5KJMA

Smyd2 in complex with az931
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
429
structure length
429
Chain Sequence
b'GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Design, Synthesis, and Biological Activity of Substrate Competitive SMYD2 Inhibitors.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 145
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5kjmA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5kjmA01
4I1AA 4RG9A 4W9RA 4HOSA 5F6LA 4AIFA 3M54A 4NVQA 4YPUA 3CKBA 2BUGA 3RAYA 4NQ0A 3AS8A 2XCCA 2C0LA 5A7DB 3QWVA 4J83A 2IF4A 2VYIA 1MUFA 5DBKA 3QOUA 3CVNA 3TG5A 4H7YA 3SF4A 2WQHA 4UI9C 4YVOA 3PE4A 3K9IA 2C0MA 4I2ZA 4WUYA 4JA7A 5F6KC 4RZ0A 2JLBA 3ESKA 3S7DA 2FEZA 4I9CA 1WM5A 4HOUA 3ZFWA 3ULQA 4ME2A 4NJ5A 2Y4TA 1WAO1 2FBNA 2KCLA 4AY5A 1ZBPA 2Q7FA 4U0UA 3MEKA 1W3BA 3K5KA 3VTYA 4ABNA 5EX0A 5C1DA 2XEVA 4BUPA 3M58A 4N2SA 3RO3A 4I9EA 3CBPA 4U04A 4AM9A 2VGYA 5CHEE 4G1TA 4YPEA 3Q4AB 3BEEA 3F9YA 3GZ1A 4BT9A 4KXKB 4BT8A 3S7BA 2C2LA 5FTPA 3M53A 1B89A 3ASFA 5KJNA 2XGMA 3KMJA 4BTBA 4JDSA 2VQ2A 3LY7A 4IJDA 2R5SA 2OOEA 1OUVA 5FJYA 2FI7A 4KYOB 2O8JA 5LCWJ 3M59A 4IJ8A 2PZIA 3F9XA 5FZQA 2RFIA 1MT6A 5G05C 2L6JA 3CBMA 5JINA 4GZ3A 3CEQA 3CVLA 3RQ4A 3QWWA 3Q15A 3SW9A 5LSXA 1TJCA 4YNDA 3LPZA 2VSNA 4O6FA 4NRHB 4J7IA 4HOQA 3QWPA 4GYYA 3BO5A 4QEOA 3RJWA 4HORA 4WNEA 4J8EA 5G04C 4J0UA 4F3VA 5CCMA 4YPAA 2WPVA 3EDTB 3QDNA 5T0KA 4HOTA 3S7JA 3OS5A 1N6CA 5EX3A 1A17A 4G2VA 3OXFA 3FFLA 4YNPA 3ZHEA 3RJVA 3Q49B 2PQNA 5HQ8A 4BTAA 1XNFA 4GA2A 5A6CA 1MVXA 2J9QA 3MO2A 3CKCA 4JHRA 3ZPJA 5KJMA 3CBOA 5ARFA 1E96B 3LYAA 2MHKA 5HI7A 5FT9A 2LSUA 1IHGA 2QFCA 2G46A 4H12A 2XGSA 4AU7A 2XPIA 3PDNA 2KCVA 2V5FA 4Z4PA 3LCAA 4CDRA 3OXGA 4N3CA 4N3AA 3AS4A 4UI9K 1YA0A 4GZ6A 4GYWA 4U0SA 4AY6A 3ASDA 2ONDA 4FMUA 5JIYA 2XCBA 5TTFA 5F5EA 3U3WA 4MI0A 4GCNA 3URZA 1NA3A 4JL0A 5D0QD 5FZSA 3TG4A 3ZHEB 5D0OD 1FCHA 2YHCA 3F9ZA 2NC9A 1ZKKA 2AVPA 5F59A 3M56A 1XQHA 2GW1A 1MVHA 3DALA 4JA9A 3GW4A 3CK9A 2VGXA 3TGOA 5TH7A 3IHXA 3CV0A 5TEGA 4G24A 1PC2A 3HNAA 5T5GA 2UWJG 4B94A 2PQRA 3WXXA 4YVQC 5BT1A 5DIZA 3VTXA 3KAEA 3VV0A 3M57A 1HH8A 5LCWC 4C1QA 4Y6CA 3U4TA 3MKRA 2LSVA 1NA0A 4J7FA 4YNMA 5EKQD 3SWCA 4XIFA 2DBAA 5JJ0A 4N39A 2KATA 4QEPA 3OPEA 1H3IA 3UUXA 5JJ7A 2VSYA 2BQZA 4I51A 2I6HA 5JJ6A 3HYMB 4CGWA 1ZU2A 3AS5A 2XGOA 3LY9A 2IFUA 3EP0A 4XI9A 3OOIA 4LDGA 2R3AA 4UI9J 4U07A 4LEUA 3MA5A 2F69A 3ZN3A 1O9SA 2UY1A 5EG2A 3CVPA 4GA1A 4IN3B 4U0ZA 2W5YA 4I2WA 4N5CA 4RG6A 4GPKA 2FF4A 2VGXB 3O48A 1KT0A 4G25A 5M72A 5BNWA 3RU0A 5LSZA 3CK8A 3S7FA 4Y6WA 5FZRA 4EQFA 4N3BA 3N71A 1KLXA 3RKVA 3TAXA 4JLGA 3SZ7A 4CGVA 3RO2A 4G23A 2HR2A 4UQXA 5AYFA 4KBQA 3KS2A 5AYWD 5CPRB 4GCOA 5BW8C 4J8FA 3KMAA 3Q5MA 4GA0A 1ML9A 3CK7A 3NF1A 3PE3A 1IYGA 3JYSA 4WNFA 3UQ3A 2KC7A 5JHNA 3ASHA 3UPVA 5ARGA 3FPDA 1NZNA 5T0MA 2HO1A 3F9WA 2KCKA 4APOA 5G05J 1P5QA 3ZGQA 4WNDA 4G26A 1KT1A 3MO0A 2HYZA 4O30A 2UY1B 2P58C 3Q47B 4XI0A 3LKUA 1PEGA 1QZ2A 1QQEA 5CCLA 4MI5A 3ASGA 3VUZA 5KJLA 5KJKA 3DB5A 3CVQA 3M5AA 5JJTA 1Y8MA 3OXLA 3MV3B 3QKYA 3R9AB 4A1SA 4WNGA 3MV2B 3E4BA 5G04J 1HZ4A 2LNIA 4N2QA 3RIBA 2W5ZA 4QENA 4UQZA 2QPWA 3S8PA 1N6AA 2Y4UA 2YQ8A 1N3JA 4UQYA 3LY8A 4J8DA 3GZ2A 4GYOA 3M55A 1ELWA 3GYZA 4I17A 4GZ5A 2E2EA 4E47A 3KD7A 3IEGA 2IGQA 2JV0A 2FO7A 3MO5A 4H7XA 1ELRA 3KMTA 3FP3A 4BWRA 2PL2A 4J8OA 1HXIA 3FWVA
chains in the Genus database with same CATH superfamily
2DIWA 4GZCA 3LJNA 5EILA 2BUGA 3RAYA 4NQ0A 3R7QA 2C0LA 3AG1E 2IF4A 5D66A 3CHSA 3NAWA 2YNQA 5DBKA 3TG5A 1BLXB 4KZ0A 4UI9C 4CZ2D 4YVOA 1S63A 2X6KA 2J49A 3CSFA 4WAFA 4WUYA 5ENTD 4JA7A 3UT8A 2JLBA 4GTVA 3S7DA 4GZDA 3PZ1A 4U96D 2AW6A 3ZFWA 4C0MA 4XE0A 2FBNA 3AG4E 4EZLA 4AY5A 3CHMA 3IKOB 5FINA 4LCTA 3B7TA 5BXUA 1HX8A 4EZKA 4IRUA 4N2SA 4Q69A 5ENSD 4E85A 4I9EA 4U04A 3JXIA 4G1TA 2V4LA 4LSZE 1E90A 3GZ1A 5FTPA 4CT0A 4BERA 1U3DA 2XRYA 3ASFA 5KJNA 3TWVA 4DUIA 4BTBA 2X38A 1N11A 5BPPA 4IJDA 2R5SA 2OOEA 4CRWA 5AJDA 1IKND 3V31A 5AIJA 3M59A 4IJ8A 3DEOA 3F9XA 5FZQA 4L1BA 2L6JA 2WXLA 5JINA 2R59A 5H7PA 3CEQA 4A1GA 3Q15A 2H6IA 4K5CA 3SW9A 4YNDA 2WXGA 4I1OB 3J5PA 1TR4A 4MKTA 3KEZA 4NRHB 1WDYA 3NQPA 3RJWA 3CHPA 3UT4A 4J8EA 3LVRE 5G04C 4J0UA 4F3VA 1TNUA 3T5XA 3QDNA 4HLEA 1DNPA 2PM6A 3FUNA 2EINE 3OXFA 3FFLA 4KZCA 3RJVA 4LG6A 4TXPA 4APFA 4F1SA 2DZOA 4EBAG 4BTAA 3L22A 1MVXA 4GTTA 4DX7D 2X3MA 3B7BA 4C9BB 3I4RB 3ZPJA 1NFIE 1NL4A 3TWTA 3Q7AA 5ARFA 5LX8A 5HI7A 3V2OA 5CECB 4JHKA 4C48B 3ZUVB 2OEVA 3FUJA 1IHGA 2QFCA 5B1BE 3FH8A 2XGSA 3FEXA 4AU7A 2AJAA 3PDNA 1X5BA 4J8SA 3LCAA 4BSXA 3D9HA 1N4PA 4K03A 4N3AA 3ABME 2I9CA 4UI9K 4BY6A 1YA0A 4LERA 2LXLA 3LS8A 3UKUG 4AXHA 1VDYA 4RLYA 3UX4A 4GTPA 2A5EA 2XCBA 4FLBA 3PNLB 3HVEB 5F5EA 2IEJA 4ILIA 4MI0A 3NOCD 4DI3A 5EYPF 3URZA 1NA3A 3CVVA 4JL0A 1SA4A 3W9GA 5AQ7A 3TWWA 4HRNA 3ZHEB 5BXOA 3T5VA 5D0OD 1N0RA 4RQIA 1H2VC 1ZKKA 5J08A 3EHMA 4EZJA 4JA9A 3GW4A 4L2YA 3TGOA 2WXHA 