5KJMA

Smyd2 in complex with az931
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
429
structure length
429
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords N-lysine methyltransferase SMYD2
publication title Design, Synthesis, and Biological Activity of Substrate Competitive SMYD2 Inhibitors.
pubmed rcsb
source organism Homo sapiens
total genus 145
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5kjmA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5kjmA01
5AYFA 4FMUA 4XIFA 3TG5A 4WNDA 4ABNA 5BW8C 4BUPA 4GZ6A 4UQYA 2VYIA 4H7XA 3S7BA 3OXLA 3ULQA 3MO2A 4QEOA 3RQ4A 5DIZA 5A7DB 3QKYA 3F9ZA 4UQXA 3EP0A 5FZSA 3VTYA 3KMJA 4BT9A 1KLXA 3RKVA 1KT0A 3SW9A 2MHKA 2XGMA 3ZHEA 2P58C 4GCOA 3LPZA 3M58A 2FO7A 5JIYA 3TG4A 5LCWC 1MVXA 3M59A 4JDSA 3CVNA 1H3IA 4NJ5A 4AIFA 3KAEA 4G1TA 5FT9A 4JHRA 3ASHA 4GCNA 5JJ0A 2BQZA 2W5YA 3Q5MA 4KBQA 3CVQA 3S7DA 2YHCA 4CDRA 1OUVA 1N6CA 3SWCA 1PC2A 4I51A 4RG9A 4G24A 4Y6CA 5LSZA 3K5KA 2GW1A 4U04A 4N3CA 2Q7FA 4YNDA 3AS4A 1TJCA 5TH7A 4H12A 3CBOA 3KMAA 4NQ0A 3RJWA 4GYOA 3UPVA 2LNIA 4LEUA 2G46A 2OOEA 1Y8MA 3S7FA 3CKBA 4NRHB 5HQ8A 1ZKKA 3DALA 2LSVA 4JA9A 1MUFA 3FPDA 2QPWA 4J8FA 5JJ6A 3DB5A 4C1QA 3FFLA 3VUZA 4I1AA 4H7YA 1A17A 5M72A 3QDNA 3LKUA 3S8PA 3LYAA 2RFIA 4I17A 3HNAA 2JV0A 4E47A 3CK9A 2LSUA 1NA0A 3QWWA 2VGXB 3MA5A 2FBNA 4J83A 3PDNA 2I6HA 5LCWJ 5CPRB 3KD7A 4GA2A 1KT1A 4KXKB 4J8OA 2IFUA 2PZIA 2IF4A 3GZ2A 4YPAA 2FF4A 3OXGA 4IJ8A 4B94A 2VSNA 2UY1B 3M56A 4CGVA 4GZ5A 4WNFA 5TEGA 4GYYA 3ESKA 5JJTA 3CEQA 1QQEA 2L6JA 4RZ0A 4GYWA 4JLGA 4J8EA 2FI7A 2VGYA 2C0LA 5F5EA 4JL0A 2XCBA 4MI5A 3VTXA 3M5AA 5F59A 3HYMB 2XCCA 3ASDA 3CVPA 1E96B 4U0UA 3MO5A 4I2WA 4WUYA 3BO5A 3E4BA 4G2VA 4U0SA 1IHGA 5FZRA 4HOSA 3U4TA 3GYZA 3KMTA 5BT1A 4G25A 1ELWA 3RIBA 3LCAA 3OPEA 5JINA 1WAO1 1ML9A 3IEGA 3N71A 3URZA 3QOUA 4I9EA 3OXFA 4UI9J 4XI9A 1O9SA 2F69A 3LY7A 2IGQA 5KJNA 2VQ2A 3RO2A 4AM9A 5F6KC 2Y4TA 5G04J 5TTFA 2NC9A 3OS5A 5FTPA 5JJ7A 4ME2A 1IYGA 3CBMA 4O30A 3MV3B 3ZFWA 3ZGQA 2KCKA 4GZ3A 2VSYA 3SF4A 4J8DA 4HOUA 5G05J 1XNFA 5ARGA 1MT6A 4QENA 4UI9C 4N39A 4N2QA 2R3AA 3BEEA 5CCMA 3OOIA 5G04C 5T5GA 3S7JA 4N5CA 3M54A 4QEPA 3Q4AB 2KCVA 3LY8A 4I9CA 2AVPA 3UQ3A 4N3AA 3MEKA 2Y4UA 2DBAA 3KS2A 3F9YA 3CK8A 2XEVA 1HXIA 3JYSA 5G05C 4WNEA 4YPEA 3U3WA 4O6FA 4BTAA 2ONDA 5KJLA 1N6AA 3FWVA 3RJVA 4G23A 1MVHA 3AS5A 5CCLA 1P5QA 5D0QD 2YQ8A 3LY9A 1ZU2A 3TAXA 4AY5A 2O8JA 5KJKA 3Q47B 2PQNA 4KYOB 1ZBPA 3ASFA 2C0MA 1N3JA 2UY1A 4I2ZA 3R9AB 4J0UA 5T0KA 5JHNA 2E2EA 3WXXA 1YA0A 3F9XA 3GZ1A 4YNMA 4YVOA 4WNGA 2UWJG 5CHEE 3FP3A 4RG6A 1B89A 5AYWD 3K9IA 5EG2A 2J9QA 4BTBA 2HR2A 3ZHEB 3M53A 5FZQA 3UUXA 3RAYA 4IJDA 4IN3B 1NZNA 1HH8A 5F6LA 3PE4A 2PQRA 2HO1A 5D0OD 1XQHA 5BNWA 5T0MA 2PL2A 2FEZA 4N2SA 1PEGA 1ELRA 3CBPA 3VV0A 3CKCA 2QFCA 4GA0A 4JA7A 3QWVA 3MO0A 4GA1A 4Z4PA 4G26A 3ZN3A 3RO3A 3Q49B 4EQFA 4YVQC 4W9RA 4HORA 4YPUA 4HOQA 2BUGA 4AU7A 3TGOA 2HYZA 3AS8A 2KCLA 2W5ZA 4MI0A 5FJYA 5DBKA 4BWRA 2XPIA 4A1SA 2R5SA 3M57A 4APOA 1WM5A 5ARFA 2KC7A 4XI0A 3F9WA 4UI9K 1NA3A 4YNPA 5EX3A 2C2LA 3CK7A 1HZ4A 2V5FA 4GPKA 4N3BA 2JLBA 3CVLA 4F3VA 3CV0A 4Y6WA 3O48A 3MKRA 4LDGA 3EDTB 4NVQA 4AY6A 3ASGA 3M55A 3PE3A 2WQHA 3QWPA 5HI7A 2XGSA 4U07A 5LSXA 1QZ2A 5C1DA 3GW4A 2XGOA 3MV2B 3ZPJA 5EKQD 1W3BA 4J7IA 4HOTA 3IHXA 2VGXA 4U0ZA 4J7FA 3SZ7A 5A6CA 1FCHA 3Q15A 5EX0A 3NF1A 2KATA 4CGWA 3RU0A 5KJMA 2WPVA 4BT8A 4UQZA
chains in the Genus database with same CATH superfamily
3RRUA 5BW8C 2PM7A 2VYIA 4XZ4A 1K1BA 5E75A 4G8LA 1JUQA 1YYHA 2J8SD 1K3ZD 5CEDB 3B7RL 4FU3A 5A7DB 3RSEG 4GTRA 4UQXA 4EBAG 3VTYA 2Y1LE 2RFMA 3FU5A 1KLXA 4IYPA 1DC2A 1KT0A 2QYJA 2VGEA 3SW9A 3NZUA 4XKCA 4V3IA 5EIBE 3M58A 3CVUA 5LCWC 1MVXA 4DI3A 3PEUB 1N4RA 3KAEA 4JHRA 1UN8A 2CHWA 5JJ0A 1MJ0A 3FULA 3GZSA 4DX7D 4JZYA 4KBQA 3TWUA 2OVFA 1OCRE 2IOLA 3KSQA 3SWCA 4I51A 4RG9A 1LD7A 5EYLA 4J6IA 4WWOA 4DUIA 3K5KA 5HKPA 3W9GA 1TN8A 3L9TA 3CBOA 1LTXA 4UWFA 1TNOA 1Y8MA 3V2OA 3L82A 4FJYA 3DXKG 4EBAA 1O1RA 5FQ4A 2HE0A 5BV1A 4WAFA 3FPDA 2QPWA 4C1QA 5CMYA 2EIJE 4H7YA 5EYPF 1S70B 3QDNA 3LKUA 3SFZA 4AP2A 4I17A 4ANXA 2XPYA 3U9WA 5AQBA 4E47A 3SD5A 3FHEA 2OEVA 3CK9A 2WVIA 4F1PA 4MBGA 1NA0A 3IKOB 3JQ0A 1OWOA 3PDNA 2I6HA 3C72A 4EPZA 4FHKA 3TWRA 2PZIA 5EDSA 1KZOA 3GZ2A 3OXGA 4BETA 2UY1B 4CGVA 2RKKA 5TEGA 3AU4A 3G2TA 4GYYA 2I2OA 3RRNB 3APCA 4DRXE 2DVWA 4RZ0A 2I9CA 2DCPA 4LRZA 2F8XK 4J8EA 4CEMA 4GMLA 4DX1A 2FI7A 5F5EA 4XE0A 2AXVA 1E8YA 1TEZA 3HYMB 2XCCA 4I43A 1E96B 5JMND 4U0SA 2VSOE 1IHGA 4TUMA 3HRAA 5JINA 5BV0A 3CSFA 1WAO1 3LDZA 3R7QA 5LP0A 2OCCE 2VTBB 3IEGA 3N71A 3URZA 5EN5D 3G2UA 1V54E 1U2VG 3UT4A 5HRYA 2VQ2A 1HE8A 4AM9A 2Y4TA 4HVBA 2CG3A 3OS5A 4RVBA 3CBMA 1UG3A 5AJDA 2X6HA 3MV3B 1QNFA 3DSVA 4WWNA 4FLHA 2EQXA 4HQDA 2Y69E 4UWKA 4LCTA 2R3AA 2IJGX 2AJAA 3UKRG 3QJZA 5KNGA 1N0QA 1DNPA 3LY8A 4CT0A 4WWPA 4N3AA 4P29A 2LUHA 5KCMA 3T5XA 3MEKA 3I4RB 2Y4UA 3CK8A 1HXIA 3JYSA 3TXNA 4DK5A 3P2BA 3UT7A 5BXOA 4O6FA 2EILE 4BTAA 2MYOA 4PS8A 1N6AA 3FWVA 1P5QA 3S2AA 2YQ8A 4HFGA 5CMWA 2XZTG 2B6CA 4HXIA 3Q47B 2PQNA 3ASFA 1N3JA 2ZXWE 4HRMB 5CHEE 4RG6A 4ATGA 1B89A 3FUKA 2J9QA 1K1AA 1S63A 4KZCA 4UWLA 4AVXA 5FZQA 4K5BA 4A3TA 5F6LA 2HO1A 5BNWA 1HO8A 3CHOA 4L23A 3DEOA 5ENTD 2I1KA 3FY4A 4U8YD 5AQAA 3D9LA 5CRVA 2WXHA 1MYOA 2QFCA 4GA0A 4JA7A 2WM9A 3MO0A 4GA1A 4JPSA 3ZN3A 3RO3A 4PS3A 4QFVA 2BUGA 4G8KA 2HYZA 2ETCA 4BWRA 2LXLA 1H2TC 2R5SA 2QC9A 1N4QA 5ARFA 3F9WA 1NA3A 5EX3A 3B95A 3CK7A 1HZ4A 4N3BA 1TR4A 3SQVA 3LJNA 3FEXA 1IKND 2YINA 3PE3A 2WQHA 3QWPA 2XGSA 4U07A 1IXVA 1QZ2A 4F6RD 2AXUA 3ABKE 3J5QB 2AXZA 3Q9UC 1W3BA 4J7IA 2X38A 5T8IA 3TWSA 1TNYA 5D66A 1Z6TA 1O1SA 2QY7A 3NF1A 1OWNA 3U64A 1KZPA 2ZISA 4YNPA 3ZKJA 5JHAA 3TG5A 4ANUA 3B13A 2WMNA 4UQYA 1QYMA 2BKGA 3OXLA 4L2LA 3ULQA 3MO2A 4DPRA 5DIZA 1SW6A 1JCRA 3QKYA 2F8YA 3EP0A 1HFAA 5H7PA 1WDYA 3KMJA 4BT9A 2YNQA 4DX6D 2XEEA 3QC1A 2P58C 3LPZA 3UX4A 3BG0B 4XKBA 5JIYA 3TG4A 3M59A 2WXIA 3FUNA 3T8KA 3CVNA 5HS0A 3B7UX 4AIFA 3ASHA 3APDA 2IONA 1SZAA 3RK6A 2QYUA 4G11A 2H6IA 4KZ0A 3S7DA 5JHBA 2YHCA 4GTMA 1UOHA 2YHEA 3ZXPA 3ULYA 3APFA 4Y6CA 4ZFHA 4HNAD 3IXEA 2GW1A 