX0A 3OPEA 5KJMA 5F6LA 4J83A 5JJ0A 3F9WA 4QEOA 2RFIA 2R3AA 3DB5A 3IHXA 4RZ0A 5TTFA 2BQZA 4MI5A 3F9ZA 3CBPA 3OOIA 3QWWA 4YPEA 3SWCA 2JV0A 3FPDA 3MO5A
chains in the Genus database with same CATH superfamily
5KJNA 4QEPA 4YPAA 1ZKKA 3M59A 1MVXA 3RJWA 5CPRB 3VV0A 1N3JA 4O6FA 2O8JA 5T0KA 4IJ8A 5KJLA 3M5AA 1XQHA 3M57A 1N6AA 3OXLA 3VUZA 4C1QA 3BO5A 5ARGA 5EG2A 3RU0A 3S8PA 3MO2A 3K5KA 1H3IA 3S7DA 2W5ZA 3EP0A 3S7FA 5HQ8A 3PDNA 5TH7A 4NVQA 5TEGA 2F69A 3RIBA 4FMUA 1PEGA 5T0MA 5T5GA 2QPWA 3KMTA 3CBMA 4H12A 4MI0A 4J8OA 3M58A 4I51A 4Z4PA 3QWPA 3OXGA 2IGQA 3DALA 5F5EA 1MVHA 3QWVA 3CBOA 5HI7A 5KJKA 3OXFA 5JINA 3F9XA 1ML9A 3SW9A 4LDGA 4NJ5A 3MO0A 3M55A 5F59A 3MEKA 4QENA 5EX3A 1MUFA 5LSXA 3M53A 3RAYA 1O9SA 3RQ4A 4WUYA 3S7JA 3HNAA 4O30A 4YNDA 3M56A 5JIYA 2W5YA 4YNPA 4AU7A 5ARFA 4IJDA 5LSZA 5CCMA 1N6CA 1MT6A 3M54A 5AYFA 2G46A 3S7BA 4JDSA 4BUPA 3TG4A 5CCLA 3KMAA 3F9YA 4J7FA 5JHNA 3OS5A 3TG5A 4E47A 4JLGA 5F6KC 3N71A 4J7IA 4YPUA 3KMJA 4YNMA 5EX0A 3OPEA 5KJMA 5F6LA 4J83A 5JJ0A 3F9WA 4QEOA 2RFIA 2R3AA 3DB5A 3IHXA 4RZ0A 5TTFA 2BQZA 4MI5A 3F9ZA 3CBPA 3OOIA 3QWWA 4YPEA 3SWCA 2JV0A 3FPDA 3MO5A
chains in the Genus database with same CATH topology
5KJNA 4QEPA 4YPAA 1ZKKA 3M59A 1MVXA 3RJWA 5CPRB 3VV0A 1N3JA 4O6FA 2O8JA 5T0KA 4IJ8A 5KJLA 3M5AA 1XQHA 3M57A 1N6AA 3OXLA 3VUZA 4C1QA 3BO5A 5ARGA 5EG2A 3RU0A 3S8PA 3MO2A 3K5KA 1H3IA 3S7DA 2W5ZA 3EP0A 3S7FA 5HQ8A 3PDNA 5TH7A 4NVQA 5TEGA 2F69A 3RIBA 4FMUA 1PEGA 5T0MA 5T5GA 2QPWA 3KMTA 3CBMA 4H12A 4MI0A 4J8OA 3M58A 4I51A 4Z4PA 3QWPA 3OXGA 2IGQA 3DALA 5F5EA 1MVHA 3QWVA 3CBOA 5HI7A 5KJKA 3OXFA 5JINA 3F9XA 1ML9A 3SW9A 4LDGA 4NJ5A 3MO0A 3M55A 5F59A 3MEKA 4QENA 5EX3A 1MUFA 5LSXA 3M53A 3RAYA 1O9SA 3RQ4A 4WUYA 3S7JA 3HNAA 4O30A 4YNDA 3M56A 5JIYA 2W5YA 4YNPA 4AU7A 5ARFA 4IJDA 5LSZA 5CCMA 1N6CA 1MT6A 3M54A 5AYFA 2G46A 3S7BA 4JDSA 4BUPA 3TG4A 5CCLA 3KMAA 3F9YA 4J7FA 5JHNA 3OS5A 3TG5A 4E47A 4JLGA 5F6KC 3N71A 4J7IA 4YPUA 3KMJA 4YNMA 5EX0A 3OPEA 5KJMA 5F6LA 4J83A 5JJ0A 3F9WA 4QEOA 2RFIA 2R3AA 3DB5A 3IHXA 4RZ0A 5TTFA 2BQZA 4MI5A 3F9ZA 3CBPA 3OOIA 3QWWA 4YPEA 3SWCA 2JV0A 3FPDA 3MO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KJN