2J8SD 2IO3C 4DJAA 2PQRA 4NIKA 3WXXA 5BT1A 2NSZA 3FTSA 1JWGA 3SFYA 3VTXA 1JCSA 4KT6B 1MX6A 1TNZA 3QC1A 3NB2A 3APFA 3ZEFA 4I6EA 4YNMA 1QNFA 2DBAA 4EECA 5JJ0A 3ZYMA 4N39A 4FJZA 1H3IA 1L5JA 3JQ1A 3UUXA 3IHVA 2VSYA 2BQZA 4I51A 1MJ0A 3G2VA 3HXEA 2AWIA 2IFUA 3EP0A 2WXMA 3IHYA 1OXJA 1QYMA 4U63A 2F69A 1O9SA 2PNNA 4XEIG 2JEKA 5AARA 5E76A 1EF1C 4WWPA 5FIOA 2W5YA 4I2WA 4GPKA 2QYUA 1INZA 2FF4A 3O48A 1UN9A 3HXBA 5M72A 1Y6IA 1AP7A 3DSTA 4FHKA 5HS0A 5J90A 4A3TA 3FH7A 3S7FA 4FC8A 1O5MA 3ABKE 2H6FA 4JEUA 3TAXA 4JLGA 3SZ7A 4G23A 2HR2A 4UQXA 1U2VG 2IY0C 3D9MA 4GCOA 2R02A 4U7EB 5ANRA 4U8YD 1XGWA 1ML9A 4CT4A 3NF1A 1MX4A 4WNFA 4E6HA 4AP2A 2XPYA 3EHQA 1JCQA 2DWZA 1KPSB 3PH0C 2XHEA 3E33A 5G2NA 3L54A 3JUEA 2GGFA 2WQ7A 4DX6D 5G05J 4WNDA 3U9WA 1HG2A 2DYSE 2H6GA 3UT7A 4O30A 3MX3A 2P58C 3Q47B 4XI0A 3UM0A 1Z6TA 1QZ2A 4HFGA 4DLOA 3ASGA 3HXCA 3TWXA 3SI5A 3DB5A 2KZTA 3R9MA 5JJTA 4UWGA 3OAWA 3OXLA 2EIJE 3MV3B 3R9AB 5EIBE 3MV2B 1ELKA 2LO6A 4N2QA 3MJWA 4B89A 2QPWA 2Y4UA 5JHAA 1HE8A 4J8DA 2ILRA 5HRYA 4I17A 4TRQA 2XQ0A 2EQXA 4GZ5A 2E2EA 3AG3E 4ANXA 2HM8A 2XRZA 3DEPA 2JV0A 3IBEA 1N4QA 3C3OA 2KXPC 3FU0A 3C3QA 5T3RA 3CSTA 3PVLA 4J8OA 1K8KG 3CR3A 2V4HC 5KBAA 2J4BA 2X6JA 1V54E 2CG2A 3AAAC 2EILE 2WMNA 3AS8A 3QWVA 3D9NA 3QOUA 3CVNA 2GRPB 3PE4A 1TN6A 4F7AA 2FEZA 5KCMA 4I9CA 3RRMB 2V8SE 1WM5A 1UN8A 4HOUA 1ZB1A 2RFAA 1UJKA 4NJ5A 2Y4TA 2KCLA 2X6FA 2CHWA 1ZBPA 3FUIA 2Q7FA 2ZISA 3ONLA 2XS8A 4U0UA 3FH5A 3K5KA 1K1AA 5C1DA 3E37A 4BUPA 4OAVB 1BPOA 2VGYA 3CVYA 5AJLA 1MZCA 3Q4AB 3F9YA 3UI2A 4KXKB 2E0IA 5AAOA 3UM1A 4FJYA 3X2QE 4PDXA 3TWUA 1H19A 4HI9A 1K1BA 1FT2A 2VTBB 3E34A 4JDSA 2F37A 5ENPD 3LY7A 3CIAA 2FI7A 2FULA 3C5RA 1MT6A 2GRQB 4ACKA 3CBMA 2I1KA 3KSQA 4GTOA 5FQ7A 4GZ3A 3DSUA 4OVUA 4LRZA 4B93B 3D9KA 4K5BA 3D9IA 4YDOA 3ASOE 4Z68A 3EU9A 2FO1E 2VSNA 1DCQA 3DSWA 4TUUA 4WWOA 4HOQA 3EJNA 4GYYA 3BO5A 3MZLB 4ANVA 1SA5A 4BEPA 4WNEA 4FU3A 4HS2A 4NURA 5CCMA 4YPAA 1OWLA 3ZYKA 3DSVA 3EDTB 2IONA 2ZXWE 5CEAA 2P9SG 3QNKA 3Q49B 3ESLA 5HQ8A 1D8DA 3L16A 3ZKJA 2Y0BG 3MO2A 4ILHB 4JHRA 2DYRE 1E96B 3TXNA 4DPRA 2BF0X 4OYSA 2WXIA 5FT9A 3GZSA 2V0PA 2LSUA 3DPDA 3D9OA 2VSOE 4ILGA 4AVXA 3L9TA 4GAAA 5KNHD 2XPIA 1E8WA 2HE0A 4CDRA 2P9UG 5AQAA 1UG3A 1GW6A 4X8QA 3AS4A 4EPZA 2BEDA 1Z3XA 4GYWA 3NBNB 3FEYA 1FVFA 3ASDA 2J4DA 5LOZA 1N52A 2P9KG 2ONDA 2WXRA 1HS6A 1H6OA 3U3WA 4GPMA 3HG0D 4U95D 5ITZF 3E30A 3PZ4A 4N5QA 3TWSA 3APDA 3MKQB 1E7VA 3EIJA 5ENOD 4B8CB 4CCAA 1XQHA 2CHZA 2VGXA 4B8AA 2ETCA 3SNXA 1PC2A 3HNAA 5T5GA 3MGBA 4HB5A 4YVQC 2XEEA 3FU3A 4F6RD 3LEWA 4A63B 4L9PA 3ZRHA 1BD8A 3MKRA 3ULEG 3SBSA 5IY5E 2M63A 1S70B 3SWCA 1TN8A 4FA6A 2KATA 5BV1A 4QEPA 3OPEA 4UWKA 2P2CP 5JJ6A 3CVUA 1ZU2A 2IO2C 2XGOA 4XI9A 5FQ4A 3PRZA 2BKGA 3MA5A 1JWFA 3UM2A 2UY1A 3R7RA 5EN5D 1EYHA 3HXDA 2BTDA 3PREA 3UINC 4G25A 4G8KA 4BSZB 2ZGGA 4P29A 3CK8A 4GTRA 4Y6WA 5FQ6A 3ZXSA 5FZRA 4EQFA 3Q7FA 3P1UA 4QFVA 4CGVA 3RO2A 1X81A 4RSYA 2WXJA 3UIPC 4LNGA 3SQVA 3G2SA 3KMAA 1SZAA 5AENA 3CHOA 2VSXE 3HRAA 3PE3A 4ATZD 3VLEA 4PS8A 2XZDG 4OAUC 1LD8A 3ASHA 3BG1B 4JEHA 4U8VD 5T0MA 1OWNA 2KBXA 4V3IA 4HQDA 3CHRA 1KT1A 3MO0A 2HYZA 3LVQE 5AQ9A 2L0IA 4XX5A 2ZU6B 4O1PA 1OWOA 4YDEA 4I6JA 3C98A 3FY4A 3SO8A 5CCLA 4L23A 4LNBA 4ATGA 3CVQA 1FVHA 3FU5A 3TWRA 1N54A 1N94A 1O1TA 4G11A 4BX9A 3PS6A 2GRNB 2MOWA 4OVVA 4WWNA 4HLLA 4UQYA 2A5UA 4GYOA 1TN7A 3F6QA 5A23A 2Y69E 3VLFA 2IGQA 2QY7A 3DPYA 3DBSA 4YDYA 3ABLE 2WXPA 3PEUB 2LUHA 4BWRA 1OCOE 3UTMA 3FWVA 3FTVA 1KZPA 2R2LA 4I1AA 4RG9A 4MRUA 2R17C 4HOSA 3M54A 4NVQA 4YPUA 3CKBA 2NYJA 4YDWA 2XCCA 5A7DB 2GROB 1IQRA 3KEAA 3FU6A 1WY6A 3B7SA 4J7WA 1UOHA 3P2BA 4RZ0A 1FPPA 3B95A 3CLJA 4IYPA 1D8EA 4M7CA 1DC2A 4ME2A 3ML9A 1WAO1 3BU8A 4IULA 3MEKA 4O1OA 2F0YA 2XEVA 3PEVB 3T9KA 3RO3A 2YHEA 2ZGDA 2WQ6A 1SVXA 3ZNGA 4BT9A 4F53A 3S7BA 2C2LA 3CQCB 1EDUA 1G3NB 3M53A 1SQMA 4O60A 4GMRA 1D9SA 5CRUA 2XGMA 4FLHA 3KMJA 3L08A 2VQ2A 3DRAA 3EUVA 3ZYQA 5FJYA 4FHJA 3FDHA 3VLDA 2O8JA 5LCWJ 1RZ4A 2RFIA 4DK5A 5G05C 3PZ3A 5EYLA 3UMVA 3EU5A 4F1PA 3RQ4A 4M3OA 5LSXA 3NZUA 2IU1A 4PS7A 1OWMA 4JW1A 3LPZA 3ML8A 4A55A 4J7IA 3AJIA 2RG8A 2P9IG 4QEOA 1HF8A 4I6GA 4HORA 3D3MA 3HVEA 4MBGA 3BG0B 2WPVA 3B13A 4DX1A 3QK0A 5T0KA 3S7JA 1N6CA 5EX3A 4G2VA 1IXVA 2MYOA 3ZHEA 1H0AA 4AJWA 4KVOA 3HXFA 1XNFA 2J9QA 3E32A 2V5QC 1BI8B 2JABA 5KJMA 2R03A 3LYAA 1UJJA 5BUZA 1TNBA 2P9NG 3CGHA 4EBAA 1TNYA 5CBOA 3ASNE 5KNGA 2G46A 2WM9A 3MCXA 2MRIA 4Z4PA 5ANLA 3G2TA 1H2UA 2WXQA 1V55E 2F8YA 1E8ZA 4CDNA 4AY6A 2J08A 3JCKC 3LJ3A 3Q9UC 3SFXA 4FMUA 4DRXE 1YYHA 5TTFA 4MS6A 2LXMA 4GCNA 4TXRA 3TG4A 3I3NA 3TXMA 3AU5A 5JHBA 2IJGX 2WB2A 1PY1A 3FTYA 1SZ9A 2NC9A 1Z3YA 1MYOA 2AVPA 2RFMA 5F59A 1WG0A 2CFZA 1S64A 3CVWA 3DALA 2WXKA 4HNAD 2AXUA 3RRUA 1U3CA 3JXJA 4B94A 4DX5D 2OCCE 1HU3A 1DVPA 3Q73A 4UWHA 3VV0A 3M57A 1JCRA 4HBDA 4HRLA 4C1QA 4Y6CA 3HHMA 2LSVA 2ZIRA 4J7FA 4XIFA 1YMPA 3NZSA 2XPZA 1IQUA 3BUAA 1N4SA 1UW4B 5JJ7A 2I6HA 2YINA 