4ATZD 3ULEG 4NIKA 1HF8A 3AS4A 5TH7A 2GRMA 1TNZA 4H12A 3NQPA 3ZW3A 3IBEA 4GTSA 4KMOA 3HIZA 3KMAA 4NQ0A 3FUIA 3UPVA 3ENEA 3S7FA 3HVEB 3CGHA 4NRHB 1ZKKA 3R7RA 1MUFA 4JXTA 4FADA 3DB5A 3UTMA 5LFAA 3NB2A 3B7SA 3FH5A 3E33A 3ZUVB 2H6FA 2XZDG 2RFIA 3HNAA 4HS2A 3CVYA 2WB2A 2LSUA 4L1BA 3D9KA 2IO3C 4A1GA 3VLFA 4LSZE 2VGXB 1SA5A 2ZGDA 3ZXSA 2FBNA 1N11A 5J08A 3TWQA 1WG0A 4J8YA 5LCWJ 1HS6A 1KT1A 2WXFA 3EIJA 2ILRA 2IFUA 4B94A 3G2SA 3M56A 2ETAA 4WNFA 3ZRHA 3U66A 3UI2A 4OAUC 1TN7A 4CDNA 4UWHA 4EECA 2L0IA 4C0EA 1BI8B 1H6KA 4MKTA 3P1UA 4B8AA 1EYHA 2KZTB 2XCBA 3ABME 1G3NB 3G2WA 3M5AA 5F59A 3L6AA 3ASDA 2XHEA 1FVFA 3DSTA 3ZYMA 1BI7B 4U0UA 2KXPC 5EIDA 4YDOA 3SBTB 3T9KA 3VLEA 4G2VA 4GTOA 4NURA 5FZRA 4HOSA 4A63B 1UW4B 3U4TA 4G25A 1MHQA 4FJZA 5KWDA 2DZNA 3CHPA 1HX8A 1ML9A 3EU9A 1AWCB 3HHMA 3X2QE 2F0YA 4B0ZA 4XI9A 3LY7A 2IGQA 5AJLA 5KJNA 2ZU6B 3D9JA 4O1OA 2GRQB 3MZLB 4GB9A 1AP7A 5TTFA 5FTPA 2J09A 3JUIA 2OV8A 1JWFA 2EIKE 3PZ2A 3SF4A 3OTNA 1XNFA 1GW6A 3LEWA 4GTVA 4I6JA 5AIJA 5ENNA 5LX8A 3HXDA 3MKQB 4JD2G 3ZEFA 3OOIA 5T5GA 4X8QA 3S7JA 4N5CA 3D9OA 2P9LG 3IHVA 3WG7E 4PDXA 3FTZA 4BESA 2BTDA 2DBAA 3AJIA 4BSXA 2RFAA 4WNEA 1E8XA 4YPEA 1JWGA 2GRPB 4A55A 2Y0BG 1EDUA 2ONDA 4I1OB 1OWPA 3RJVA 5CCLA 2J4DA 1YCSB 4B89A 3L08A 3V79K 5ENQD 1ZU2A 3TAXA 2B0OE 2IO2C 4CT4A 2OVBA 5KJKA 3HXFA 1X81A 1ZB1A 2C0MA 3QK0A 5E76A 2UY1A 4GMRA 2GROB 2P9NG 2PNNA 3R9AB 4J0UA 2MOWA 5T0KA 2E2EA 3DSUA 2NXPA 3CHSA 2UWJG 4HI9A 4CRWA 3PUKA 1BPOA 4XEIG 3CHMA 4PS7A 1MX4A 4CCAA 4GTTA 4BTBA 3L54A 5J90A 4JHJA 3ZHEB 3M53A 3UUXA 1IQRA 2R2LA 4M3OA 4U8HA 2J07A 3ASOE 5LOZA 4E6HA 3CLJA 2DYRE 1HH8A 3PE4A 4JEUA 4KVMA 1XQHA 4NACA 1D9SA 1DCEA 2PL2A 4N2SA 3PRZA 2VTBA 3VV0A 1ELKA 3UM0A 2V4HC 4AXHA 3QWVA 4G26A 2J49A 3FUDA 4FHJA 4EQFA 4YVQC 4HOQA 4AU7A 4MI0A 2W5ZA 3SNXA 5FJYA 3ML9A 2WXKA 3IV0A 1Z3XA 4UI9K 3FUMA 2C2LA 4JC8A 3V31A 4GPKA 2JLBA 3CVLA 3FTSA 3CV0A 2GRRB 3VLDA 4Y6WA 1OY3D 2WMOA 1O1TA 3ASGA 3M55A 2R02A 3PZDA 1NP7A 1EF1C 3I5PA 2CG2A 4AOFA 3MV2B 5AARA 4GZCA 2A5UA 2CHZA 4YDEA 3EHMA 3FTUA 3HXCA 5A6CA 4GPMA 3Q15A 4O60A 5EX0A 4AEZC 1L5JA 3RU0A 5CERB 4O30A 3Q7FA 4BT8A 4FA6A 3O4ZA 4UQZA 5AYFA 4FMUA 4XIFA 4WNDA 4GZ6A 2ETBA 3PNTB 3S7BA 4DLOA 4FP7A 3KEAA 1MQSA 5FIOA 5ENSD 3NOGD 3PS6A 3ISMC 1TN6A 4U8VD 2CHXA 3RKVA 4AV7A 2MHKA 3NOCD 1OCZE 2L0TB 4GCOA 2FO7A 2QZAA 3TJPA 4JDSA 3NBNB 2IQCA 2WXRA 4NJ5A 4G1TA 1JCQA 3FUJA 3QAQA 3QB2A 4GCNA 1YMPA 3ZYQA 2W5YA 3UIOC 3CVQA 3L13A 4CDRA 1OUVA 1N6CA 3ZNGA 4EZKA 4MLPA 3ZVVA 3AG1E 5ENPD 4I6EA 4GTQA 1H6PA 3DPDA 1MZCA 2R59A 5CECB 2JEKA 4ILHB 1BLXB 1UJJA 1Q2ZA 2WXJA 1PY1A 3FUHA 3MCXA 4JB8P 4DX5D 4F7AA 4GYOA 4LEUA 2G46A 1FT1A 3CKBA 3DALA 4JA9A 2CFUA 3EUVA 3AG2E 4DX2A 2LAIA 4MRUA 3AU5A 1TNUA 2V4LA 4I1AA 3AAAC 1FPPA 3SBSA 3LVRE 4GU5A 1A17A 2XENA 1V55E 2JV0A 2JABA 4K0RA 2P2CP 2HM8A 1TJFA 1MX6A 4HB5A 2GGFA 3QWWA 3MA5A 4J83A 5EILA 3HDXA 4BX9A 3LJ3A 3QNKA 4GA2A 1FVHA 1OXJA 4KXKB 4PH4B 4HLEA 3FUFA 4J8OA 2IOSA 4C9BB 3ONKA 2IF4A 2FF4A 3UIPC 3FU6A 4YDYA 2DWZA 5AN8A 4LNBA 3BUAA 3CEQA 4GTPA 1PAQA 4JLGA 4R7LA 3ZIMA 2VGYA 1IQUA 2C0LA 5A23A 2V5QC 4MI5A 3T8MA 3KSLA 3Q78A 3CVPA 3JXIA 3UT8A 3MO5A 3CVXA 4I2WA 1BD8A 4WUYA 1H2VC 1NFIE 2P9IG 1Z3YA 3GYZA 3CQCB 3PVLA 5BT1A 3RIBA 1ELWA 4RQIA 3LCAA 4XX5A 3UINC 2R05A 3DSWA 5AAOA 4BFRA 4M7CA 4Z68A 3D9NA 4J8SA 3QOUA 4I9EA 1O9SA 1QBQA 1N4SA 5F6KC 3SO8A 4BERA 3Q7AA 2DYSE 2M63A 2Y3AA 4ME2A 4FULA 2R03A 3ZFWA 2VSYA 4HOUA 5G05J 3ML8A 3T5VA 3HVEA 2WXNA 3SI5A 4N2QA 3CVWA 3EHRA 3BEEA 5CCMA 2ZIRA 3MJWA 3UXGA 3Q4AB 4I9CA 2AVPA 5CBOA 3CR3A 3Q73A 3F9YA 2AW6A 5G05C 2FO1E 3CHQA 5B3SE 1OWMA 1SQMA 2A5EA 3G2VA 5KJLA 5AENA 1MVHA 1A5EA 5D0QD 2V0PA 3TWTA 3E30A 1U3DA 2IEJA 3EHQA 1OT8A 3DEPA 4AY5A 2O8JA 5FQ6A 4ACKA 2BF0X 2NSZA 3JCKC 1H19A 2A4ZA 4A3VA 5AQ9A 4Q69A 5JHNA 3FTYA 2CFZA 3WXXA 1YA0A 2KBXA 3GZ1A 4YNMA 4K03A 4YVOA 3FP3A 2WXQA 2LAHA 3K9IA 5EG2A 2HR2A 3DPYA 2KZTA 4JW1A 3ESLA 3J5PA 2P9SG 2MRIA 3AG3E 4TUUA 3TWVA 3L16A 5BUZA 4K5CA 2RG8A 5T0MA 4BSZB 3L22A 3KEZA 1ELRA 1K8KG 5FINA 2XRYA 3CBPA 3EJNA 3D9HA 3DSSA 5KNHD 4I6GA 1E90A 4HRNA 5B1AE 2XS8A 3CIAA 5ITZF 1H6OA 4LNGA 5IY5E 1UN9A 1INZA 4HORA 4PUCA 4U63A 2KCLA 1N9AA 1WM5A 2KC7A 3Q9NC 3D9PA 2PM6A 3DXMG 5CEAA 5FQ7A 2AWIA 3MKQA 3EDTB 4AY6A 4FC8A 1IHBA 4LG6A 4D10C 3FUEA 3SGHA 5HI7A 2P9KG 4OVVA 5LSXA 3ABLE 5C1DA 3FTVA 2L9BA 2H6HA 3E32A 2XGOA 4JHKA 3L17A 4DLQA 4U7EB 2XQ0A 4L7TA 5EKQD 3CHRA 4HI8A 3RAUA 4ILIA 4C48B 2KATA 4CGWA 3ZU7B 1N0RA 5KJMA 3C3OA 4ABNA 4BUPA 1WY6A 2WQ6A 3UKUG 1NL4A 4H7XA 4F53A 4MS6A 1KPSB 4KVOA 3BG1B 4QEOA 3RQ4A 3PEVB 1Z5SC 2J4BA 3EU5A 1U3CA 5CBNA 3F9ZA 3HXEA 5G55A 2X6IA 5FZSA 3DSXA 3FH8A 2XGMA 1RZ4A 3ZHEA 3BQOA 4ZHBA 4JEHA 2GRNB 4F1SA 1H3IA 3PREA 1H0AA 5FT9A 3Q79A 1VDYA 4IULA 3DWLG 5BXUA 3NZSA 2BQZA 1S64A 3Q5MA 3MX3A 3TWXA 5T3RA 1PC2A 2ZGGA 4G24A 4Q96A 5LSZA 4U04A 4TXQA 4UWGA 3NAWA 4N3CA 2Q7FA 4YNDA 4HBDA 4CZ2D 3SFXA 1TJCA 1E7UA 2EIME 3RJWA 2XRZA 2LNIA 2OOEA 3E34A 4ANVA 2FULA 5ENOD 1E8ZA 3D9MA 5HQ8A 3C5RA 4EHMA 2LSVA 3I3NA 3JQ1A 4J8FA 5JJ6A 4UUCA 3MYVA 3UMVA 3FFLA 3VUZA 1SZ9A 5AQ7A 4BEPA 5M72A 4GMJA 3S8PA 3LYAA 5D2MC 3HXBA 4GAAA 3C98A 1D8EA 4ILGA 4YDWA 2WQ7A 4K5AB 1XGWA 4I1MA 3C3RA 3SFYA 4Q94A 3TXMA 3I4GA 5C2YA 3IHYA 3ZYKA 3LS8A 3Q75A 3CVVA 1FT2A 5CPRB 3KD7A 4BY6A 3TL5A 3RRMB 3UM2A 4YPAA 3CQGB 4IJ8A 2VSNA 3EIQC 4B93B 3V2XA 4GZ5A 3ESKA 3HG0D 4FLBA 2LO6A 5JJTA 4O1PA 4URKA 1Y6IA 2DIWA 3TWWA 1QQEA 4OYSA 2L6JA 4RSYA 4GYWA 5B1BE 1BU9A 5JA4D 3UM1A 4TRQA 3ONLA 4JL0A 1SA4A 2OEWA 1O5MA 3VTXA 3B7TA 3AG4E 1HG5A 1UJKA 2KM4A 3BO5A 3ASNE 3E4BA 1N95A 5T4YA 3JUEA 3KMTA 2XEHA 3OPEA 3UM3A 1S0PA 2IY0C 3R9MA 4JVSA 4OVUA 4E85A 2WXGA 2WXMA 3OXFA 4UI9J 1EPUA 2F69A 1N4PA 3RO2A 2VSXE 1RW2A 5G04J 2X3MA 2NC9A 5KBAA 5JJ7A 1IYGA 3DRAA 4B8CB 4CYMD 3ZGQA 2KCKA 4GZ3A 4J8DA 5FWQA 3PH0C 5ARGA 1MT6A 4QENA 4UI9C 4LUNU 4N39A 3QARA 1OWLA 3JXJA 4CDMA 3CSTA 1N94A 5G04C 4BX8A 3M54A 4QEPA 2KCVA 4L2YA 1N52A 3UQ3A 3FEYA 3KS2A 2L6BA 2XEVA 5FQ8A 5G2NA 5ENRD 1N54A 4U96D 4APFA 4ANWA 3U3WA 4J7WA 2WXLA 1DCQA 4GZDA 2BKKB 4OAVB 4G23A 3AS5A 3C3QA 3BU8A 4HLLA 3FU0A 3LY9A 4KT6B 3B7BA 2E0IA 4KYOB 1ZBPA 3V30A 4L9PA 4I2ZA 1E8WA 1DVPA 3PZ3A 2DZOA 1JPLA 2IU1A 3MGBA 2P9UG 4LERA 3F9XA 4N5QA 4WNGA 1OCOE 5AYWD 4DJAA 3SY2A 5CRUA 3DBSA 1HG2A 1MX2A 2WXPA 1D8DA 1OCCE 2EINE 3RAYA 4IJDA 4IN3B 2GRLA 1NZNA 3D9IA 4LNUD 2PQRA 3OAWA 5D0OD 2F37A 2R17C 2X6JA 1X5BA 3LXUX 2FEZA 1PEGA 2XPZA 3D3MA 3FTWA 3E37A 4DI4A 3SHFA 3CKCA 1H2UA 2J08A 2P9PG 2I1JA 4Z4PA 1TYQG 5BPPA 3PZ1A 2V8SE 3Q49B 4TXPA 1NI1A 3PZ4A 4W9RA 4YPUA 2VJ8A 3TGOA 2WXOA 4C0MA 3AS8A 3FH7A 5DBKA 4U95D 1LF8A 2XPIA 4A1SA 3M57A 2XS1A 4EZLA 4APOA 3F6QA 4XI0A 1E7VA 3PNLB 4TV3A 4ACLA 3FU3A 3W9FA 4TXRA 2V5FA 4F3VA 3EHNA 3O48A 3FTXA 3MKRA 4LDGA 1JCSA 3FDHA 2RD0A 4NVQA 4QQIA 1SVXA 2NYJA 3LVQE 5ANRA 2BEDA 4IRUA 4AJWA 2LXMA 3GW4A 1HU3A 3ZPJA 5ANLA 4HOTA 3IHXA 2VGXA 1TNBA 2X6KA 4U0ZA 3ZYLA 4J7FA 3SZ7A 4HRLA 1FCHA 2X6FA 3PUJA 1LD8A 2H6GA 4EZJA 2WPVA 4RLYA