A;  4QEP A;  4YPA A;  1ZKK A;  3M59 A;  1MVX A;  3RJW A;  5CPR B;  3VV0 A;  1N3J A;  4O6F A;  2O8J A;  5T0K A;  4IJ8 A;  5KJL A;  3M5A A;  1XQH A;  3M57 A;  1N6A A;  3OXL A;  3VUZ A;  4C1Q A;  3BO5 A;  5ARG A;  5EG2 A;  3RU0 A;  3S8P A;  3MO2 A;  3K5K A;  1H3I A;  3S7D A;  2W5Z A;  3EP0 A;  3S7F A;  5HQ8 A;  3PDN A;  5TH7 A;  4NVQ A;  5TEG A;  2F69 A;  3RIB A;  4FMU A;  1PEG A;  5T0M A;  5T5G A;  2QPW A;  3KMT A;  3CBM A;  4H12 A;  4MI0 A;  4J8O A;  3M58 A;  4I51 A;  4Z4P A;  3QWP A;  3OXG A;  2IGQ A;  3DAL A;  5F5E A;  1MVH A;  3QWV A;  3CBO A;  5HI7 A;  5KJK A;  3OXF A;  5JIN A;  3F9X A;  1ML9 A;  3SW9 A;  4LDG A;  4NJ5 A;  3MO0 A;  3M55 A;  5F59 A;  3MEK A;  4QEN A;  5EX3 A;  1MUF A;  5LSX A;  3M53 A;  3RAY A;  1O9S A;  3RQ4 A;  4WUY A;  3S7J A;  3HNA A;  4O30 A;  4YND A;  3M56 A;  5JIY A;  2W5Y A;  4YNP A;  4AU7 A;  5ARF A;  4IJD A;  5LSZ A;  5CCM A;  1N6C A;  1MT6 A;  3M54 A;  5AYF A;  2G46 A;  3S7B A;  4JDS A;  4BUP A;  3TG4 A;  5CCL A;  3KMA A;  3F9Y A;  4J7F A;  5JHN A;  3OS5 A;  3TG5 A;  4E47 A;  4JLG A;  5F6K C;  3N71 A;  4J7I A;  4YPU A;  3KMJ A;  4YNM A;  5EX0 A;  3OPE A;  5KJM A;  5F6L A;  4J83 A;  5JJ0 A;  3F9W A;  4QEO A;  2RFI A;  2R3A A;  3DB5 A;  3IHX A;  4RZ0 A;  5TTF A;  2BQZ A;  4MI5 A;  3F9Z A;  3CBP A;  3OOI A;  3QWW A;  4YPE A;  3SWC A;  2JV0 A;  3FPD A;  3MO5 A; 
#chains in the Genus database with same CATH topology
 5KJN A;  4QEP A;  4YPA A;  1ZKK A;  3M59 A;  1MVX A;  3RJW A;  5CPR B;  3VV0 A;  1N3J A;  4O6F A;  2O8J A;  5T0K A;  4IJ8 A;  5KJL A;  3M5A A;  1XQH A;  3M57 A;  1N6A A;  3OXL A;  3VUZ A;  4C1Q A;  3BO5 A;  5ARG A;  5EG2 A;  3RU0 A;  3S8P A;  3MO2 A;  3K5K A;  1H3I A;  3S7D A;  2W5Z A;  3EP0 A;  3S7F A;  5HQ8 A;  3PDN A;  5TH7 A;  4NVQ A;  5TEG A;  2F69 A;  3RIB A;  4FMU A;  1PEG A;  5T0M A;  5T5G A;  2QPW A;  3KMT A;  3CBM A;  4H12 A;  4MI0 A;  4J8O A;  3M58 A;  4I51 A;  4Z4P A;  3QWP A;  3OXG A;  2IGQ A;  3DAL A;  5F5E A;  1MVH A;  3QWV A;  3CBO A;  5HI7 A;  5KJK A;  3OXF A;  5JIN A;  3F9X A;  1ML9 A;  3SW9 A;  4LDG A;  4NJ5 A;  3MO0 A;  3M55 A;  5F59 A;  3MEK A;  4QEN