4UWLA 3AS5A 2F8XK 3HDXA 2X6IA 2L9BA 3LY9A 1SW6A 3OOIA 4LDGA 3L17A 2R3AA 4UI9J 2A4ZA 4U07A 4LEUA 2XENA 4HVBA 3FUDA 3ZN3A 3ZYLA 3D9PA 5EG2A 3V30A 1NI1A 5KWDA 4GA1A 4CYMD 4IN3B 2ETBA 5ENRD 5D2MC 4RG6A 1KT0A 3LDZA 1NP7A 3RK6A 2PM7A 5BNWA 5LSZA 2GRMA 5CMYA 4HRMB 3ZVVA 2WXFA 4N3BA 3N71A 1KLXA 4PH4B 5AYFA 4KBQA 5AQBA 5AYWD 5CPRB 4AV7A 4J8FA 3Q5MA 3MYVA 4GA0A 4U8HA 3CK7A 4G8LA 2QC9A 3UQ3A 3W9FA 2KC7A 2LAHA 5B1AE 3RSEG 5JHNA 4DX2A 3SY2A 4XKBA 3UPVA 5ARGA 3FPDA 1NZNA 2HO1A 2IOSA 2NXPA 3F9WA 3AG2E 4APOA 1P5QA 3SHFA 3ONKA 4G26A 3O4ZA 1JUQA 3U64A 3LKUA 4JPSA 4BETA 3DXKG 4KVMA 3QAQA 5CMWA 4AEZC 4MI5A 3VUZA 5KJLA 1HFAA 4UUCA 3FTWA 3M5AA 4ZHBA 2P9PG 1Y8MA 3QKYA 5EIDA 3EHRA 3E4BA 3QB2A 5G04J 1Q2ZA 3RIBA 2W5ZA 1E8YA 1TJFA 4QENA 4BX8A 3S8PA 3TL5A 1N3JA 3GZ2A 3ZXPA 3M55A 3PUKA 3ZW3A 2CHXA 5JA4D 3IXEA 3JUIA 3RAUA 1MX2A 2QYJA 3B7RL 2PL2A 4RVBA 2VTBA 4W9RA 5F6LA 4AIFA 3UKRG 2L0TB 2OV8A 2GRLA 2IOLA 3UXGA 4MLPA 3L82A 3OTNA 2QZAA 4J83A 4GTSA 5B3SE 2VYIA 1MUFA 3EIQC 4H7YA 5HKPA 4EHMA 5FWQA 3SF4A 2WQHA 4FULA 2KZTB 3K9IA 2C0MA 2J09A 2Y1LE 4I2ZA 5F6KC 2OVBA 3ESKA 4PS3A 4GMLA 1OCCE 3ULQA 2WXNA 2IQCA 4BESA 5FQ8A 4TV3A 1W3BA 3UM3A 3CQGB 3VTYA 4ABNA 5EX0A 1JPLA 4JZYA 2BKKB 3M58A 3CBPA 3Q9NC 5AN8A 2GRRB 4AM9A 3FULA 2XEHA 5CHEE 4YPEA 3BEEA 5CRVA 3C72A 4JHJA 4BT8A 1QBQA 4I43A 1H2TC 1B89A 5C2YA 4FP7A 2AXVA 2P9LG 3AU4A 1OUVA 4KYOB 2RD0A 3FUHA 4KMOA 3PUJA 3ZIMA 2PZIA 2B6CA 4XKCA 4D10C 1OCRE 2CFUA 2DCPA 1Z5SC 2I2OA 4C0EA 1TYQG 3CVLA 3QWWA 2AXZA 5ENQD 5CERB 1TJCA 3FTZA 4JD2G 3L6AA 5T8IA 3I5PA 4O6FA 5BV0A 3QWPA 1OT8A 2DZNA 3QJZA 3SBTB 3T8MA 2VGEA 3D9JA 3FHEA 2OVFA 4HOTA 3OS5A 1A17A 4K0RA 2VJ8A 1E7UA 2X6HA 4YNPA 4L7TA 1OCZE 3MKQA 2LAIA 4DLQA 2PQNA 4GA2A 1HO8A 5A6CA 3ZU7B 3CKCA 4L2LA 5ENNA 2I1JA 3CBOA 4ANWA 2MHKA 1FT1A 4ACLA 5CEDB 1N4RA 3ISMC 4ANUA 4GTMA 3PNTB 4H12A 3JQ0A 4GTQA 4JVSA 3U66A 2KCVA 2V5FA 1RW2A 1LTXA 3DSXA 2DVWA 3OXGA 4N3CA 1E8XA 3FTXA 2XS1A 3B7UX 4HI8A 4GZ6A 3FUEA 4JXTA 4U0SA 4A3VA 1O1RA 3G2WA 5JMND 5JIYA 3TJPA 3T8KA 1O1SA 3S2AA 5D0QD 2OEWA 5FZSA 3Q75A 2J07A 1DCEA 5LFAA 3FUMA 4TXQA 2KM4A 1TEZA 1FCHA 4XZ4A 2YHCA 3IV0A 3F9ZA 4QQIA 1PAQA 3J5QB 5T4YA 3UIOC 3M56A 3APCA 4PUCA 2R05A 1OWPA 2GW1A 1MVHA 1H6KA 1BU9A 4LUNU 3CK9A 4GMJA 4TUMA 5TH7A 2WVIA 3IHXA 3CV0A 5TEGA 1OY3D 4G24A 2EIME 1TNOA 1A5EA 2UWJG 4NACA 3SGHA 5LP0A 4J8YA 5DIZA 3KAEA 3FUFA 4Q94A 4AOFA 1HH8A 5LCWC 1N95A 3NOGD 3FTUA 3U4TA 1IHBA 1NA0A 4K5AB 5EKQD 1K3ZD 1N0QA 5EDSA 1S0PA 2ETAA 1MQSA 3CHQA 5E75A 3CVXA 3HYMB 4CGWA 2WXOA 4UWFA 3TWQA 2RKKA 4Q96A 2H6HA 4LNUD 3CVPA 1KZOA 4U0ZA 4N5CA 1MHQA 2VGXB 3BQOA 3FUKA 5G55A 3RU0A 3SFZA 3DWLG 3ENEA 4CEMA 4GB9A 1BI7B 1H6PA 4GU5A 3RKVA 4DI4A 4URKA 3D9LA 3KS2A 1LD7A 1HG5A 3C3RA 5BW8C 3SD5A 1EPUA 2L6BA 1IYGA 2EIKE 3JYSA 3ULYA 3HIZA 2KCKA 3DSSA 3ZGQA 3KSLA 4B0ZA 4CDMA 1YCSB 5CBNA 2UY1B 3L13A 1PEGA 3EHNA 1QQEA 3WG7E 4R7LA 5KJKA 3I4GA 3LXUX 2B0OE 3QARA 1LF8A 3V79K 4ZFHA 4J6IA 3RRNB 4A1SA 4WNGA 1HZ4A 2WMOA 2LNIA 3Q79A 3V2XA 4UQZA 4BFRA 1N6AA 2CG3A 2YQ8A 4I1MA 3LY8A 3DXMG 1AWCB 1N9AA 2Y3AA 4JB8P 3G2UA 1ELWA 3GYZA 4HXIA 4E47A 3PZ2A 3KD7A 3IEGA 3PZDA 2FO7A 3MO5A 3Q78A 4H7XA 1ELRA 3KMTA 3FP3A 2XZTG 4FADA 4JC8A 1HXIA
chains in the Genus database with same CATH topology
2VTBA 2J4BA 4I1AA 4RG9A 4MRUA 2R17C 2X6JA 4W9RA 2DIWA 4HOSA 2CG2A 4GZCA 5F6LA 4AIFA 3M54A 4NVQA 4YPUA 3CKBA 2L0TB 2BUGA 2OV8A 2GRLA 2IOLA 3RAYA 4NQ0A 4MLPA 2WMNA 3AS8A 2XCCA 3R7QA 2C0LA 3OTNA 5A7DB 3QWVA 4J83A 2IF4A 3CHSA 2VYIA 1IQRA 3D9NA 2YNQA 3FU6A 1MUFA 3EIQC 5DBKA 3QOUA 3CVNA 3TG5A 1WY6A 4H7YA 5FWQA 3B7SA 2WQHA 4FULA 4KZ0A 4UI9C 3SF4A 4YVOA 2X6KA 3PE4A 2KZTB 3K9IA 3P2BA 2C0MA 2J09A 2J49A 3CSFA 4JA7A 4I2ZA 2OVBA 4WUYA 2JLBA 4WAFA 3UT8A 4F7AA 3ESKA 4RZ0A 3CLJA 3S7DA 2FEZA 5KCMA 4IYPA 4I9CA 3RRMB 2V8SE 1WM5A 1UN8A 4GZDA 2AW6A 4HOUA 4PS3A 3ZFWA 4C0MA 4XE0A 4GMLA 3ULQA 1UJKA 4ME2A 3ML9A 2Y4TA 1WAO1 2WXNA 2FBNA 4NJ5A 2KCLA 2X6FA 4EZLA 2CHWA 1ZBPA 2IQCA 2Q7FA 3CHMA 3FUIA 3ONLA 4IULA 4AY5A 3IKOB 3MEKA 4U0UA 3FH5A 4TV3A 5FQ8A 1W3BA 3K5KA 3CQGB 3VTYA 4ABNA 4LCTA 3B7TA 5EX0A 1HX8A 1JPLA 4EZKA 2XEVA 5C1DA 3PEVB 4IRUA 4JZYA 4BUPA 3M58A 4N2SA 4Q69A 3RO3A 4E85A 4I9EA 3CBPA 2YHEA 4U04A 1BPOA 4AM9A 3FULA 2VGYA 5CHEE 3CVYA 4G1TA 2V4LA 4YPEA 2WQ6A 5AJLA 1E90A 3BEEA 3Q4AB 3F9YA 3GZ1A 4BT9A 4KXKB 4JHJA 4F53A 2E0IA 3S7BA 4BT8A 2C2LA 5FTPA 4CT0A 4FJYA 3CQCB 1EDUA 4I43A 1H2TC 1SQMA 3M53A 1B89A 1U3DA 5C2YA 2XRYA 4PDXA 4FP7A 2AXVA 3ASFA 5KJNA 1H19A 2XGMA 4FLHA 3KMJA 4BTBA 2VTBB 2X38A 3L08A 4JDSA 2VQ2A 3AU4A 3LY7A 5BPPA 4IJDA 2R5SA 2OOEA 3CIAA 3ZYQA 4CRWA 1OUVA 5FJYA 4FHJA 2FI7A 4KYOB 5AJDA 2FULA 2RD0A 3FUHA 4KMOA 3PUJA 5AIJA 3FDHA 3VLDA 3ZIMA 5LCWJ 2O8JA 3M59A 4IJ8A 2PZIA 3F9XA 4XKCA 5FZQA 4D10C 4DK5A 2RFIA 1MT6A 5G05C 4ACKA 2CFUA 4L1BA 2L6JA 2DCPA 3CBMA 2I1KA 3UMVA 2I2OA 5FQ7A 2WXLA 5JINA 4GZ3A 2R59A 4C0EA 3CEQA 3CVLA 3RQ4A 3QWWA 4A1GA 3Q15A 