chains in the Genus database with same CATH topology
5AYFA 4FMUA 4XIFA 3TG5A 5JHAA 4WNDA 4ABNA 4ANUA 3RRUA 3B13A 5BW8C 2WMNA 2PM7A 4BUPA 4GZ6A 1WY6A 2WQ6A 4UQYA 2VYIA 3PNTB 4H7XA 3S7BA 4F53A 3OXLA 4XZ4A 4MS6A 5E75A 4DLOA 4FP7A 4L2LA 4KVOA 1JUQA 3BG1B 3ULQA 1MQSA 3MO2A 4QEOA 3RQ4A 3PEVB 3PS6A 4DPRA 2J4BA 3B7RL 1U3CA 4FU3A 5DIZA 5A7DB 3QKYA 3F9ZA 5G55A 2X6IA 4UQXA 4EBAG 3EP0A 5FZSA 1HFAA 3VTYA 2CHXA 3FH8A 3KMJA 4BT9A 2YNQA 3FU5A 1KLXA 4IYPA 3RKVA 1KT0A 3SW9A 4AV7A 2MHKA 3NZUA 3QC1A 2XGMA 4XKCA 3ZHEA 2L0TB 2P58C 3LPZA 4GCOA 3UX4A 4V3IA 3BG0B 3M58A 2FO7A 4XKBA 3CVUA 5JIYA 3TG4A 5LCWC 1MVXA 3M59A 4DI3A 4JEHA 2WXIA 3TJPA 4JDSA 2IQCA 3FUNA 3PEUB 2WXRA 3CVNA 4F1SA 1H3IA 3B7UX 3PREA 3KAEA 4AIFA 4NJ5A 1H0AA 4G1TA 5FT9A 4JHRA 3FUJA 1UN8A 1VDYA 2CHWA 3ASHA 3QAQA 4IULA 3QB2A 4GCNA 3APDA 2IONA 3FULA 5JJ0A 1SZAA 3RK6A 3GZSA 3NZSA 3ZYQA 2BQZA 2W5YA 4G11A 3Q5MA 4KZ0A 4JZYA 4KBQA 2OVFA 3CVQA 3MX3A 3S7DA 2YHCA 3L13A 5JHBA 4CDRA 1OUVA 2IOLA 1N6CA 5T3RA 2YHEA 3SWCA 1PC2A 4EZKA 4I51A 4RG9A 3APFA 4G24A 4MLPA 4Y6CA 4J6IA 3ZVVA 4WWOA 4Q96A 5LSZA 4I6EA 3K5KA 2GW1A 4U04A 4UWGA 3DPDA 4N3CA 2R59A 2Q7FA 2JEKA 4YNDA 4ILHB 1HF8A 3AS4A 1TJCA 1UJJA 5TH7A 2WXJA 2GRMA 1PY1A 4H12A 3FUHA 3NQPA 1E7UA 3MCXA 3ZW3A 3IBEA 3CBOA 4KMOA 3HIZA 3KMAA 4NQ0A 4UWFA 3RJWA 4F7AA 3FUIA 4GYOA 3UPVA 2XRZA 2LNIA 4LEUA 2G46A 2OOEA 1Y8MA 4ANVA 2FULA 3ENEA 3S7FA 3HVEB 4FJYA 1E8ZA 3CKBA 3CGHA 3D9MA 5FQ4A 4NRHB 4EBAA 5HQ8A 1ZKKA 3R7RA 5BV1A 3DALA 2LSVA 4JA9A 1MUFA 4WAFA 2CFUA 3I3NA 4JXTA 3FPDA 4FADA 2QPWA 3JQ1A 4J8FA 2LAIA 5JJ6A 3DB5A 4MRUA 3MYVA 4C1QA 3AU5A 5CMYA 3FFLA 3UMVA 5LFAA 3VUZA 2V4LA 4I1AA 1SZ9A 4H7YA 3B7SA 3FH5A 3LVRE 3SBSA 4GU5A 1A17A 5M72A 3QDNA 3LKUA 3SFZA 4GMJA 3S8PA 4AP2A 3LYAA 2RFIA 4I17A 4GAAA 4ANXA 3HNAA 2XPYA 3C98A 4ILGA 4HS2A 2JV0A 3U9WA 3CVYA 4E47A 3SD5A 3FHEA 3CK9A 2WQ7A 4K0RA 2WB2A 1XGWA 2LSUA 4I1MA 4L1BA 2HM8A 3D9KA 4Q94A 1TJFA 2WVIA 4A1GA 3VLFA 3TXMA 3I4GA 1NA0A 2GGFA 2VGXB 3IKOB 3QWWA 3ZXSA 3JQ0A 1OWOA 5C2YA 3MA5A 2FBNA 4J83A 3IHYA 3ZYKA 3LS8A 3PDNA 5J08A 3CVVA 2I6HA 5LCWJ 3HDXA 4BX9A 5CPRB 1HS6A 3KD7A 3LJ3A 3QNKA 4BY6A 4GA2A 1KT1A 1FVHA 4KXKB 4EPZA 4PH4B 3TL5A 2WXFA 4HLEA 3FUFA 4J8OA 3RRMB 2IOSA 3EIJA 4FHKA 2ILRA 4C9BB 3ONKA 2IFUA 2PZIA 2IF4A 3GZ2A 5EDSA 2FF4A 3CQGB 4YPAA 3OXGA 4IJ8A 2VSNA 2UY1B 3EIQC 3G2SA 3FU6A 4B94A 3M56A 4CGVA 4GZ5A 4WNFA 5TEGA 3AU4A 3ZRHA 3G2TA 4GYYA 3U66A 3ESKA 4FLBA 2LO6A 5JJTA 3CEQA 4CDNA 4UWHA 4EECA 4URKA 1Y6IA 2DIWA 2I2OA 1PAQA 3RRNB 3APCA 1QQEA 4OYSA 2L6JA 2L0IA 2I9CA 4RZ0A 4RSYA 2DCPA 4GYWA 4LRZA 4C0EA 1H6KA 4JLGA 4R7LA 3ZIMA 4J8EA 4CEMA 4MKTA 4GMLA 2FI7A 2VGYA 3P1UA 1IQUA 4B8AA 4TRQA 2C0LA 1EYHA 3ONLA 2KZTB 5A23A 4XE0A 5F5EA 4JL0A 2AXVA 1E8YA 2XCBA 4FA6A 4MI5A 3VTXA 3B7TA 3G2WA 3T8MA 1TEZA 3M5AA 5F59A 3L6AA 3HYMB 2XCCA 3ASDA 2XHEA 1FVFA 1E96B 1HG5A 3CVPA 4I43A 4U0UA 3ZYMA 3UT8A 1UJKA 3MO5A 2KM4A 3CVXA 4I2WA 4WUYA 3SBTB 3BO5A 3E4BA 2VSOE 4G2VA 4U0SA 3VLEA 4NURA 1IHGA 1H2VC 5FZRA 5T4YA 4HOSA 1UW4B 3U4TA 1Z3YA 3GYZA 3CQCB 3PVLA 5BT1A 3KMTA 4G25A 1ELWA 3RIBA 3LCAA 1MHQA 4XX5A 4FJZA 3OPEA 5JINA 5BV0A 3CSFA 1WAO1 1S0PA 3LDZA 3R7QA 4BFRA 3CHPA 1HX8A 3D9NA 5LP0A 1ML9A 4JVSA 2VTBB 3IEGA 3N71A 4OVUA 4J8SA 3URZA 3G2UA 4E85A 2WXGA 3HHMA 2WXMA 3QOUA 4I9EA 3OXFA 4UI9J 3UT4A 4B0ZA 1EPUA 4XI9A 1O9SA 3LY7A 2F69A 2IGQA 5AJLA 5KJNA 2ZU6B 2VQ2A 3D9JA 3RO2A 2VSXE 1HE8A 3MZLB 4AM9A 4GB9A 5F6KC 2Y4TA 4HVBA 5G04J 5TTFA 2CG3A 2X3MA 2NC9A 2M63A 2Y3AA 3OS5A 4RVBA 2J09A 5FTPA 5JJ7A 4ME2A 1IYGA 3JUIA 4FULA 3CBMA 2OV8A 4O30A 1UG3A 5AJDA 4B8CB 1JWFA 2X6HA 3MV3B 1QNFA 3ZFWA 3ZGQA 2KCKA 4GZ3A 2VSYA 3SF4A 4J8DA 3OTNA 4HOUA 4WWNA 4FLHA 5G05J 5FWQA 2EQXA 3ML8A 3T5VA 3PH0C 1XNFA 5ARGA 1GW6A 1MT6A 4QENA 4UI9C 3HVEA 3LEWA 4LUNU 4N39A 2WXNA 4I6JA 4UWKA 3SI5A 5AIJA 4N2QA 3QARA 4LCTA 3CVWA 1OWLA 5ENNA 2R3AA 5LX8A 2IJGX 3MKQB 3BEEA 5CCMA 4CDMA 3ZEFA 3CSTA 3OOIA 5G04C 3MJWA 3QJZA 5T5GA 4BX8A 3S7JA 4N5CA 3M54A 4QEPA 3Q4AB 2KCVA 1DNPA 3D9OA 3LY8A 4I9CA 4L2YA 4CT0A 1N52A 2AVPA 4WWPA 4N3AA 3UQ3A 3FEYA 4P29A 5KCMA 3IHVA 3CR3A 3T5XA 3MEKA 4PDXA 3FTZA 3I4RB 2BTDA 2Y4UA 2DBAA 3KS2A 3F9YA 4BSXA 3CK8A 2AW6A 2XEVA 5FQ8A 1HXIA 3JYSA 5G05C 5G2NA 3TXNA 3CHQA 4WNEA 4DK5A 3P2BA 3UT7A 1E8XA 1OWMA 1SQMA 1N54A 4YPEA 1JWGA 4APFA 4ANWA 3U3WA 3G2VA 4O6FA 4A55A 2WXLA 4BTAA 1EDUA 2ONDA 5KJLA 4GZDA 4I1OB 1OWPA 4PS8A 3FWVA 5AENA 1N6AA 3RJVA 4G23A 1MVHA 3AS5A 2J4DA 5CCLA 1P5QA 5D0QD 3S2AA 2V0PA 2YQ8A 3L08A 4B89A 1U3DA 4HFGA 3FU0A 3LY9A 4KT6B 1ZU2A 5CMWA 3TAXA 4CT4A 2OVBA 4AY5A 2O8JA 4HXIA 5KJKA 2E0IA 3Q47B 5FQ6A 4ACKA 2PQNA 4KYOB 1ZBPA 2BF0X 3ASFA 2C0MA 1N3JA 3QK0A 2NSZA 5E76A 2UY1A 4I2ZA 3JCKC 1E8WA 1H19A 2A4ZA 4A3VA 3R9AB 4J0UA 1DVPA 2MOWA 4Q69A 5T0KA 5JHNA 1JPLA 2E2EA 2IU1A 3FTYA 2CFZA 3MGBA 3WXXA 1YA0A 4LERA 3F9XA 3GZ1A 4YNMA 4K03A 2NXPA 3CHSA 4YVOA 2UWJG 4WNGA 5CHEE 3FP3A 2WXQA 4RG6A 4ATGA 4CRWA 1B89A 3PUKA 3FUKA 5AYWD 1BPOA 2LAHA 3CHMA 3K9IA 4PS7A 2J9QA 5EG2A 4CCAA 4DJAA 2HR2A 3L54A 4BTBA 5J90A 4JHJA 2KZTA 3ZHEB 3M53A 4KZCA 4UWLA 4AVXA 3DBSA 5FZQA 4JW1A 3UUXA 1HG2A 2WXPA 1IQRA 3RAYA 4M3OA 4IJDA 4U8HA 2J07A 4IN3B 5LOZA 4A3TA 4E6HA 2GRLA 3CLJA 1NZNA 3D9IA 1HH8A 3ESLA 5F6LA 3PE4A 4JEUA 4KVMA 2PQRA 3OAWA 