A;  5EX3 A;  1MUF A;  5LSX A;  3M53 A;  3RAY A;  1O9S A;  3RQ4 A;  4WUY A;  3S7J A;  3HNA A;  4O30 A;  4YND A;  3M56 A;  5JIY A;  2W5Y A;  4YNP A;  4AU7 A;  5ARF A;  4IJD A;  5LSZ A;  5CCM A;  1N6C A;  1MT6 A;  3M54 A;  5AYF A;  2G46 A;  3S7B A;  4JDS A;  4BUP A;  3TG4 A;  5CCL A;  3KMA A;  3F9Y A;  4J7F A;  5JHN A;  3OS5 A;  3TG5 A;  4E47 A;  4JLG A;  5F6K C;  3N71 A;  4J7I A;  4YPU A;  3KMJ A;  4YNM A;  5EX0 A;  3OPE A;  5KJM A;  5F6L A;  4J83 A;  5JJ0 A;  3F9W A;  4QEO A;  2RFI A;  2R3A A;  3DB5 A;  3IHX A;  4RZ0 A;  5TTF A;  2BQZ A;  4MI5 A;  3F9Z A;  3CBP A;  3OOI A;  3QWW A;  4YPE A;  3SWC A;  2JV0 A;  3FPD A;  3MO5 A; 
#chains in the Genus database with same CATH homology
 5KJN A;  4QEP A;  4YPA A;  1ZKK A;  3M59 A;  1MVX A;  3RJW A;  5CPR B;  3VV0 A;  1N3J A;  4O6F A;  2O8J A;  5T0K A;  4IJ8 A;  5KJL A;  3M5A A;  1XQH A;  3M57 A;  1N6A A;  3OXL A;  3VUZ A;  4C1Q A;  3BO5 A;  5ARG A;  5EG2 A;  3RU0 A;  3S8P A;  3MO2 A;  3K5K A;  1H3I A;  3S7D A;  2W5Z A;  3EP0 A;  3S7F A;  5HQ8 A;  3PDN A;  5TH7 A;  4NVQ A;  5TEG A;  2F69 A;  3RIB A;  4FMU A;  1PEG A;  5T0M A;  5T5G A;  2QPW A;  3KMT A;  3CBM A;  4H12 A;  4MI0 A;  4J8O A;  3M58 A;  4I51 A;  4Z4P A;  3QWP A;  3OXG A;  2IGQ A;  3DAL A;  5F5E A;  1MVH A;  3QWV A;  3CBO A;  5HI7 A;  5KJK A;  3OXF A;  5JIN A;  3F9X A;  1ML9 A;  3SW9 A;  4LDG A;  4NJ5 A;  3MO0 A;  3M55 A;  5F59 A;  3MEK A;  4QEN A;  5EX3 A;  1MUF A;  5LSX A;  3M53 A;  3RAY A;  1O9S A;  3RQ4 A;  4WUY A;  3S7J A;  3HNA A;  4O30 A;  4YND A;  3M56 A;  5JIY A;  2W5Y A;  4YNP A;  4AU7 A;  5ARF A;  4IJD A;  5LSZ A;  5CCM A;  1N6C A;  1MT6 A;  3M54 A;  5AYF A;  2G46 A;  3S7B A;  4JDS A;  4BUP A;  3TG4 A;  5CCL A;  3KMA A;  3F9Y A;  4J7F A;  5JHN A;  3OS5 A;  3TG5 A;  4E47 A;  4JLG A;  5F6K C;  3N71 A;  4J7I A;  4YPU A;  3KMJ A;  4YNM A;  5EX0 A;  3OPE A;  5KJM A;  5F6L A;  4J83 A;  5JJ0 A;  3F9W A;  4QEO A;  2RFI A;  2R3A A;  3DB5 A;  3IHX A;  4RZ0 A;  5TTF A;  2BQZ A;  4MI5 A;  3F9Z A;  3CBP A;  3OOI A;  3QWW A;  4YPE A;  3SWC A;  2JV0 A;  3FPD A;  3MO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...