4OVUA 4M3OA 2AXZA 4LRZA 3SW9A 3D9KA 5LSXA 3NZUA 2IU1A 1TJCA 3FTZA 4YNDA 2WXGA 4PS7A 3D9IA 1OWMA 4I1OB 4JW1A 3L6AA 3LPZA 4MKTA 3KEZA 5T8IA 2VSNA 3I5PA 3ML8A 4O6FA 4TUUA 5F6KC 4NRHB 4A55A 4WWOA 3NQPA 4J7IA 5BV0A 2RG8A 3EJNA 3QWPA 4GYYA 4HOQA 3BO5A 3MZLB 4QEOA 1HF8A 3RJWA 4I6GA 3CHPA 3QJZA 3UT4A 4HORA 4ANVA 4WNEA 4J8EA 3LVRE 3SBTB 5G04C 4FU3A 3T8MA 4J0UA 4F3VA 4HS2A 3D3MA 4NURA 5CCMA 3HVEA 4YPAA 1OWLA 3ZYKA 3BG0B 2WPVA 3B13A 3D9JA 3T5XA 3EDTB 3QDNA 3FHEA 3QK0A 1DNPA 4HLEA 5T0KA 2PM6A 3FUNA 2OVFA 4HOTA 2IONA 3S7JA 3OS5A 1N6CA 5EX3A 1A17A 4K0RA 4G2VA 3OXFA 3FFLA 2VJ8A 1E7UA 2X6HA 4YNPA 4L7TA 3ZHEA 3QNKA 4KZCA 1H0AA 3MKQA 3RJVA 2LAIA 4AJWA 4DLQA 3Q49B 2PQNA 3ESLA 4KVOA 4APFA 4F1SA 5HQ8A 4EBAG 4BTAA 1XNFA 4GA2A 1HO8A 3L16A 5A6CA 3L22A 1MVXA 2J9QA 2X3MA 4C9BB 3I4RB 3MO2A 3CKCA 4L2LA 4ILHB 4JHRA 3ZPJA 5KJMA 5ENNA 2I1JA 3CBOA 5ARFA 1E96B 3TXNA 4ANWA 4DPRA 3LYAA 5LX8A 2BF0X 1UJJA 2MHKA 4OYSA 5HI7A 5BUZA 2WXIA 4JHKA 5FT9A 3CGHA 3GZSA 2V0PA 2LSUA 3DPDA 3D9OA 3FUJA 4ACLA 2VSOE 4ILGA 4EBAA 1IHGA 2QFCA 4AVXA 4ANUA 2G46A 3FH8A 4GAAA 3PNTB 4H12A 2XGSA 2WM9A 3FEXA 3JQ0A 4AU7A 2XPIA 3PDNA 1E8WA 3MCXA 4JVSA 3U66A 1X5BA 2KCVA 2MRIA 2V5FA 3LCAA 4J8SA 5ANLA 4BSXA 4CDRA 4Z4PA 3G2TA 1UG3A 1GW6A 3OXGA 4K03A 4N3CA 4N3AA 1E8XA 2I9CA 3FTXA 3AS4A 4UI9K 3B7UX 1H2UA 4BY6A 4EPZA 1YA0A 4GZ6A 2WXQA 4LERA 3FUEA 1Z3XA 4JXTA 3LS8A 4GYWA 1E8ZA 4U0SA 3FEYA 4A3VA 4CDNA 1FVFA 4AXHA 4AY6A 3ASDA 2J08A 2J4DA 5LOZA 3JCKC 1N52A 3G2WA 1VDYA 3LJ3A 2ONDA 4FMUA 2WXRA 3UX4A 5JIYA 1HS6A 2XCBA 4FLBA 5TTFA 3TJPA 3PNLB 3HVEB 5F5EA 3U3WA 4ILIA 4MS6A 4MI0A 4GCNA 4DI3A 3URZA 1NA3A 3CVVA 3S2AA 4JL0A 5D0QD 3APDA 5FZSA 3TG4A 3I3NA 3TXMA 3ZHEB 3T5VA 3AU5A 2J07A 3MKQB 5JHBA 1E7VA 2IJGX 3FUMA 5D0OD 5LFAA 1TEZA 2KM4A 2WB2A 1FCHA 1PY1A 4XZ4A 1H2VC 3EIJA 2YHCA 3FTYA 1SZ9A 2NC9A 1Z3YA 3IV0A 2AVPA 4B8CB 4CCAA 1PAQA 1ZKKA 3F9ZA 5F59A 5T4YA 3M56A 3APCA 4PUCA 1XQHA 1OWPA 2CFZA 5J08A 3CVWA 3EHMA 2GW1A 4EZJA 1MVHA 1H6KA 3DALA 4JA9A 2CHZA 3GW4A 4LUNU 3CK9A 4L2YA 2VGXA 4B8AA 2WXKA 3TGOA 4GMJA 5TH7A 2WXHA 2WVIA 3IHXA 3CV0A 5TEGA 2AXUA 4G24A 3SNXA 3RRUA 1U3CA 1PC2A 3HNAA 5T5GA 4DJAA 2UWJG 3MGBA 4NACA 3SGHA 4B94A 2PQRA 3WXXA 5LP0A 4YVQC 5BT1A 1HU3A 2NSZA 1DVPA 1JWGA 3FTSA 5DIZA 3VTXA 3FU3A 3LEWA 4UWHA 3KAEA 4KT6B 3FUFA 4Q94A 3VV0A 3M57A 4AOFA 3ZRHA 1HH8A 5LCWC 4C1QA 3FTUA 4Y6CA 3U4TA 3HHMA 3MKRA 3QC1A 2LSVA 3APFA 3SBSA 3ZEFA 4I6EA 1NA0A 4J7FA 4YNMA 1QNFA 2M63A 5EKQD 3SWCA 4XIFA 2DBAA 4EECA 5JJ0A 3ZYMA 5EDSA 3NZSA 1S0PA 4N39A 4FA6A 2KATA 5BV1A 4QEPA 4FJZA 2XPZA 1IQUA 1H3IA 1MQSA 1L5JA 3CHQA 3JQ1A 3OPEA 4UWKA 5E75A 3UUXA 1UW4B 3IHVA 5JJ7A 2VSYA 2BQZA 4I51A 2I6HA 5JJ6A 2YINA 3CVXA 3HYMB 4UWLA 4CGWA 1ZU2A 3CVUA 3AS5A 3G2VA 3HDXA 2X6IA 2XGOA 2L9BA 2WXOA 2AWIA 3LY9A 2IFUA 4UWFA 3EP0A 4XI9A 5FQ4A 3OOIA 4LDGA 3L17A 2WXMA 2R3AA 3IHYA 4UI9J 2A4ZA 3PRZA 4U07A 4LEUA 4Q96A 3MA5A 4U63A 4HVBA 3FUDA 3ZN3A 2F69A 1O9SA 1JWFA 2UY1A 3ZYLA 3D9PA 3R7RA 5EG2A 3CVPA 2JEKA 5E76A 1EYHA 4GA1A 4IN3B 4U0ZA 1EF1C 4WWPA 2W5YA 4I2WA 4N5CA 1MHQA 4RG6A 4GPKA 1INZA 2BTDA 2FF4A 2VGXB 1KT0A 3O48A 1UN9A 3LDZA 1NP7A 3PREA 4G25A 3RK6A 1Y6IA 3FUKA 2PM7A 5G55A 5M72A 5BNWA 3RU0A 5LSZA 4FHKA 3SFZA 5J90A 4P29A 3CK8A 4A3TA 3ENEA 4CEMA 2GRMA 3FH7A 5CMYA 3S7FA 4FC8A 4Y6WA 4GB9A 5FQ6A 3ZXSA 5FZRA 3ZVVA 2WXFA 4EQFA 3P1UA 4N3BA 3N71A 4GU5A 1KLXA 4JEUA 4QFVA 3RKVA 3TAXA 4JLGA 4DI4A 3SZ7A 4URKA 4CGVA 3RO2A 4G23A 2HR2A 4PH4B 4RSYA 2WXJA 4UQXA 5AYFA 4KBQA 3D9LA 3KS2A 5AYWD 5CPRB 3D9MA 4AV7A 1HG5A 4GCOA 5ANRA 5BW8C 4J8FA 1XGWA 3G2SA 3KMAA 3Q5MA 1SZAA 3MYVA 5AENA 4GA0A 4U8HA 3CHOA 3SD5A 1ML9A 3CK7A 2VSXE 4CT4A 1EPUA 3NF1A 3PE3A 1IYGA 3JYSA 4WNFA 4E6HA 4AP2A 2XPYA 3UQ3A 3HIZA 2KC7A 2LAHA 4PS8A 3VLEA 5JHNA 3PH0C 3ASHA 4XKBA 3UPVA 5ARGA 2XHEA 3FPDA 1NZNA 3BG1B 2HO1A 4JEHA 2IOSA 5G2NA 3L54A 5T0MA 1OWNA 2NXPA 3F9WA 2KCKA 2GGFA 4APOA 2WQ7A 5G05J 1P5QA 3ZGQA 3SHFA 4V3IA 3ONKA 3CHRA 4WNDA 4G26A 3U9WA 1HG2A 4B0ZA 1KT1A 3O4ZA 4CDMA 3UT7A 3MO0A 2HYZA 3LVQE 2L0IA 4O30A 2UY1B 4XX5A 2ZU6B 3L13A 1JUQA 2P58C 3MX3A 3Q47B 4XI0A 3LKUA 1OWOA 3U64A 4JPSA 4I6JA 1PEGA 3C98A 1Z6TA 3EHNA 1QZ2A 3FY4A 1QQEA 4KVMA 3QAQA 4HFGA 5CMWA 5CCLA 4R7LA 4AEZC 4DLOA 3ASGA 4MI5A 4L23A 5KJLA 3VUZA 4ATGA 5KJKA 3SI5A 1HFAA 3CVQA 1FVHA 3I4GA 2KZTA 3LXUX 3DB5A 3FTWA 3FU5A 3M5AA 5JJTA 1N54A 3QARA 4UWGA 1LF8A 4G11A 3OAWA 1Y8MA 3OXLA 4BX9A 3MV3B 3QKYA 4J6IA 3R9AB 3RRNB 4A1SA 4WNGA 3MV2B 3E4BA 3QB2A 5G04J 1ELKA 2LO6A 1HZ4A 2WMOA 2LNIA 3PS6A 4N2QA 3RIBA 2MOWA 2W5ZA 1E8YA 4OVVA 3MJWA 1TJFA 4B89A 4QENA 4WWNA 4UQZA 4BX8A 4BFRA 2QPWA 3S8PA 1N6AA 2Y4UA 2CG3A 2YQ8A 4I1MA 3TL5A 1N3JA 4UQYA 3LY8A 5JHAA 2A5UA 1HE8A 4J8DA 3GZ2A 4GYOA 2ILRA 3M55A 2Y3AA 3PUKA 3G2UA 3ZW3A 1ELWA 2CHXA 3GYZA 4I17A 4TRQA 2XQ0A 2EQXA 4GZ5A 2E2EA 4HXIA 5A23A 4E47A 4ANXA 2HM8A 2XRZA 3KD7A 3VLFA 3IEGA 2IGQA 2JV0A 2QY7A 3PZDA 2FO7A 3IBEA 3JUIA 3MO5A 