2HO1A 2MRIA 4TUUA 5D0OD 1XQHA 5BNWA 2R17C 4NACA 3L16A 5BUZA 2X6JA 2RG8A 1HO8A 1X5BA 3CHOA 3LXUX 5T0MA 2PL2A 4L23A 2FEZA 4N2SA 3L22A 3KEZA 2I1KA 3FY4A 1PEGA 1ELRA 3PRZA 2XPZA 2XRYA 3D3MA 2VTBA 3FTWA 3CBPA 3EJNA 4DI4A 1ELKA 3VV0A 3SHFA 3CKCA 3D9LA 1H2UA 2WXHA 2QFCA 4GA0A 4I6GA 4AXHA 4JA7A 2WM9A 3QWVA 3MO0A 1E90A 2J08A 4GA1A 2I1JA 4JPSA 4Z4PA 4G26A 3ZN3A 2J49A 5BPPA 3RO3A 2V8SE 3CIAA 3Q49B 4PS3A 3FUDA 4FHJA 4EQFA 4YVQC 4QFVA 1UN9A 1INZA 4W9RA 4HORA 4PUCA 4U63A 4YPUA 4HOQA 2VJ8A 2BUGA 4AU7A 3TGOA 2WXOA 4C0MA 2HYZA 3AS8A 2KCLA 2W5ZA 3SNXA 4MI0A 3FH7A 5FJYA 5DBKA 4BWRA 3ML9A 1LF8A 2XPIA 4A1SA 2WXKA 1H2TC 2R5SA 3M57A 4EZLA 4APOA 1WM5A 5ARFA 2KC7A 4XI0A 3IV0A 1E7VA 3PNLB 1Z3XA 3D9PA 3F9WA 4UI9K 4TV3A 1NA3A 4YNPA 5EX3A 4ACLA 3FU3A 3FUMA 2C2LA 3CK7A 2PM6A 1HZ4A 4JC8A 2V5FA 4GPKA 5FQ7A 4N3BA 2JLBA 3CVLA 3FTSA 4F3VA 3CV0A 3EHNA 3VLDA 4Y6WA 3O48A 2AWIA 3MKQA 2WMOA 3FTXA 3MKRA 4LDGA 3FDHA 2RD0A 3EDTB 4NVQA 3FEXA 4FC8A 3ASGA 4AY6A 3M55A 4D10C 2YINA 3PE3A 2WQHA 3FUEA 3QWPA 3LVQE 4OVVA 2XGSA 5ANRA 5HI7A 3SGHA 3PZDA 1NP7A 4U07A 5LSXA 4IRUA 1EF1C 4AJWA 1QZ2A 3I5PA 5C1DA 3FTVA 3GW4A 2L9BA 2CG2A 2AXUA 2XGOA 4JHKA 4AOFA 3L17A 4DLQA 2AXZA 1HU3A 2XQ0A 3MV2B 4L7TA 5EKQD 4GZCA 3ZPJA 1W3BA 4J7IA 5ANLA 2X38A 4HOTA 3IHXA 5T8IA 2VGXA 3CHRA 2A5UA 2CHZA 2X6KA 3EHMA 3FTUA 4U0ZA 3ZYLA 4J7FA 3SZ7A 5A6CA 1Z6TA 1FCHA 3Q15A 4ILIA 5EX0A 2X6FA 3PUJA 4AEZC 2QY7A 3NF1A 1OWNA 2KATA 3U64A 4EZJA 1L5JA 4CGWA 3RU0A 5KJMA 2WPVA 4BT8A 3O4ZA 4UQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AYF A;  4FMU A;  4XIF A;  3TG5 A;  4WND A;  4ABN A;  5BW8 C;  4BUP A;  4GZ6 A;  4UQY A;  2VYI A;  4H7X A;  3S7B A;  3OXL A;  3ULQ A;  3MO2 A;  4QEO A;  3RQ4 A;  5DIZ A;  5A7D B;  3QKY A;  3F9Z A;  4UQX A;  3EP0 A;  5FZS A;  3VTY A;  3KMJ A;  4BT9 A;  1KLX A;  3RKV A;  1KT0 A;  3SW9 A;  2MHK A;  2XGM A;  3ZHE A;  2P58 C;  4GCO A;  3LPZ A;  3M58 A;  2FO7 A;  5JIY A;  3TG4 A;  5LCW C;  1MVX A;  3M59 A;  4JDS A;  3CVN A;  1H3I A;  4NJ5 A;  4AIF A;  3KAE A;  4G1T A;  5FT9 A;  4JHR A;  3ASH A;  4GCN A;  5JJ0 A;  2BQZ A;  2W5Y A;  3Q5M A;  4KBQ A;  3CVQ A;  3S7D A;  2YHC A;  4CDR A;  1OUV A;  1N6C A;  3SWC A;  1PC2 A;  4I51 A;  4RG9 A;  4G24 A;  4Y6C A;  5LSZ A;  3K5K A;  2GW1 A;  4U04 A;  4N3C A;  2Q7F A;  4YND A;  3AS4 A;  1TJC A;  5TH7 A;  4H12 A;  3CBO A;  3KMA A;  4NQ0 A;  3RJW A;  4GYO A;  3UPV A;  2LNI A;  4LEU A;  2G46 A;  2OOE A;  1Y8M A;  3S7F A;  3CKB A;  4NRH B;  5HQ8 A;  1ZKK A;  3DAL A;  2LSV A;  4JA9 A;  1MUF A;  3FPD A;  2QPW A;  4J8F A;  5JJ6 A;  3DB5 A;  4C1Q A;  3FFL A;  3VUZ A;  4I1A A;  4H7Y A;  1A17 A;  5M72 A;  3QDN A;  3LKU A;  3S8P A;  3LYA A;  2RFI A;  4I17 A;  3HNA A;  2JV0 A;  4E47 A;  3CK9 A;  2LSU A;  1NA0 A;  3QWW A;  2VGX B;  3MA5 A;  2FBN A;  4J83 A;  3PDN A;  2I6H A;  5LCW J;  5CPR B;  3KD7 A;  4GA2 A;  1KT1 A;  4KXK B;  4J8O A;  2IFU A;  2PZI A;  2IF4 A;  3GZ2 A;  4YPA A;  2FF4 A;  3OXG A;  4IJ8 A;  4B94 A;  2VSN A;  2UY1 B;  3M56 A;  4CGV A;  4GZ5 A;  4WNF A;  5TEG A;  4GYY A;  3ESK A;  5JJT A;  3CEQ A;  1QQE A;  2L6J A;  4RZ0 A;  4GYW A;  4JLG A;  4J8E A;  2FI7 A;  2VGY A;  2C0L A;  5F5E A;  4JL0 A;  2XCB A;  4MI5 A;  3VTX A;  3M5A A;  5F59 A;  3HYM B;  2XCC A;  3ASD A;  3CVP A;  1E96 B;  4U0U A;  3MO5 A;  4I2W A;  4WUY A;  3BO5 A;  3E4B A;  4G2V A;  4U0S A;  1IHG A;  5FZR A;  4HOS A;  3U4T A;  3GYZ A;  3KMT A;  5BT1 A;  4G25 A;  1ELW A;  3RIB A;  3LCA A;  3OPE A;  5JIN A;  1WAO 1;  1ML9 A;  3IEG A;  3N71 A;  3URZ A;  3QOU A;  4I9E A;  3OXF A;  4UI9 J;  4XI9 A;  1O9S A;  2F69 A;  3LY7 A;  2IGQ A;  5KJN A;  2VQ2 A;  3RO2 A;  4AM9 A;  5F6K C;  2Y4T A;  5G04 J;  5TTF A;  2NC9 A;  3OS5 A;  5FTP A;  5JJ7 A;  4ME2 A;  1IYG A;  3CBM A;  4O30 A;  3MV3 B;  3ZFW A;  3ZGQ A;  2KCK A;  4GZ3 A;  2VSY A;  3SF4 A;  4J8D A;  4HOU A;  5G05 J;  1XNF A;  5ARG A;  1MT6 A;  4QEN A;  4UI9 C;  4N39 A;  4N2Q A;  2R3A A;  3BEE A;  5CCM A;  3OOI A;  5G04 C;  5T5G A;  3S7J A;  4N5C A;  3M54 A;  4QEP A;  3Q4A B;  2KCV A;  3LY8 A;  4I9C A;  2AVP A;  3UQ3 A;  4N3A A;  3MEK A;  2Y4U A;  2DBA A;  3KS2 A;  3F9Y A;  3CK8 A;  2XEV A;  1HXI A;  3JYS A;  5G05 C;  4WNE A;  4YPE A;  3U3W A;  4O6F A;  4BTA A;  2OND A;  5KJL A;  1N6A A;  3FWV A;  3RJV A;  4G23 A;  1MVH A;  3AS5 A;  5CCL A;  1P5Q A;  5D0Q D;  2YQ8 A;  3LY9 A;  1ZU2 A;  3TAX A;  4AY5 A;  2O8J A;  5KJK A;  3Q47 B;  2PQN A;  4KYO B;  1ZBP A;  3ASF A;  2C0M A;  1N3J A;  2UY1 A;  4I2Z A;  3R9A B;  4J0U A;  5T0K A;  5JHN A;  2E2E A;  3WXX A;  1YA0 A;  3F9X A;  3GZ1 A;  4YNM A;  4YVO A;  4WNG A;  2UWJ G;  5CHE E;  3FP3 A;  4RG6 A;  1B89 A;  5AYW D;  3K9I A;  5EG2 A;  2J9Q A;  4BTB A;  2HR2 A;  3ZHE B;  3M53 A;  5FZQ A;  3UUX A;  3RAY A;  4IJD A;  4IN3 B;  1NZN A;  1HH8 A;  5F6L A;  3PE4 A;  2PQR A;  2HO1 A;  5D0O D;  1XQH A;  5BNW A;  5T0M A;  2PL2 A;  2FEZ A;  4N2S A;  1PEG A;  1ELR A;  3CBP A;  3VV0 A;  3CKC A;  2QFC A;  4GA0 A;  4JA7 A;  3QWV A;  3MO0 A;  4GA1 A;  4Z4P A;  4G26 A;  3ZN3 A;  3RO3 A;  3Q49 B;  4EQF A;  4YVQ C;  4W9R A;  4HOR A;  4YPU A;  4HOQ A;  2BUG A;  4AU7 A;  3TGO A;  2HYZ A;  3AS8 A;  2KCL A;  2W5Z A;  4MI0 A;  5FJY A;  5DBK A;  4BWR A;  2XPI A;  4A1S A;  2R5S A;  3M57 A;  4APO A;  1WM5 A;  5ARF A;  2KC7 A;  4XI0 A;  3F9W A;  4UI9 K;  1NA3 A;  4YNP A;  5EX3 A;  2C2L A;  3CK7 A;  1HZ4 A;  2V5F A;  4GPK A;  4N3B A;  2JLB A;  3CVL A;  4F3V A;  3CV0 A;  4Y6W A;  3O48 A;  3MKR A;  4LDG A;  3EDT B;  4NVQ A;  4AY6 A;  3ASG A;  3M55 A;  3PE3 A;  2WQH A;  3QWP A;  5HI7 A;  2XGS A;  4U07 A;  5LSX A;  1QZ2 A;  5C1D A;  3GW4 A;  2XGO A;  3MV2 B;  3ZPJ A;  5EKQ D;  1W3B A;  4J7I A;  4HOT A;  3IHX A;  2VGX A;  4U0Z A;  4J7F A;  3SZ7 A;  5A6C A;  1FCH A;  3Q15 A;  5EX0 A;  3NF1 A;  2KAT A;  4CGW A;  3RU0 A;  5KJM A;  2WPV A;  4BT8 A;  4UQZ A; 
#chains in the Genus database with same CATH topology