3DBSA 3FU0A 4H7XA 1ELRA 2WXPA 3PEUB 3KMTA 5T3RA 3FP3A 4BWRA 3CSTA 4FADA 3B7RL 2PL2A 3PVLA 4JC8A 4J8OA 1HXIA 3FWVA 4RVBA 3FTVA 3CR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I1A A;  4RG9 A;  4W9R A;  4HOS A;  5F6L A;  4AIF A;  3M54 A;  4NVQ A;  4YPU A;  3CKB A;  2BUG A;  3RAY A;  4NQ0 A;  3AS8 A;  2XCC A;  2C0L A;  5A7D B;  3QWV A;  4J83 A;  2IF4 A;  2VYI A;  1MUF A;  5DBK A;  3QOU A;  3CVN A;  3TG5 A;  4H7Y A;  3SF4 A;  2WQH A;  4UI9 C;  4YVO A;  3PE4 A;  3K9I A;  2C0M A;  4I2Z A;  4WUY A;  4JA7 A;  5F6K C;  4RZ0 A;  2JLB A;  3ESK A;  3S7D A;  2FEZ A;  4I9C A;  1WM5 A;  4HOU A;  3ZFW A;  3ULQ A;  4ME2 A;  4NJ5 A;  2Y4T A;  1WAO 1;  2FBN A;  2KCL A;  4AY5 A;  1ZBP A;  2Q7F A;  4U0U A;  3MEK A;  1W3B A;  3K5K A;  3VTY A;  4ABN A;  5EX0 A;  5C1D A;  2XEV A;  4BUP A;  3M58 A;  4N2S A;  3RO3 A;  4I9E A;  3CBP A;  4U04 A;  4AM9 A;  2VGY A;  5CHE E;  4G1T A;  4YPE A;  3Q4A B;  3BEE A;  3F9Y A;  3GZ1 A;  4BT9 A;  4KXK B;  4BT8 A;  3S7B A;  2C2L A;  5FTP A;  3M53 A;  1B89 A;  3ASF A;  5KJN A;  2XGM A;  3KMJ A;  4BTB A;  4JDS A;  2VQ2 A;  3LY7 A;  4IJD A;  2R5S A;  2OOE A;  1OUV A;  5FJY A;  2FI7 A;  4KYO B;  2O8J A;  5LCW J;  3M59 A;  4IJ8 A;  2PZI A;  3F9X A;  5FZQ A;  2RFI A;  1MT6 A;  5G05 C;  2L6J A;  3CBM A;  5JIN A;  4GZ3 A;  3CEQ A;  3CVL A;  3RQ4 A;  3QWW A;  3Q15 A;  3SW9 A;  5LSX A;  1TJC A;  4YND A;  3LPZ A;  2VSN A;  4O6F A;  4NRH B;  4J7I A;  4HOQ A;  3QWP A;  4GYY A;  3BO5 A;  4QEO A;  3RJW A;  4HOR A;  4WNE A;  4J8E A;  5G04 C;  4J0U A;  4F3V A;  5CCM A;  4YPA A;  2WPV A;  3EDT B;  3QDN A;  5T0K A;  4HOT A;  3S7J A;  3OS5 A;  1N6C A;  5EX3 A;  1A17 A;  4G2V A;  3OXF A;  3FFL A;  4YNP A;  3ZHE A;  3RJV A;  3Q49 B;  2PQN A;  5HQ8 A;  4BTA A;  1XNF A;  4GA2 A;  5A6C A;  1MVX A;  2J9Q A;  3MO2 A;  3CKC A;  4JHR A;  3ZPJ A;  5KJM A;  3CBO A;  5ARF A;  1E96 B;  3LYA A;  2MHK A;  5HI7 A;  5FT9 A;  2LSU A;  1IHG A;  2QFC A;  2G46 A;  4H12 A;  2XGS A;  4AU7 A;  2XPI A;  3PDN A;  2KCV A;  2V5F A;  4Z4P A;  3LCA A;  4CDR A;  3OXG A;  4N3C A;  4N3A A;  3AS4 A;  4UI9 K;  1YA0 A;  4GZ6 A;  4GYW A;  4U0S A;  4AY6 A;  3ASD A;  2OND A;  4FMU A;  5JIY A;  2XCB A;  5TTF A;  5F5E A;  3U3W A;  4MI0 A;  4GCN A;  3URZ A;  1NA3 A;  4JL0 A;  5D0Q D;  5FZS A;  3TG4 A;  3ZHE B;  5D0O D;  1FCH A;  2YHC A;  3F9Z A;  2NC9 A;  1ZKK A;  2AVP A;  5F59 A;  3M56 A;  1XQH A;  2GW1 A;  1MVH A;  3DAL A;  4JA9 A;  3GW4 A;  3CK9 A;  2VGX A;  3TGO A;  5TH7 A;  3IHX A;  3CV0 A;  5TEG A;  4G24 A;  1PC2 A;  3HNA A;  5T5G A;  2UWJ G;  4B94 A;  2PQR A;  3WXX A;  4YVQ C;  5BT1 A;  5DIZ A;  3VTX A;  3KAE A;  3VV0 A;  3M57 A;  1HH8 A;  5LCW C;  4C1Q A;  4Y6C A;  3U4T A;  3MKR A;  2LSV A;  1NA0 A;  4J7F A;  4YNM A;  5EKQ D;  3SWC A;  4XIF A;  2DBA A;  5JJ0 A;  4N39 A;  2KAT A;  4QEP A;  3OPE A;  1H3I A;  3UUX A;  5JJ7 A;  2VSY A;  2BQZ A;  4I51 A;  2I6H A;  5JJ6 A;  3HYM B;  4CGW A;  1ZU2 A;  3AS5 A;  2XGO A;  3LY9 A;  2IFU A;  3EP0 A;  4XI9 A;  3OOI A;  4LDG A;  2R3A A;  4UI9 J;  4U07 A;  4LEU A;  3MA5 A;  2F69 A;  3ZN3 A;  1O9S A;  2UY1 A;  5EG2 A;  3CVP A;  4GA1 A;  4IN3 B;  4U0Z A;  2W5Y A;  4I2W A;  4N5C A;  4RG6 A;  4GPK A;  2FF4 A;  2VGX B;  3O48 A;  1KT0 A;  4G25 A;  5M72 A;  5BNW A;  3RU0 A;  5LSZ A;  3CK8 A;  3S7F A;  4Y6W A;  5FZR A;  4EQF A;  4N3B A;  3N71 A;  1KLX A;  3RKV A;  3TAX A;  4JLG A;  3SZ7 A;  4CGV A;  3RO2 A;  4G23 A;  2HR2 A;  4UQX A;  5AYF A;  4KBQ A;  3KS2 A;  5AYW D;  5CPR B;  4GCO A;  5BW8 C;  4J8F A;  3KMA A;  3Q5M A;  4GA0 A;  1ML9 A;  3CK7 A;  3NF1 A;  3PE3 A;  1IYG A;  3JYS A;  4WNF A;  3UQ3 A;  2KC7 A;  5JHN A;  3ASH A;  3UPV A;  5ARG A;  3FPD A;  1NZN A;  5T0M A;  2HO1 A;  3F9W A;  2KCK A;  4APO A;  5G05 J;  1P5Q A;  3ZGQ A;  4WND A;  4G26 A;  1KT1 A;  3MO0 A;  2HYZ A;  4O30 A;  2UY1 B;  2P58 C;  3Q47 B;  4XI0 A;  3LKU A;  1PEG A;  1QZ2 A;  1QQE A;  5CCL A;  4MI5 A;  3ASG A;  3VUZ A;  5KJL A;  5KJK A;  3DB5 A;  3CVQ A;  3M5A A;  5JJT A;  1Y8M A;  3OXL A;  3MV3 B;  3QKY A;  3R9A B;  4A1S A;  4WNG A;  3MV2 B;  3E4B A;  5G04 J;  1HZ4 A;  2LNI A;  4N2Q A;  3RIB A;  2W5Z A;  4QEN A;  4UQZ A;  2QPW A;  3S8P A;  1N6A A;  2Y4U A;  2YQ8 A;  1N3J A;  4UQY A;  3LY8 A;  4J8D A;  3GZ2 A;  4GYO A;  3M55 A;  1ELW A;  3GYZ A;  4I17 A;  4GZ5 A;  2E2E A;  4E47 A;  3KD7 A;  3IEG A;  2IGQ A;  2JV0 A;  2FO7 A;  3MO5 A;  4H7X A;  1ELR A;  3KMT A;  3FP3 A;  4BWR A;  2PL2 A;  4J8O A;  1HXI A;  3FWV A; 
#chains in the Genus database with same CATH topology
 2DIW A;  4GZC A;  3LJN A;  5EIL A;  2BUG A;  3RAY A;  4NQ0 A;  3R7Q A;  2C0L A;  3AG1 E;  2IF4 A;  5D66 A;  3CHS A;  3NAW A;  2YNQ A;  5DBK A;  3TG5 A;  1BLX B;  4KZ0 A;  4UI9 C;  4CZ2 D;  4YVO A;  1S63 A;  2X6K A;  2J49 A;  3CSF A;  4WAF A;  4WUY A;  5ENT D;  4JA7 A;  3UT8 A;  2JLB A;  4GTV A;  3S7D A;  4GZD A;  3PZ1 A;  4U96 D;  2AW6 A;  3ZFW A;  4C0M A;  4XE0 A;  2FBN A;  3AG4 E;  4EZL A;  4AY5 A;  3CHM A;  3IKO B;  5FIN A;  4LCT A;  3B7T A;  5BXU A;  1HX8 A;  4EZK A;  4IRU A;  4N2S A;  4Q69 A;  5ENS D;  4E85 A;  4I9E A;  4U04 A;  3JXI A;  4G1T A;  2V4L A;  4LSZ E;  1E90 A;  3GZ1 A;  5FTP A;  4CT0 A;  4BER A;  1U3D A;  2XRY A;  3ASF A;  5KJN A;  3TWV A;  4DUI A;  4BTB A;  2X38 A;  1N11 A;  5BPP A;  4IJD A;  2R5S A;  2OOE A;  4CRW A;  5AJD A;  1IKN D;  3V31 A;  5AIJ A;  3M59 A;  4IJ8 A;  3DEO A;  3F9X A;  5FZQ A;  4L1B A;  2L6J A;  2WXL A;  5JIN A;  2R59 A;  5H7P A;  3CEQ A;  4A1G A;  3Q15 A;  2H6I A;  4K5C A;  3SW9 A;  4YND A;  2WXG A;  4I1O B;  3J5P A;  1TR4 A;  4MKT A;  3KEZ A;  4NRH B;  1WDY A;  3NQP A;  3RJW A;  3CHP A;  3UT4 A;  4J8E A;  3LVR E;  5G04 C;  4J0U A;  4F3V A;  1TNU A;  3T5X A;  3QDN A;  4HLE A;  1DNP A;  2PM6 A;  3FUN A;  2EIN E;  3OXF A;  3FFL A;  4KZC A;  3RJV A;  4LG6 A;  4TXP A;  4APF A;  4F1S A;  2DZO A;  4EBA G;  4BTA A;  3L22 A;  1MVX A;  4GTT A;  4DX7 D;  2X3M A;  3B7B A;  4C9B B;  3I4R B;  3ZPJ A;  1NFI E;  1NL4 A;  3TWT A;  3Q7A A;  5ARF A;  5LX8 A;  5HI7 A;  3V2O A;  5CEC B;  4JHK A;  4C48 B;  3ZUV B;  2OEV A;  3FUJ A;  1IHG A;  2QFC A;  5B1B E;  3FH8 A;  2XGS A;  3FEX A;  4AU7 A;  2AJA A;  3PDN A;  1X5B A;  4J8S A;  3LCA A;  4BSX A;  3D9H A;  1N4P A;  4K03 A;  4N3A A;  3ABM E;  2I9C A;  4UI9 K;  4BY6 A;  1YA0 A;  4LER A;  2LXL A;  3LS8 A;  3UKU G;  4AXH A;  1VDY A;  4RLY A;  3UX4 A;  4GTP A;  2A5E A;  2XCB A;  4FLB A;  3PNL B;  3HVE B;  5F5E A;  2IEJ A;  4ILI A;  4MI0 A;  3NOC D;  4DI3 A;  5EYP F;  3URZ A;  1NA3 A;  3CVV A;  4JL0 A;  1SA4 A;  3W9G A;  5AQ7 A;  3TWW A;  4HRN A;  3ZHE B;  5BXO A;  3T5V A;  5D0O D;  1N0R A;  4RQI A;  1H2V C;  1ZKK A;  5J08 A;  3EHM A;  4EZJ A;  4JA9 A;  3GW4 A;  4L2Y A;  3TGO A;  2WXH A;  2J8S D;  2IO3 C;  4DJA A;  2PQR A;  4NIK A;  3WXX A;  5BT1 A;  2NSZ A;  3FTS A;  1JWG A;  3SFY A;  3VTX A;  1JCS A;  4KT6 B;  1MX6 A;  1TNZ A;  3QC1 A;  3NB2 A;  3APF A;  3ZEF A;  4I6E A;  4YNM A;  1QNF A;  2DBA A;  4EEC A;  5JJ0 A;  3ZYM A;  4N39 A;  4FJZ A;  1H3I A;  1L5J A;  3JQ1 A;  3UUX A;  3IHV A;  2VSY A;  2BQZ A;  4I51 A;  1MJ0 A;  3G2V A;  3HXE A;  2AWI A;  2IFU A;  3EP0 A;  2WXM A;  3IHY A;  1OXJ A;  1QYM A;  4U63 A;  2F69 A;  1O9S A;  2PNN A;  4XEI G;  2JEK A;  5AAR A;  5E76 A;  1EF1 C;  4WWP A;  5FIO A;  2W5Y A;  4I2W A;  4GPK A;  2QYU A;  1INZ A;  2FF4 A;  3O48 A;  1UN9 A;  3HXB A;  5M72 A;  1Y6I A;  1AP7 A;  3DST A;  4FHK A;  5HS0 A;  5J90 A;  4A3T A;  3FH7 A;  3S7F A;  4FC8 A;  1O5M A;  3ABK E;  2H6F A;  4JEU A;  3TAX A;  4JLG A;  3SZ7 A;  4G23 A;  2HR2 A;  4UQX A;  1U2V G;  2IY0 C;  3D9M A;  4GCO A;  2R02 A;  4U7E B;  5ANR A;  4U8Y D;  1XGW A;  1ML9 A;  4CT4 A;  3NF1 A;  1MX4 A;  4WNF A;  4E6H A;  4AP2 A;  2XPY A;  3EHQ A;  1JCQ A;  2DWZ A;  1KPS B;  3PH0 C;  2XHE A;  3E33 A;  5G2N A;  3L54 A;  3JUE A;  2GGF A;  2WQ7 A;  4DX6 D;  5G05 J;  4WND A;  3U9W A;  1HG2 A;  2DYS E;  2H6G A;  3UT7 A;  4O30 A;  3MX3 A;  2P58 C;  3Q47 B;  4XI0 A;  3UM0 A;  1Z6T A;  1QZ2 A;  4HFG A;  4DLO A;  3ASG A;  3HXC A;  3TWX A;  3SI5 A;  3DB5 A;  2KZT A;  3R9M A;  5JJT A;  4UWG A;  3OAW A;  3OXL A;  2EIJ E;  3MV3 B;  3R9A B;  5EIB E;  3MV2 B;  1ELK A;  2LO6 A;  4N2Q A;  3MJW A;  4B89 A;  2QPW A;  2Y4U A;  5JHA A;  1HE8 A;  4J8D A;  2ILR A;  5HRY A;  4I17 A;  4TRQ A;  2XQ0 A;  2EQX A;  4GZ5 A;  2E2E A;  3AG3 E;  4ANX A;  2HM8 A;  2XRZ A;  3DEP A;  2JV0 A;  3IBE A;  1N4Q A;  3C3O A;  2KXP C;  3FU0 A;  3C3Q A;  5T3R A;  3CST A;  3PVL A;  4J8O A;  1K8K G;  3CR3 A;  2V4H C;  5KBA A;  2J4B A;  2X6J A;  1V54 E;  2CG2 A;  3AAA C;  2EIL E;  2WMN A;  3AS8 A;  3QWV A;  3D9N A;  3QOU A;  3CVN A;  2GRP B;  3PE4 A;  1TN6 A;  4F7A A;  2FEZ A;  5KCM A;  4I9C A;  3RRM B;  2V8S E;  1WM5 A;  1UN8 A;  4HOU A;  1ZB1 A;  2RFA A;  1UJK A;  4NJ5 A;  2Y4T A;  2KCL A;  2X6F A;  2CHW A;  1ZBP A;  3FUI A;  2Q7F A;  2ZIS A;  3ONL A;  2XS8 A;  4U0U A;  3FH5 A;  3K5K A;  1K1A A;  5C1D A;  3E37 A;  4BUP A;  4OAV B;  1BPO A;  2VGY A;  3CVY A;  5AJL A;  1MZC A;  3Q4A B;  3F9Y A;  3UI2 A;  4KXK B;  2E0I A;  5AAO A;  3UM1 A;  4FJY A;  3X2Q E;  4PDX A;  3TWU A;  1H19 A;  4HI9 A;  1K1B A;  1FT2 A;  2VTB B;  3E34 A;  4JDS A;  2F37 A;  5ENP D;  3LY7 A;  3CIA A;  2FI7 A;  2FUL A;  3C5R A;  1MT6 A;  2GRQ B;  4ACK A;  3CBM A;  2I1K A;  3KSQ A;  4GTO A;  5FQ7 A;  4GZ3 A;  3DSU A;  4OVU A;  4LRZ A;  4B93 B;  3D9K A;  4K5B A;  3D9I A;  4YDO A;  3ASO E;  4Z68 A;  3EU9 A;  2FO1 E;  2VSN A;  1DCQ A;  3DSW A;  4TUU A;  4WWO A;  4HOQ A;  3EJN A;  4GYY A;  3BO5 A;  3MZL B;  4ANV A;  1SA5 A;  4BEP A;  4WNE A;  4FU3 A;  4HS2 A;  4NUR A;  5CCM A;  4YPA A;  1OWL A;  3ZYK A;  3DSV A;  3EDT B;  2ION A;  2ZXW E;  5CEA A;  2P9S G;  3QNK A;  