 3RRU A;  5BW8 C;  2PM7 A;  2VYI A;  4XZ4 A;  1K1B A;  5E75 A;  4G8L A;  1JUQ A;  1YYH A;  2J8S D;  1K3Z D;  5CED B;  3B7R L;  4FU3 A;  5A7D B;  3RSE G;  4GTR A;  4UQX A;  4EBA G;  3VTY A;  2Y1L E;  2RFM A;  3FU5 A;  1KLX A;  4IYP A;  1DC2 A;  1KT0 A;  2QYJ A;  2VGE A;  3SW9 A;  3NZU A;  4XKC A;  4V3I A;  5EIB E;  3M58 A;  3CVU A;  5LCW C;  1MVX A;  4DI3 A;  3PEU B;  1N4R A;  3KAE A;  4JHR A;  1UN8 A;  2CHW A;  5JJ0 A;  1MJ0 A;  3FUL A;  3GZS A;  4DX7 D;  4JZY A;  4KBQ A;  3TWU A;  2OVF A;  1OCR E;  2IOL A;  3KSQ A;  3SWC A;  4I51 A;  4RG9 A;  1LD7 A;  5EYL A;  4J6I A;  4WWO A;  4DUI A;  3K5K A;  5HKP A;  3W9G A;  1TN8 A;  3L9T A;  3CBO A;  1LTX A;  4UWF A;  1TNO A;  1Y8M A;  3V2O A;  3L82 A;  4FJY A;  3DXK G;  4EBA A;  1O1R A;  5FQ4 A;  2HE0 A;  5BV1 A;  4WAF A;  3FPD A;  2QPW A;  4C1Q A;  5CMY A;  2EIJ E;  4H7Y A;  5EYP F;  1S70 B;  3QDN A;  3LKU A;  3SFZ A;  4AP2 A;  4I17 A;  4ANX A;  2XPY A;  3U9W A;  5AQB A;  4E47 A;  3SD5 A;  3FHE A;  2OEV A;  3CK9 A;  2WVI A;  4F1P A;  4MBG A;  1NA0 A;  3IKO B;  3JQ0 A;  1OWO A;  3PDN A;  2I6H A;  3C72 A;  4EPZ A;  4FHK A;  3TWR A;  2PZI A;  5EDS A;  1KZO A;  3GZ2 A;  3OXG A;  4BET A;  2UY1 B;  4CGV A;  2RKK A;  5TEG A;  3AU4 A;  3G2T A;  4GYY A;  2I2O A;  3RRN B;  3APC A;  4DRX E;  2DVW A;  4RZ0 A;  2I9C A;  2DCP A;  4LRZ A;  2F8X K;  4J8E A;  4CEM A;  4GML A;  4DX1 A;  2FI7 A;  5F5E A;  4XE0 A;  2AXV A;  1E8Y A;  1TEZ A;  3HYM B;  2XCC A;  4I43 A;  1E96 B;  5JMN D;  4U0S A;  2VSO E;  1IHG A;  4TUM A;  3HRA A;  5JIN A;  5BV0 A;  3CSF A;  1WAO 1;  3LDZ A;  3R7Q A;  5LP0 A;  2OCC E;  2VTB B;  3IEG A;  3N71 A;  3URZ A;  5EN5 D;  3G2U A;  1V54 E;  1U2V G;  3UT4 A;  5HRY A;  2VQ2 A;  1HE8 A;  4AM9 A;  2Y4T A;  4HVB A;  2CG3 A;  3OS5 A;  4RVB A;  3CBM A;  1UG3 A;  5AJD A;  2X6H A;  3MV3 B;  1QNF A;  3DSV A;  4WWN A;  4FLH A;  2EQX A;  4HQD A;  2Y69 E;  4UWK A;  4LCT A;  2R3A A;  2IJG X;  2AJA A;  3UKR G;  3QJZ A;  5KNG A;  1N0Q A;  1DNP A;  3LY8 A;  4CT0 A;  4WWP A;  4N3A A;  4P29 A;  2LUH A;  5KCM A;  3T5X A;  3MEK A;  3I4R B;  2Y4U A;  3CK8 A;  1HXI A;  3JYS A;  3TXN A;  4DK5 A;  3P2B A;  3UT7 A;  5BXO A;  4O6F A;  2EIL E;  4BTA A;  2MYO A;  4PS8 A;  1N6A A;  3FWV A;  1P5Q A;  3S2A A;  2YQ8 A;  4HFG A;  5CMW A;  2XZT G;  2B6C A;  4HXI A;  3Q47 B;  2PQN A;  3ASF A;  1N3J A;  2ZXW E;  4HRM B;  5CHE E;  4RG6 A;  4ATG A;  1B89 A;  3FUK A;  2J9Q A;  1K1A A;  1S63 A;  4KZC A;  4UWL A;  4AVX A;  5FZQ A;  4K5B A;  4A3T A;  5F6L A;  2HO1 A;  5BNW A;  1HO8 A;  3CHO A;  4L23 A;  3DEO A;  5ENT D;  2I1K A;  3FY4 A;  4U8Y D;  5AQA A;  3D9L A;  5CRV A;  2WXH A;  1MYO A;  2QFC A;  4GA0 A;  4JA7 A;  2WM9 A;  3MO0 A;  4GA1 A;  4JPS A;  3ZN3 A;  3RO3 A;  4PS3 A;  4QFV A;  2BUG A;  4G8K A;  2HYZ A;  2ETC A;  4BWR A;  2LXL A;  1H2T C;  2R5S A;  2QC9 A;  1N4Q A;  5ARF A;  3F9W A;  1NA3 A;  5EX3 A;  3B95 A;  3CK7 A;  1HZ4 A;  4N3B A;  1TR4 A;  3SQV A;  3LJN A;  3FEX A;  1IKN D;  2YIN A;  3PE3 A;  2WQH A;  3QWP A;  2XGS A;  4U07 A;  1IXV A;  1QZ2 A;  4F6R D;  2AXU A;  3ABK E;  3J5Q B;  2AXZ A;  3Q9U C;  1W3B A;  4J7I A;  2X38 A;  5T8I A;  3TWS A;  1TNY A;  5D66 A;  1Z6T A;  1O1S A;  2QY7 A;  3NF1 A;  1OWN A;  3U64 A;  1KZP A;  2ZIS A;  4YNP A;  3ZKJ A;  5JHA A;  3TG5 A;  4ANU A;  3B13 A;  2WMN A;  4UQY A;  1QYM A;  2BKG A;  3OXL A;  4L2L A;  3ULQ A;  3MO2 A;  4DPR A;  5DIZ A;  1SW6 A;  1JCR A;  3QKY A;  2F8Y A;  3EP0 A;  1HFA A;  5H7P A;  1WDY A;  3KMJ A;  4BT9 A;  2YNQ A;  4DX6 D;  2XEE A;  3QC1 A;  2P58 C;  3LPZ A;  3UX4 A;  3BG0 B;  4XKB A;  5JIY A;  3TG4 A;  3M59 A;  2WXI A;  3FUN A;  3T8K A;  3CVN A;  5HS0 A;  3B7U X;  4AIF A;  3ASH A;  3APD A;  2ION A;  1SZA A;  3RK6 A;  2QYU A;  4G11 A;  2H6I A;  4KZ0 A;  3S7D A;  5JHB A;  2YHC A;  4GTM A;  1UOH A;  2YHE A;  3ZXP A;  3ULY A;  3APF A;  4Y6C A;  4ZFH A;  4HNA D;  3IXE A;  2GW1 A;  4ATZ D;  3ULE G;  4NIK A;  1HF8 A;  3AS4 A;  5TH7 A;  2GRM A;  1TNZ A;  4H12 A;  3NQP A;  3ZW3 A;  3IBE A;  4GTS A;  4KMO A;  3HIZ A;  3KMA A;  4NQ0 A;  3FUI A;  3UPV A;  3ENE A;  3S7F A;  3HVE B;  3CGH A;  4NRH B;  1ZKK A;  3R7R A;  1MUF A;  4JXT A;  4FAD A;  3DB5 A;  3UTM A;  5LFA A;  3NB2 A;  3B7S A;  3FH5 A;  3E33 A;  3ZUV B;  2H6F A;  2XZD G;  2RFI A;  3HNA A;  4HS2 A;  3CVY A;  2WB2 A;  2LSU A;  4L1B A;  3D9K A;  2IO3 C;  4A1G A;  3VLF A;  4LSZ E;  2VGX B;  1SA5 A;  2ZGD A;  3ZXS A;  2FBN A;  1N11 A;  5J08 A;  3TWQ A;  1WG0 A;  4J8Y A;  5LCW J;  1HS6 A;  1KT1 A;  2WXF A;  3EIJ A;  2ILR A;  2IFU A;  4B94 A;  3G2S A;  3M56 A;  2ETA A;  4WNF A;  3ZRH A;  3U66 A;  3UI2 A;  4OAU C;  1TN7 A;  4CDN A;  4UWH A;  4EEC A;  2L0I A;  4C0E A;  1BI8 B;  1H6K A;  4MKT A;  3P1U A;  4B8A A;  1EYH A;  2KZT B;  2XCB A;  3ABM E;  1G3N B;  3G2W A;  3M5A A;  5F59 A;  3L6A A;  3ASD A;  2XHE A;  1FVF A;  3DST A;  3ZYM A;  1BI7 B;  4U0U A;  2KXP C;  5EID A;  4YDO A;  3SBT B;  3T9K A;  3VLE A;  4G2V A;  4GTO A;  4NUR A;  5FZR A;  4HOS A;  4A63 B;  1UW4 B;  3U4T A;  4G25 A;  1MHQ A;  4FJZ A;  5KWD A;  2DZN A;  3CHP A;  1HX8 A;  1ML9 A;  3EU9 A;  1AWC B;  3HHM A;  3X2Q E;  2F0Y A;  4B0Z A;  4XI9 A;  3LY7 A;  2IGQ A;  5AJL A;  5KJN A;  2ZU6 B;  3D9J A;  4O1O A;  2GRQ B;  3MZL B;  4GB9 A;  1AP7 A;  5TTF A;  5FTP A;  2J09 A;  3JUI A;  2OV8 A;  1JWF A;  2EIK E;  3PZ2 A;  3SF4 A;  3OTN A;  1XNF A;  1GW6 A;  3LEW A;  4GTV A;  4I6J A;  5AIJ A;  5ENN A;  5LX8 A;  3HXD A;  3MKQ B;  4JD2 G;  3ZEF A;  3OOI A;  5T5G A;  4X8Q A;  3S7J A;  4N5C A;  3D9O A;  2P9L G;  3IHV A;  3WG7 E;  4PDX A;  3FTZ A;  4BES A;  2BTD A;  2DBA A;  3AJI A;  4BSX A;  2RFA A;  4WNE A;  1E8X A;  4YPE A;  1JWG A;  2GRP B;  4A55 A;  2Y0B G;  1EDU A;  2OND A;  4I1O B;  1OWP A;  3RJV A;  5CCL A;  2J4D A;  1YCS B;  4B89 A;  3L08 A;  3V79 K;  5ENQ D;  1ZU2 A;  3TAX A;  2B0O E;  2IO2 C;  4CT4 A;  2OVB A;  5KJK A;  3HXF A;  1X81 A;  1ZB1 A;  2C0M A;  3QK0 A;  5E76 A;  2UY1 A;  4GMR A;  2GRO B;  2P9N G;  2PNN A;  3R9A B;  4J0U A;  2MOW A;  5T0K A;  2E2E A;  3DSU A;  2NXP A;  3CHS A;  2UWJ G;  4HI9 A;  4CRW A;  3PUK A;  1BPO A;  4XEI G;  3CHM A;  4PS7 A;  1MX4 A;  4CCA A;  4GTT A;  4BTB