3Q49 B;  3ESL A;  5HQ8 A;  1D8D A;  3L16 A;  3ZKJ A;  2Y0B G;  3MO2 A;  4ILH B;  4JHR A;  2DYR E;  1E96 B;  3TXN A;  4DPR A;  2BF0 X;  4OYS A;  2WXI A;  5FT9 A;  3GZS A;  2V0P A;  2LSU A;  3DPD A;  3D9O A;  2VSO E;  4ILG A;  4AVX A;  3L9T A;  4GAA A;  5KNH D;  2XPI A;  1E8W A;  2HE0 A;  4CDR A;  2P9U G;  5AQA A;  1UG3 A;  1GW6 A;  4X8Q A;  3AS4 A;  4EPZ A;  2BED A;  1Z3X A;  4GYW A;  3NBN B;  3FEY A;  1FVF A;  3ASD A;  2J4D A;  5LOZ A;  1N52 A;  2P9K G;  2OND A;  2WXR A;  1HS6 A;  1H6O A;  3U3W A;  4GPM A;  3HG0 D;  4U95 D;  5ITZ F;  3E30 A;  3PZ4 A;  4N5Q A;  3TWS A;  3APD A;  3MKQ B;  1E7V A;  3EIJ A;  5ENO D;  4B8C B;  4CCA A;  1XQH A;  2CHZ A;  2VGX A;  4B8A A;  2ETC A;  3SNX A;  1PC2 A;  3HNA A;  5T5G A;  3MGB A;  4HB5 A;  4YVQ C;  2XEE A;  3FU3 A;  4F6R D;  3LEW A;  4A63 B;  4L9P A;  3ZRH A;  1BD8 A;  3MKR A;  3ULE G;  3SBS A;  5IY5 E;  2M63 A;  1S70 B;  3SWC A;  1TN8 A;  4FA6 A;  2KAT A;  5BV1 A;  4QEP A;  3OPE A;  4UWK A;  2P2C P;  5JJ6 A;  3CVU A;  1ZU2 A;  2IO2 C;  2XGO A;  4XI9 A;  5FQ4 A;  3PRZ A;  2BKG A;  3MA5 A;  1JWF A;  3UM2 A;  2UY1 A;  3R7R A;  5EN5 D;  1EYH A;  3HXD A;  2BTD A;  3PRE A;  3UIN C;  4G25 A;  4G8K A;  4BSZ B;  2ZGG A;  4P29 A;  3CK8 A;  4GTR A;  4Y6W A;  5FQ6 A;  3ZXS A;  5FZR A;  4EQF A;  3Q7F A;  3P1U A;  4QFV A;  4CGV A;  3RO2 A;  1X81 A;  4RSY A;  2WXJ A;  3UIP C;  4LNG A;  3SQV A;  3G2S A;  3KMA A;  1SZA A;  5AEN A;  3CHO A;  2VSX E;  3HRA A;  3PE3 A;  4ATZ D;  3VLE A;  4PS8 A;  2XZD G;  4OAU C;  1LD8 A;  3ASH A;  3BG1 B;  4JEH A;  4U8V D;  5T0M A;  1OWN A;  2KBX A;  4V3I A;  4HQD A;  3CHR A;  1KT1 A;  3MO0 A;  2HYZ A;  3LVQ E;  5AQ9 A;  2L0I A;  4XX5 A;  2ZU6 B;  4O1P A;  1OWO A;  4YDE A;  4I6J A;  3C98 A;  3FY4 A;  3SO8 A;  5CCL A;  4L23 A;  4LNB A;  4ATG A;  3CVQ A;  1FVH A;  3FU5 A;  3TWR A;  1N54 A;  1N94 A;  1O1T A;  4G11 A;  4BX9 A;  3PS6 A;  2GRN B;  2MOW A;  4OVV A;  4WWN A;  4HLL A;  4UQY A;  2A5U A;  4GYO A;  1TN7 A;  3F6Q A;  5A23 A;  2Y69 E;  3VLF A;  2IGQ A;  2QY7 A;  3DPY A;  3DBS A;  4YDY A;  3ABL E;  2WXP A;  3PEU B;  2LUH A;  4BWR A;  1OCO E;  3UTM A;  3FWV A;  3FTV A;  1KZP A;  2R2L A;  4I1A A;  4RG9 A;  4MRU A;  2R17 C;  4HOS A;  3M54 A;  4NVQ A;  4YPU A;  3CKB A;  2NYJ A;  4YDW A;  2XCC A;  5A7D B;  2GRO B;  1IQR A;  3KEA A;  3FU6 A;  1WY6 A;  3B7S A;  4J7W A;  1UOH A;  3P2B A;  4RZ0 A;  1FPP A;  3B95 A;  3CLJ A;  4IYP A;  1D8E A;  4M7C A;  1DC2 A;  4ME2 A;  3ML9 A;  1WAO 1;  3BU8 A;  4IUL A;  3MEK A;  4O1O A;  2F0Y A;  2XEV A;  3PEV B;  3T9K A;  3RO3 A;  2YHE A;  2ZGD A;  2WQ6 A;  1SVX A;  3ZNG A;  4BT9 A;  4F53 A;  3S7B A;  2C2L A;  3CQC B;  1EDU A;  1G3N B;  3M53 A;  1SQM A;  4O60 A;  4GMR A;  1D9S A;  5CRU A;  2XGM A;  4FLH A;  3KMJ A;  3L08 A;  2VQ2 A;  3DRA A;  3EUV A;  3ZYQ A;  5FJY A;  4FHJ A;  3FDH A;  3VLD A;  2O8J A;  5LCW J;  1RZ4 A;  2RFI A;  4DK5 A;  5G05 C;  3PZ3 A;  5EYL A;  3UMV A;  3EU5 A;  4F1P A;  3RQ4 A;  4M3O A;  5LSX A;  3NZU A;  2IU1 A;  4PS7 A;  1OWM A;  4JW1 A;  3LPZ A;  3ML8 A;  4A55 A;  4J7I A;  3AJI A;  2RG8 A;  2P9I G;  4QEO A;  1HF8 A;  4I6G A;  4HOR A;  3D3M A;  3HVE A;  4MBG A;  3BG0 B;  2WPV A;  3B13 A;  4DX1 A;  3QK0 A;  5T0K A;  3S7J A;  1N6C A;  5EX3 A;  4G2V A;  1IXV A;  2MYO A;  3ZHE A;  1H0A A;  4AJW A;  4KVO A;  3HXF A;  1XNF A;  2J9Q A;  3E32 A;  2V5Q C;  1BI8 B;  2JAB A;  5KJM A;  2R03 A;  3LYA A;  1UJJ A;  5BUZ A;  1TNB A;  2P9N G;  3CGH A;  4EBA A;  1TNY A;  5CBO A;  3ASN E;  5KNG A;  2G46 A;  2WM9 A;  3MCX A;  2MRI A;  4Z4P A;  5ANL A;  3G2T A;  1H2U A;  2WXQ A;  1V55 E;  2F8Y A;  1E8Z A;  4CDN A;  4AY6 A;  2J08 A;  3JCK C;  3LJ3 A;  3Q9U C;  3SFX A;  4FMU A;  4DRX E;  1YYH A;  5TTF A;  4MS6 A;  2LXM A;  4GCN A;  4TXR A;  3TG4 A;  3I3N A;  3TXM A;  3AU5 A;  5JHB A;  2IJG X;  2WB2 A;  1PY1 A;  3FTY A;  1SZ9 A;  2NC9 A;  1Z3Y A;  1MYO A;  2AVP A;  2RFM A;  5F59 A;  1WG0 A;  2CFZ A;  1S64 A;  3CVW A;  3DAL A;  2WXK A;  4HNA D;  2AXU A;  3RRU A;  1U3C A;  3JXJ A;  4B94 A;  4DX5 D;  2OCC E;  1HU3 A;  1DVP A;  3Q73 A;  4UWH A;  3VV0 A;  3M57 A;  1JCR A;  4HBD A;  4HRL A;  4C1Q A;  4Y6C A;  3HHM A;  2LSV A;  2ZIR A;  4J7F A;  4XIF A;  1YMP A;  3NZS A;  2XPZ A;  1IQU A;  3BUA A;  1N4S A;  1UW4 B;  5JJ7 A;  2I6H A;  2YIN A;  4UWL A;  3AS5 A;  2F8X K;  3HDX A;  2X6I A;  2L9B A;  3LY9 A;  1SW6 A;  3OOI A;  4LDG A;  3L17 A;  2R3A A;  4UI9 J;  2A4Z A;  4U07 A;  4LEU A;  2XEN A;  4HVB A;  3FUD A;  3ZN3 A;  3ZYL A;  3D9P A;  5EG2 A;  3V30 A;  1NI1 A;  5KWD A;  4GA1 A;  4CYM D;  4IN3 B;  2ETB A;  5ENR D;  5D2M C;  4RG6 A;  1KT0 A;  3LDZ A;  1NP7 A;  3RK6 A;  2PM7 A;  5BNW A;  5LSZ A;  2GRM A;  5CMY A;  4HRM B;  3ZVV A;  2WXF A;  4N3B A;  3N71 A;  1KLX A;  4PH4 B;  5AYF A;  4KBQ A;  5AQB A;  5AYW D;  5CPR B;  4AV7 A;  4J8F A;  3Q5M A;  3MYV