A;  3L54 A;  5J90 A;  4JHJ A;  3ZHE B;  3M53 A;  3UUX A;  1IQR A;  2R2L A;  4M3O A;  4U8H A;  2J07 A;  3ASO E;  5LOZ A;  4E6H A;  3CLJ A;  2DYR E;  1HH8 A;  3PE4 A;  4JEU A;  4KVM A;  1XQH A;  4NAC A;  1D9S A;  1DCE A;  2PL2 A;  4N2S A;  3PRZ A;  2VTB A;  3VV0 A;  1ELK A;  3UM0 A;  2V4H C;  4AXH A;  3QWV A;  4G26 A;  2J49 A;  3FUD A;  4FHJ A;  4EQF A;  4YVQ C;  4HOQ A;  4AU7 A;  4MI0 A;  2W5Z A;  3SNX A;  5FJY A;  3ML9 A;  2WXK A;  3IV0 A;  1Z3X A;  4UI9 K;  3FUM A;  2C2L A;  4JC8 A;  3V31 A;  4GPK A;  2JLB A;  3CVL A;  3FTS A;  3CV0 A;  2GRR B;  3VLD A;  4Y6W A;  1OY3 D;  2WMO A;  1O1T A;  3ASG A;  3M55 A;  2R02 A;  3PZD A;  1NP7 A;  1EF1 C;  3I5P A;  2CG2 A;  4AOF A;  3MV2 B;  5AAR A;  4GZC A;  2A5U A;  2CHZ A;  4YDE A;  3EHM A;  3FTU A;  3HXC A;  5A6C A;  4GPM A;  3Q15 A;  4O60 A;  5EX0 A;  4AEZ C;  1L5J A;  3RU0 A;  5CER B;  4O30 A;  3Q7F A;  4BT8 A;  4FA6 A;  3O4Z A;  4UQZ A;  5AYF A;  4FMU A;  4XIF A;  4WND A;  4GZ6 A;  2ETB A;  3PNT B;  3S7B A;  4DLO A;  4FP7 A;  3KEA A;  1MQS A;  5FIO A;  5ENS D;  3NOG D;  3PS6 A;  3ISM C;  1TN6 A;  4U8V D;  2CHX A;  3RKV A;  4AV7 A;  2MHK A;  3NOC D;  1OCZ E;  2L0T B;  4GCO A;  2FO7 A;  2QZA A;  3TJP A;  4JDS A;  3NBN B;  2IQC A;  2WXR A;  4NJ5 A;  4G1T A;  1JCQ A;  3FUJ A;  3QAQ A;  3QB2 A;  4GCN A;  1YMP A;  3ZYQ A;  2W5Y A;  3UIO C;  3CVQ A;  3L13 A;  4CDR A;  1OUV A;  1N6C A;  3ZNG A;  4EZK A;  4MLP A;  3ZVV A;  3AG1 E;  5ENP D;  4I6E A;  4GTQ A;  1H6P A;  3DPD A;  1MZC A;  2R59 A;  5CEC B;  2JEK A;  4ILH B;  1BLX B;  1UJJ A;  1Q2Z A;  2WXJ A;  1PY1 A;  3FUH A;  3MCX A;  4JB8 P;  4DX5 D;  4F7A A;  4GYO A;  4LEU A;  2G46 A;  1FT1 A;  3CKB A;  3DAL A;  4JA9 A;  2CFU A;  3EUV A;  3AG2 E;  4DX2 A;  2LAI A;  4MRU A;  3AU5 A;  1TNU A;  2V4L A;  4I1A A;  3AAA C;  1FPP A;  3SBS A;  3LVR E;  4GU5 A;  1A17 A;  2XEN A;  1V55 E;  2JV0 A;  2JAB A;  4K0R A;  2P2C P;  2HM8 A;  1TJF A;  1MX6 A;  4HB5 A;  2GGF A;  3QWW A;  3MA5 A;  4J83 A;  5EIL A;  3HDX A;  4BX9 A;  3LJ3 A;  3QNK A;  4GA2 A;  1FVH A;  1OXJ A;  4KXK B;  4PH4 B;  4HLE A;  3FUF A;  4J8O A;  2IOS A;  4C9B B;  3ONK A;  2IF4 A;  2FF4 A;  3UIP C;  3FU6 A;  4YDY A;  2DWZ A;  5AN8 A;  4LNB A;  3BUA A;  3CEQ A;  4GTP A;  1PAQ A;  4JLG A;  4R7L A;  3ZIM A;  2VGY A;  1IQU A;  2C0L A;  5A23 A;  2V5Q C;  4MI5 A;  3T8M A;  3KSL A;  3Q78 A;  3CVP A;  3JXI A;  3UT8 A;  3MO5 A;  3CVX A;  4I2W A;  1BD8 A;  4WUY A;  1H2V C;  1NFI E;  2P9I G;  1Z3Y A;  3GYZ A;  3CQC B;  3PVL A;  5BT1 A;  3RIB A;  1ELW A;  4RQI A;  3LCA A;  4XX5 A;  3UIN C;  2R05 A;  3DSW A;  5AAO A;  4BFR A;  4M7C A;  4Z68 A;  3D9N A;  4J8S A;  3QOU A;  4I9E A;  1O9S A;  1QBQ A;  1N4S A;  5F6K C;  3SO8 A;  4BER A;  3Q7A A;  2DYS E;  2M63 A;  2Y3A A;  4ME2 A;  4FUL A;  2R03 A;  3ZFW A;  2VSY A;  4HOU A;  5G05 J;  3ML8 A;  3T5V A;  3HVE A;  2WXN A;  3SI5 A;  4N2Q A;  3CVW A;  3EHR A;  3BEE A;  5CCM A;  2ZIR A;  3MJW A;  3UXG A;  3Q4A B;  4I9C A;  2AVP A;  5CBO A;  3CR3 A;  3Q73 A;  3F9Y A;  2AW6 A;  5G05 C;  2FO1 E;  3CHQ A;  5B3S E;  1OWM A;  1SQM A;  2A5E A;  3G2V A;  5KJL A;  5AEN A;  1MVH A;  1A5E A;  5D0Q D;  2V0P A;  3TWT A;  3E30 A;  1U3D A;  2IEJ A;  3EHQ A;  1OT8 A;  3DEP A;  4AY5 A;  2O8J A;  5FQ6 A;  4ACK A;  2BF0 X;  2NSZ A;  3JCK C;  1H19 A;  2A4Z A;  4A3V A;  5AQ9 A;  4Q69 A;  5JHN A;  3FTY A;  2CFZ A;  3WXX A;  1YA0 A;  2KBX A;  3GZ1 A;  4YNM A;  4K03 A;  4YVO A;  3FP3 A;  2WXQ A;  2LAH A;  3K9I A;  5EG2 A;  2HR2 A;  3DPY A;  2KZT A;  4JW1 A;  3ESL A;  3J5P A;  2P9S G;  2MRI A;  3AG3 E;  4TUU A;  3TWV A;  3L16 A;  5BUZ A;  4K5C A;  2RG8 A;  5T0M A;  4BSZ B;  3L22 A;  3KEZ A;  1ELR A;  1K8K G;  5FIN A;  2XRY A;  3CBP A;  3EJN A;  3D9H A;  3DSS A;  5KNH D;  4I6G A;  1E90 A;  4HRN A;  5B1A E;  2XS8 A;  3CIA A;  5ITZ F;  1H6O A;  4LNG A;  5IY5 E;  1UN9 A;  1INZ A;  4HOR A;  4PUC A;  4U63 A;  2KCL A;  1N9A A;  1WM5 A;  2KC7 A;  3Q9N C;  3D9P A;  2PM6 A;  3DXM G;  5CEA A;  5FQ7 A;  2AWI A;  3MKQ A;  3EDT B;  4AY6 A;  4FC8 A;  1IHB A;  4LG6 A;  4D10 C;  3FUE A;  3SGH A;  5HI7 A;  2P9K G;  4OVV A;  5LSX A;  3ABL E;  5C1D A;  3FTV A;  2L9B A;  2H6H A;  3E32 A;  2XGO A;  4JHK A;  3L17 A;  4DLQ A;  4U7E B;  2XQ0 A;  4L7T A;  5EKQ D;  3CHR A;  4HI8 A;  3RAU A;  4ILI A;  4C48 B;  2KAT A;  4CGW A;  3ZU7 B;  1N0R A;  5KJM A;  3C3O A;  4ABN A;  4BUP A;  1WY6 A;  2WQ6 A;  3UKU G;  1NL4 A;  4H7X A;  4F53 A;  4MS6 A;  1KPS B;  4KVO A;  3BG1 B;  4QEO A;  3RQ4 A;  3PEV B;  1Z5S C;  2J4B A;  3EU5 A;  1U3C A;  5CBN A;  3F9Z A;  3HXE A;  5G55 A;  2X6I A;  5FZS A;  3DSX A;  3FH8 A;  2XGM A;  1RZ4 A;  3ZHE A;  3BQO A;  4ZHB A;  4JEH A;  2GRN B;  4F1S A;  1H3I A;  3PRE A;  1H0A A;  5FT9 A;  3Q79 A;  1VDY A;  4IUL A;  3DWL G;  5BXU A;  3NZS A;  2BQZ A;  1S64 A;  3Q5M A;  3MX3 A;  3TWX A;  5T3R A;  1PC2 A;  2ZGG A;  4G24 A;  4Q96 A;  5LSZ A;  4U04 A;  4TXQ A;  4UWG A;  3NAW A;  4N3C A;  2Q7F A;  4YND A;  4HBD A;  4CZ2 D;  3SFX A;  1TJC A;  1E7U A;  2EIM E;  3RJW A;  2XRZ A;  2LNI A;  2OOE A;  3E34 A;  4ANV A;  2FUL A;  5ENO D;  1E8Z A;  3D9M A;  5HQ8 A;  3C5R A;  4EHM A;  2LSV A;  3I3N A;  3JQ1 A;  4J8F A;  5JJ6 A;  4UUC A;  3MYV A;  3UMV A;  3FFL A;  3VUZ A;  1SZ9 A;  5AQ7 A;  4BEP A;  5M72 A;  4GMJ A;  3S8P A;  3LYA A;  5D2M C;  3HXB A;  4GAA A;  3C98 A;  1D8E A;  4ILG A;  4YDW A;  2WQ7 A;  4K5A B;  1XGW A;  4I1M A;  3C3R A;  3SFY A;  4Q94 A;  3TXM A;  3I4G A;  5C2Y A;  3IHY A;  3ZYK A;  3LS8 A;  3Q75 A;  3CVV A;  1FT2 A;  5CPR B;  3KD7 A;  4BY6 A;  3TL5 A;  3RRM B;  3UM2 A;  4YPA A;  3CQG B;  4IJ8 A;  2VSN A;  3EIQ C;  4B93 B;  3V2X A;  4GZ5 A;  3ESK A;  3HG0 D;  4FLB A;  2LO6 A;  5JJT A;  4O1P A;  4URK A;  1Y6I A;  2DIW A;  3TWW A;  1QQE A;  4OYS A;  2L6J A;  4RSY A;  4GYW A;  5B1B E;  1BU9 A;  5JA4 D;  3UM1 A;  4TRQ A;  3ONL A;  4JL0 A;  1SA4 A;  2OEW A;  1O5M A;  3VTX A;  3B7T A;  3AG4 E;  1HG5 A;  1UJK A;  2KM4 A;  3BO5 A;  3ASN E;  3E4B A;  1N95 A;  5T4Y A;  3JUE A;  3KMT A;  2XEH A;  3OPE A;  3UM3 A;  1S0P A;  2IY0 C;  3R9M A;  4JVS A;  4OVU A;  4E85 A;  2WXG A;  2WXM A;  3OXF A;  4UI9 J;  1EPU A;  2F69 A;  1N4P A;  3RO2 A;  2VSX E;  1RW2 A;  5G04 J;  2X3M A;  2NC9 A;  5KBA A;  5JJ7 A;  1IYG A;  3DRA A;  4B8C B;  4CYM D;  3ZGQ A;  2KCK A;  4GZ3 A;  4J8D A;  5FWQ A;  3PH0 C;  5ARG A;  1MT6 A;  4QEN A;  4UI9 C;  4LUN U;  4N39 A;  3QAR A;  1OWL A;  3JXJ A;  4CDM A;  3CST A;  1N94 A;  5G04 C;  4BX8 A;  3M54 A;  4QEP A;  2KCV A;  4L2Y A;  1N52 A;  3UQ3 A;  3FEY A;  3KS2 A;  2L6B A;  2XEV A;  5FQ8 A;  5G2N A;  5ENR D;  1N54 A;  4U96 D;  4APF A;  4ANW A;  3U3W A;  4J7W A;  2WXL A;  1DCQ A;  4GZD A;  2BKK B;  4OAV B;  4G23 A;  3AS5 A;  3C3Q A;  3BU8 A;  4HLL A;  3FU0 A;  3LY9 A;  4KT6 B;  3B7B A;  2E0I A;  4KYO B;  1ZBP A;  3V30 A;  4L9P A;  4I2Z A;  1E8W A;  1DVP A;  3PZ3 A;  2DZO A;  1JPL A;  2IU1 A;  3MGB A;  2P9U G;  4LER A;  3F9X A;  4N5Q A;  4WNG A;  1OCO E;  5AYW D;  4DJA A;  3SY2 A;  5CRU A;  3DBS A;  1HG2 A;  1MX2 A;  2WXP A;  1D8D A;  1OCC E;  2EIN E;  3RAY A;  4IJD A;  4IN3 B;  2GRL A;  1NZN A;  3D9I A;  4LNU D;  2PQR A;  3OAW A;  5D0O D;  2F37 A;  2R17 C;  2X6J A;  1X5B A;  3LXU X;  2FEZ A;  1PEG A;  2XPZ A;  3D3M A;  3FTW A;  3E37 A;  4DI4 A;  3SHF A;  3CKC A;  1H2U A;  2J08 A;  2P9P G;  2I1J A;  4Z4P A;  1TYQ G;  5BPP A;  3PZ1 A;  2V8S E;  3Q49 B;  4TXP A;  1NI1 A;  3PZ4 A;  4W9R A;  4YPU A;  2VJ8 A;  3TGO A;  2WXO A;  4C0M A;  3AS8 A;  3FH7 A;  5DBK A;  4U95 D;  1LF8 A;  2XPI A;  4A1S A;  3M57 A;  2XS1 A;  4EZL A;  4APO A;  3F6Q A;  4XI0 A;  1E7V A;  3PNL B;  4TV3 A;  4ACL A;  3FU3 A;  3W9F A;  4TXR A;  2V5F A;  4F3V A;  3EHN A;  3O48 A;  3FTX A;  3MKR A;  4LDG A;  1JCS A;  3FDH A;  2RD0 A;  4NVQ A;  4QQI A;  1SVX A;  2NYJ A;  3LVQ E;  5ANR A;  2BED A;  4IRU A;  4AJW A;  2LXM A;  3GW4 A;  1HU3 A;  3ZPJ A;  5ANL A;  4HOT A;  3IHX A;  2VGX A;  1TNB A;  2X6K A;  4U0Z A;  3ZYL A;  4J7F A;  3SZ7 A;  4HRL A;  1FCH A;  2X6F A;  3PUJ A;  1LD8 A;  2H6G A;  4EZJ A;  2WPV A;  4RLY A; 
#chains in the Genus database with same CATH homology
 5AYF A;  4FMU A;  4XIF A;  3TG5 A;  5JHA A;  4WND A;  4ABN A;  4ANU A;  3RRU A;  3B13 A;  5BW8 C;  2WMN A;  2PM7 A;  4BUP A;  4GZ6 A;  1WY6 A;  2WQ6 A;  4UQY A;  2VYI A;  3PNT B;  4H7X A;  3S7B A;  4F53 A;  3OXL A;  4XZ4 A;  4MS6 A;  5E75 A;  4DLO A;  4FP7 A;  4L2L A;  4KVO A;  1JUQ A;  3BG1 B;  3ULQ A;  1MQS A;  3MO2 A;  4QEO A;  3RQ4 A;  3PEV B;  3PS6 A;  4DPR A;  2J4B A;  3B7R L;  1U3C A;  4FU3 A;  5DIZ A;  5A7D B;  3QKY A;  3F9Z A;  5G55 A;  2X6I A;  4UQX A;  4EBA G;  3EP0 A;  5FZS A;  1HFA A;  3VTY A;  2CHX A;  3FH8 A;  3KMJ A;  4BT9 A;  2YNQ A;  3FU5 A;  1KLX A;  4IYP A;  3RKV A;  1KT0 A;  3SW9 A;  4AV7 A;  2MHK A;  3NZU A;  3QC1 A;  2XGM A;  4XKC A;  3ZHE A;  2L0T B;  2P58 C;  3LPZ A;  4GCO A;  3UX4 A;  4V3I A;  3BG0 B;  3M58 A;  2FO7 A;  4XKB A;  3CVU A;  5JIY A;  3TG4 A;  5LCW C;  1MVX A;  3M59 A;  4DI3 A;  4JEH A;  2WXI A;  3TJP A;  4JDS A;  2IQC A;  3FUN A;  3PEU B;  2WXR A;  3CVN A;  4F1S A;  1H3I A;  3B7U X;  3PRE A;  3KAE A;  4AIF A;  4NJ5 A;  1H0A A;  4G1T A;  5FT9 A;  4JHR A;  3FUJ A;  1UN8 A;  1VDY A;  2CHW A;  3ASH A;  3QAQ A;  4IUL A;  3QB2 A;  4GCN A;  3APD A;  2ION A;  3FUL A;  5JJ0 A;  1SZA A;  3RK6 A;  3GZS A;  3NZS A;  3ZYQ A;  2BQZ A;  2W5Y A;  4G11 A;  3Q5M A;  4KZ0 A;  4JZY A;  4KBQ A;  2OVF A;  3CVQ A;  3MX3 A;  3S7D A;  2YHC A;  3L13 A;  5JHB A;  4CDR A;  1OUV A;  2IOL A;  1N6C A;  5T3R A;  2YHE A;  3SWC A;  1PC2 A;  4EZK A;  4I51 A;  4RG9 A;  3APF A;  4G24 A;  4MLP A;  4Y6C A;  4J6I A;  3ZVV A;  4WWO A;  4Q96 A;  5LSZ A;  4I6E A;  3K5K A;  2GW1 A;  4U04 A;  4UWG A;  3DPD A;  4N3C A;  2R59 A;  2Q7F A;  2JEK A;  4YND A;  4ILH B;  1HF8 A;  3AS4 A;  1TJC A;  1UJJ A;  5TH7 A;  2WXJ A;  2GRM A;  1PY1 A;  4H12 A;  3FUH A;  3NQP A;  1E7U A;  3MCX A;  3ZW3 A;  3IBE A;  3CBO A;  4KMO A;  3HIZ A;  3KMA A;  4NQ0 A;  4UWF A;  3RJW A;  4F7A A;  3FUI A;  4GYO A;  3UPV A;  2XRZ A;  2LNI A;  4LEU A;  2G46 A;  2OOE A;  1Y8M A;  4ANV A;  2FUL A;  3ENE A;  3S7F A;  3HVE B;  4FJY A;  1E8Z A;  3CKB A;  3CGH A;  3D9M A;  5FQ4 A;  4NRH B;  4EBA A;  5HQ8 A;  1ZKK A;  3R7R A;  5BV1 A;  3DAL A;  2LSV A;  4JA9 A;  1MUF A;  4WAF A;  2CFU A;  3I3N A;  4JXT A;  3FPD A;  4FAD A;  2QPW A;  3JQ1 A;  4J8F A;  2LAI A;  5JJ6 A;  3DB5 A;  4MRU A;  3MYV A;  4C1Q A;  3AU5 A;  5CMY A;  3FFL A;  3UMV A;  5LFA A;  3VUZ A;  2V4L A;  4I1A A;  1SZ9 A;  4H7Y A;  3B7S A;  3FH5 A;  3LVR E;  3SBS A;  4GU5 A;  1A17 A;  5M72 A;  3QDN A;  3LKU A;  3SFZ A;  4GMJ A;  3S8P A;  4AP2 A;  3LYA A;  2RFI A;  4I17 A;  4GAA A;  4ANX A;  3HNA A;  2XPY A;  3C98 A;  4ILG A;  4HS2 A;  2JV0 A;  3U9W A;  3CVY A;  4E47 A;  3SD5 A;  3FHE A;  3CK9 A;  2WQ7 A;  4K0R A;  2WB2 A;  1XGW A;  2LSU A;  4I1M A;  4L1B A;  2HM8 A;  3D9K A;  4Q94 A;  1TJF A;  2WVI A;  4A1G A;  3VLF A;  3TXM A;  3I4G A;  1NA0 A;  2GGF A;  2VGX B;  3IKO B;  3QWW A;  3ZXS A;  3JQ0 A;  1OWO A;  5C2Y A;  3MA5 A;  2FBN A;  4J83 A;  3IHY A;  3ZYK A;  3LS8 A;  3PDN A;  5J08 A;  3CVV A;  2I6H A;  5LCW J;  3HDX A;  4BX9 A;  5CPR B;  1HS6 A;  3KD7 A;  3LJ3 A;  3QNK A;  4BY6 A;  4GA2 A;  1KT1 A;  1FVH A;  4KXK B;  4EPZ A;  4PH4 B;  3TL5 A;  2WXF A;  4HLE A;  3FUF A;  4J8O A;  3RRM B;  2IOS A;  3EIJ A;  4FHK A;  2ILR A;  4C9B B;  3ONK A;  2IFU A;  2PZI A;  2IF4 A;  3GZ2 A;  5EDS A;  2FF4 A;  3CQG B;  4YPA A;  3OXG A;  4IJ8 A;  2VSN A;  2UY1 B;  3EIQ C;  3G2S A;  3FU6 A;  4B94 A;  3M56 A;  4CGV A;  4GZ5 A;  4WNF A;  5TEG A;  3AU4 A;  3ZRH A;  3G2T A;  4GYY A;  3U66 A;  3ESK A;  4FLB A;  2LO6 A;  5JJT A;  3CEQ A;  4CDN A;  4UWH A;  4EEC A;  4URK A;  1Y6I A;  2DIW A;  2I2O A;  1PAQ A;  3RRN B;  3APC A;  1QQE A;  4OYS A;  2L6J A;  2L0I A;  2I9C A;  4RZ0 A;  4RSY A;  2DCP A;  4GYW A;  4LRZ A;  4C0E A;  1H6K A;  4JLG A;  4R7L A;  3ZIM A;  4J8E A;  4CEM A;  4MKT A;  4GML A;  2FI7 A;  2VGY A;  3P1U A;  1IQU A;  4B8A A;  4TRQ A;  2C0L A;  1EYH A;  3ONL A;  2KZT B;  5A23 A;  4XE0 A;  5F5E A;  4JL0 A;  2AXV A;  1E8Y A;  2XCB A;  4FA6 A;  4MI5 A;  3VTX A;  3B7T A;  3G2W A;  3T8M A;  1TEZ A;  3M5A A;  5F59 A;  3L6A A;  3HYM B;  2XCC A;  3ASD A;  2XHE A;  1FVF A;  1E96 B;  1HG5 A;  3CVP A;  4I43 A;  4U0U A;  3ZYM A;  3UT8 A;  1UJK A;  3MO5 A;  2KM4 A;  3CVX A;  4I2W A;  4WUY A;  3SBT B;  3BO5 A;  3E4B A;  2VSO E;  4G2V A;  4U0S A;  3VLE A;  4NUR A;  1IHG A;  1H2V C;  5FZR A;  5T4Y A;  4HOS A;  1UW4 B;  3U4T A;  1Z3Y A;  3GYZ A;  3CQC B;  3PVL A;  5BT1 A;  3KMT A;  4G25 A;  1ELW A;  3RIB A;  3LCA A;  1MHQ A;  4XX5 A;  4FJZ A;  3OPE A;  5JIN A;  5BV0 A;  3CSF A;  1WAO 1;  1S0P A;  3LDZ A;  3R7Q A;  4BFR A;  3CHP A;  1HX8 A;  3D9N A;  5LP0 A;  1ML9 A;  4JVS A;  2VTB B;  3IEG A;  3N71 A;  4OVU A;  4J8S A;  3URZ A;  3G2U A;  4E85 A;  2WXG A;  3HHM A;  2WXM A;  3QOU A;  4I9E A;  3OXF A;  4UI9 J;  3UT4 A;  4B0Z A;  1EPU A;  4XI9 A;  1O9S A;  3LY7 A;  2F69 A;  2IGQ A;  5AJL A;  5KJN A;  2ZU6 B;  2VQ2 A;  3D9J A;  3RO2 A;  2VSX E;  1HE8 A;  3MZL B;  4AM9 A;  4GB9 A;  5F6K C;  2Y4T A;  4HVB A;  5G04 J;  5TTF A;  2CG3 A;  2X3M A;  2NC9 A;  2M63 A;  2Y3A A;  3OS5 A;  4RVB A;  2J09 A;  5FTP A;  5JJ7 A;  4ME2 A;  1IYG A;  3JUI A;  4FUL A;  3CBM A;  2OV8 A;  4O30 A;  1UG3 A;  5AJD A;  4B8C B;  1JWF A;  2X6H A;  3MV3 B;  1QNF A;  3ZFW A;  3ZGQ A;  2KCK A;  4GZ3 A;  2VSY A;  3SF4 A;  4J8D A;  3OTN A;  4HOU A;  4WWN A;  4FLH A;  5G05 J;  5FWQ A;  2EQX A;  3ML8 A;  3T5V A;  3PH0 C;  1XNF A;  5ARG A;  1GW6 A;  1MT6 A;  4QEN A;  4UI9 C;  3HVE A;  3LEW A;  4LUN U;  4N39 A;  2WXN A;  4I6J A;  4UWK A;  3SI5 A;  5AIJ A;  4N2Q A;  3QAR A;  4LCT A;  3CVW A;  1OWL A;  5ENN A;  2R3A A;  5LX8 A;  2IJG X;  3MKQ B;  3BEE A;  5CCM A;  4CDM A;  3ZEF A;  3CST A;  3OOI A;  5G04 C;  3MJW A;  3QJZ A;  5T5G A;  4BX8 A;  3S7J A;  4N5C A;  3M54 A;  4QEP A;  3Q4A B;  2KCV A;  1DNP A;  3D9O A;  3LY8 A;  4I9C A;  4L2Y A;  4CT0 A;  1N52 A;  2AVP A;  4WWP A;  4N3A A;  3UQ3 A;  3FEY A;  4P29 A;  5KCM A;  3IHV A;  3CR3 A;  3T5X A;  3MEK A;  4PDX A;  3FTZ A;  3I4R B;  2BTD A;  2Y4U A;  2DBA A;  3KS2 A;  3F9Y A;  4BSX A;  3CK8 A;  2AW6 A;  2XEV A;  5FQ8 A;  1HXI A;  3JYS A;  5G05 C;  5G2N A;  3TXN A;  3CHQ A;  4WNE A;  4DK5 A;  3P2B A;  3UT7 A;  1E8X A;  1OWM A;  1SQM A;  1N54 A;  4YPE A;  1JWG A;  4APF A;  4ANW A;  3U3W A;  3G2V A;  4O6F A;  4A55 A;  2WXL A;  4BTA A;  1EDU A;  2OND A;  5KJL A;  4GZD A;  4I1O B;  1OWP A;  4PS8 A;  3FWV A;  5AEN A;  1N6A A;  3RJV A;  4G23 A;  1MVH A;  3AS5 A;  2J4D A;  5CCL A;  1P5Q A;  5D0Q D;  3S2A A;  2V0P A;  2YQ8 A;  3L08 A;  4B89 A;  1U3D A;  4HFG A;  3FU0 A;  3LY9 A;  4KT6 B;  1ZU2 A;  5CMW A;  3TAX A;  4CT4 A;  2OVB A;  4AY5 A;  2O8J A;  4HXI A;  5KJK A;  2E0I A;  3Q47 B;  5FQ6 A;  4ACK A;  2PQN A;  4KYO B;  1ZBP A;  2BF0 X;  3ASF A;  2C0M A;  1N3J A;  3QK0 A;  2NSZ A;  5E76 A;  2UY1 A;  4I2Z A;  3JCK C;  1E8W A;  1H19 A;  2A4Z A;  4A3V A;  3R9A B;  4J0U A;  1DVP A;  2MOW A;  4Q69 A;  5T0K A;  5JHN A;  1JPL A;  2E2E A;  2IU1 A;  3FTY A;  2CFZ A;  3MGB A;  3WXX A;  1YA0 A;  4LER A;  3F9X A;  3GZ1 A;  4YNM A;  4K03 A;  2NXP A;  3CHS A;  4YVO A;  2UWJ G;  4WNG A;  5CHE E;  3FP3 A;  2WXQ A;  4RG6 A;  4ATG A;  4CRW A;  1B89 A;  3PUK A;  3FUK A;  5AYW D;  1BPO A;  2LAH A;  3CHM A;  3K9I A;  4PS7 A;  2J9Q A;  5EG2 A;  4CCA A;  4DJA A;  2HR2 A;  3L54 A;  4BTB A;  5J90 A;  4JHJ A;  2KZT A;  3ZHE B;  3M53 A;  4KZC A;  4UWL A;  4AVX A;  3DBS A;  5FZQ A;  4JW1 A;  3UUX A;  1HG2 A;  2WXP A;  1IQR A;  3RAY A;  4M3O A;  4IJD A;  4U8H A;  2J07 A;  4IN3 B;  5LOZ A;  4A3T A;  4E6H A;  2GRL A;  3CLJ A;  1NZN A;  3D9I A;  1HH8 A;  3ESL A;  5F6L A;  3PE4 A;  4JEU A;  4KVM A;  2PQR A;  3OAW A;  2HO1 A;  2MRI A;  4TUU A;  5D0O D;  1XQH A;  5BNW A;  2R17 C;  4NAC A;  3L16 A;  5BUZ A;  2X6J A;  2RG8 A;  1HO8 A;  1X5B A;  3CHO A;  3LXU X;  5T0M A;  2PL2 A;  4L23 A;  2FEZ A;  4N2S A;  3L22 A;  3KEZ A;  2I1K A;  3FY4 A;  1PEG A;  1ELR A;  3PRZ A;  2XPZ A;  2XRY A;  3D3M A;  2VTB A;  3FTW A;  3CBP A;  3EJN A;  4DI4 A;  1ELK A;  3VV0 A;  3SHF A;  3CKC A;  3D9L A;  1H2U A;  2WXH A;  2QFC A;  4GA0 A;  4I6G A;  4AXH A;  4JA7 A;  2WM9 A;  3QWV A;  3MO0 A;  1E90 A;  2J08 A;  4GA1 A;  2I1J A;  4JPS A;  4Z4P A;  4G26 A;  3ZN3 A;  2J49 A;  5BPP A;  3RO3 A;  2V8S E;  3CIA A;  3Q49 B;  4PS3 A;  3FUD A;  4FHJ A;  4EQF A;  4YVQ C;  4QFV A;  1UN9 A;  1INZ A;  4W9R A;  4HOR A;  4PUC A;  4U63 A;  4YPU A;  4HOQ A;  2VJ8 A;  2BUG A;  4AU7 A;  3TGO A;  2WXO A;  4C0M A;  2HYZ A;  3AS8 A;  2KCL A;  2W5Z A;  3SNX A;  4MI0 A;  3FH7 A;  5FJY A;  5DBK A;  4BWR A;  3ML9 A;  1LF8 A;  2XPI A;  4A1S A;  2WXK A;  1H2T C;  2R5S A;  3M57 A;  4EZL A;  4APO A;  1WM5 A;  5ARF A;  2KC7 A;  4XI0 A;  3IV0 A;  1E7V A;  3PNL B;  1Z3X A;  3D9P A;  3F9W A;  4UI9 K;  4TV3 A;  1NA3 A;  4YNP A;  5EX3 A;  4ACL A;  3FU3 A;  3FUM A;  2C2L A;  3CK7 A;  2PM6 A;  1HZ4 A;  4JC8 A;  2V5F A;  4GPK A;  5FQ7 A;  4N3B A;  2JLB A;  3CVL A;  3FTS A;  4F3V A;  3CV0 A;  3EHN A;  3VLD A;  4Y6W A;  3O48 A;  2AWI A;  3MKQ A;  2WMO A;  3FTX A;  3MKR A;  4LDG A;  3FDH A;  2RD0 A;  3EDT B;  4NVQ A;  3FEX A;  4FC8 A;  3ASG A;  4AY6 A;  3M55 A;  4D10 C;  2YIN A;  3PE3 A;  2WQH A;  3FUE A;  3QWP A;  3LVQ E;  4OVV A;  2XGS A;  5ANR A;  5HI7 A;  3SGH A;  3PZD A;  1NP7 A;  4U07 A;  5LSX A;  4IRU A;  1EF1 C;  4AJW A;  1QZ2 A;  3I5P A;  5C1D A;  3FTV A;  3GW4 A;  2L9B A;  2CG2 A;  2AXU A;  2XGO A;  4JHK A;  4AOF A;  3L17 A;  4DLQ A;  2AXZ A;  1HU3 A;  2XQ0 A;  3MV2 B;  4L7T A;  5EKQ D;  4GZC A;  3ZPJ A;  1W3B A;  4J7I A;  5ANL A;  2X38 A;  4HOT A;  3IHX A;  5T8I A;  2VGX A;  3CHR A;  2A5U A;  2CHZ A;  2X6K A;  3EHM A;  3FTU A;  4U0Z A;  3ZYL A;  4J7F A;  3SZ7 A;  5A6C A;  1Z6T A;  1FCH A;  3Q15 A;  4ILI A;  5EX0 A;  2X6F A;  3PUJ A;  4AEZ C;  2QY7 A;  3NF1 A;  1OWN A;  2KAT A;  3U64 A;  4EZJ A;  1L5J A;  4CGW A;  3RU0 A;  5KJM A;  2WPV A;  4BT8 A;  3O4Z A;  4UQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...