A;  4GA0 A;  4U8H A;  3CK7 A;  4G8L A;  2QC9 A;  3UQ3 A;  3W9F A;  2KC7 A;  2LAH A;  5B1A E;  3RSE G;  5JHN A;  4DX2 A;  3SY2 A;  4XKB A;  3UPV A;  5ARG A;  3FPD A;  1NZN A;  2HO1 A;  2IOS A;  2NXP A;  3F9W A;  3AG2 E;  4APO A;  1P5Q A;  3SHF A;  3ONK A;  4G26 A;  3O4Z A;  1JUQ A;  3U64 A;  3LKU A;  4JPS A;  4BET A;  3DXK G;  4KVM A;  3QAQ A;  5CMW A;  4AEZ C;  4MI5 A;  3VUZ A;  5KJL A;  1HFA A;  4UUC A;  3FTW A;  3M5A A;  4ZHB A;  2P9P G;  1Y8M A;  3QKY A;  5EID A;  3EHR A;  3E4B A;  3QB2 A;  5G04 J;  1Q2Z A;  3RIB A;  2W5Z A;  1E8Y A;  1TJF A;  4QEN A;  4BX8 A;  3S8P A;  3TL5 A;  1N3J A;  3GZ2 A;  3ZXP A;  3M55 A;  3PUK A;  3ZW3 A;  2CHX A;  5JA4 D;  3IXE A;  3JUI A;  3RAU A;  1MX2 A;  2QYJ A;  3B7R L;  2PL2 A;  4RVB A;  2VTB A;  4W9R A;  5F6L A;  4AIF A;  3UKR G;  2L0T B;  2OV8 A;  2GRL A;  2IOL A;  3UXG A;  4MLP A;  3L82 A;  3OTN A;  2QZA A;  4J83 A;  4GTS A;  5B3S E;  2VYI A;  1MUF A;  3EIQ C;  4H7Y A;  5HKP A;  4EHM A;  5FWQ A;  3SF4 A;  2WQH A;  4FUL A;  2KZT B;  3K9I A;  2C0M A;  2J09 A;  2Y1L E;  4I2Z A;  5F6K C;  2OVB A;  3ESK A;  4PS3 A;  4GML A;  1OCC E;  3ULQ A;  2WXN A;  2IQC A;  4BES A;  5FQ8 A;  4TV3 A;  1W3B A;  3UM3 A;  3CQG B;  3VTY A;  4ABN A;  5EX0 A;  1JPL A;  4JZY A;  2BKK B;  3M58 A;  3CBP A;  3Q9N C;  5AN8 A;  2GRR B;  4AM9 A;  3FUL A;  2XEH A;  5CHE E;  4YPE A;  3BEE A;  5CRV A;  3C72 A;  4JHJ A;  4BT8 A;  1QBQ A;  4I43 A;  1H2T C;  1B89 A;  5C2Y A;  4FP7 A;  2AXV A;  2P9L G;  3AU4 A;  1OUV A;  4KYO B;  2RD0 A;  3FUH A;  4KMO A;  3PUJ A;  3ZIM A;  2PZI A;  2B6C A;  4XKC A;  4D10 C;  1OCR E;  2CFU A;  2DCP A;  1Z5S C;  2I2O A;  4C0E A;  1TYQ G;  3CVL A;  3QWW A;  2AXZ A;  5ENQ D;  5CER B;  1TJC A;  3FTZ A;  4JD2 G;  3L6A A;  5T8I A;  3I5P A;  4O6F A;  5BV0 A;  3QWP A;  1OT8 A;  2DZN A;  3QJZ A;  3SBT B;  3T8M A;  2VGE A;  3D9J A;  3FHE A;  2OVF A;  4HOT A;  3OS5 A;  1A17 A;  4K0R A;  2VJ8 A;  1E7U A;  2X6H A;  4YNP A;  4L7T A;  1OCZ E;  3MKQ A;  2LAI A;  4DLQ A;  2PQN A;  4GA2 A;  1HO8 A;  5A6C A;  3ZU7 B;  3CKC A;  4L2L A;  5ENN A;  2I1J A;  3CBO A;  4ANW A;  2MHK A;  1FT1 A;  4ACL A;  5CED B;  1N4R A;  3ISM C;  4ANU A;  4GTM A;  3PNT B;  4H12 A;  3JQ0 A;  4GTQ A;  4JVS A;  3U66 A;  2KCV A;  2V5F A;  1RW2 A;  1LTX A;  3DSX A;  2DVW A;  3OXG A;  4N3C A;  1E8X A;  3FTX A;  2XS1 A;  3B7U X;  4HI8 A;  4GZ6 A;  3FUE A;  4JXT A;  4U0S A;  4A3V A;  1O1R A;  3G2W A;  5JMN D;  5JIY A;  3TJP A;  3T8K A;  1O1S A;  3S2A A;  5D0Q D;  2OEW A;  5FZS A;  3Q75 A;  2J07 A;  1DCE A;  5LFA A;  3FUM A;  4TXQ A;  2KM4 A;  1TEZ A;  1FCH A;  4XZ4 A;  2YHC A;  3IV0 A;  3F9Z A;  4QQI A;  1PAQ A;  3J5Q B;  5T4Y A;  3UIO C;  3M56 A;  3APC A;  4PUC A;  2R05 A;  1OWP A;  2GW1 A;  1MVH A;  1H6K A;  1BU9 A;  4LUN U;  3CK9 A;  4GMJ A;  4TUM A;  5TH7 A;  2WVI A;  3IHX A;  3CV0 A;  5TEG A;  1OY3 D;  4G24 A;  2EIM E;  1TNO A;  1A5E A;  2UWJ G;  4NAC A;  3SGH A;  5LP0 A;  4J8Y A;  5DIZ A;  3KAE A;  3FUF A;  4Q94 A;  4AOF A;  1HH8 A;  5LCW C;  1N95 A;  3NOG D;  3FTU A;  3U4T A;  1IHB A;  1NA0 A;  4K5A B;  5EKQ D;  1K3Z D;  1N0Q A;  5EDS A;  1S0P A;  2ETA A;  1MQS A;  3CHQ A;  5E75 A;  3CVX A;  3HYM B;  4CGW A;  2WXO A;  4UWF A;  3TWQ A;  2RKK A;  4Q96 A;  2H6H A;  4LNU D;  3CVP A;  1KZO A;  4U0Z A;  4N5C A;  1MHQ A;  2VGX B;  3BQO A;  3FUK A;  5G55 A;  3RU0 A;  3SFZ A;  3DWL G;  3ENE A;  4CEM A;  4GB9 A;  1BI7 B;  1H6P A;  4GU5 A;  3RKV A;  4DI4 A;  4URK A;  3D9L A;  3KS2 A;  1LD7 A;  1HG5 A;  3C3R A;  5BW8 C;  3SD5 A;  1EPU A;  2L6B A;  1IYG A;  2EIK E;  3JYS A;  3ULY A;  3HIZ A;  2KCK A;  3DSS A;  3ZGQ A;  3KSL A;  4B0Z A;  4CDM A;  1YCS B;  5CBN A;  2UY1 B;  3L13 A;  1PEG A;  3EHN A;  1QQE A;  3WG7 E;  4R7L A;  5KJK A;  3I4G A;  3LXU X;  2B0O E;  3QAR A;  1LF8 A;  3V79 K;  4ZFH A;  4J6I A;  3RRN B;  4A1S A;  4WNG A;  1HZ4 A;  2WMO A;  2LNI A;  3Q79 A;  3V2X A;  4UQZ A;  4BFR A;  1N6A A;  2CG3 A;  2YQ8 A;  4I1M A;  3LY8 A;  3DXM G;  1AWC B;  1N9A A;  2Y3A A;  4JB8 P;  3G2U A;  1ELW A;  3GYZ A;  4HXI A;  4E47 A;  3PZ2 A;  3KD7 A;  3IEG A;  3PZD A;  2FO7 A;  3MO5 A;  3Q78 A;  4H7X A;  1ELR A;  3KMT A;  3FP3 A;  2XZT G;  4FAD A;  4JC8 A;  1HXI A; 
#chains in the Genus database with same CATH homology
 2VTB A;  2J4B A;  4I1A A;  4RG9 A;  4MRU A;  2R17 C;  2X6J A;  4W9R A;  2DIW A;  4HOS A;  2CG2 A;  4GZC A;  5F6L A;  4AIF A;  3M54 A;  4NVQ A;  4YPU A;  3CKB A;  2L0T B;  2BUG A;  2OV8 A;  2GRL A;  2IOL A;  3RAY A;  4NQ0 A;  4MLP A;  2WMN A;  3AS8 A;  2XCC A;  3R7Q A;  2C0L A;  3OTN A;  5A7D B;  3QWV A;  4J83 A;  2IF4 A;  3CHS A;  2VYI A;  1IQR A;  3D9N A;  2YNQ A;  3FU6 A;  1MUF A;  3EIQ C;  5DBK A;  3QOU A;  3CVN A;  3TG5 A;  1WY6 A;  4H7Y A;  5FWQ A;  3B7S A;  2WQH A;  4FUL A;  4KZ0 A;  4UI9 C;  3SF4 A;  4YVO A;  2X6K A;  3PE4 A;  2KZT B;  3K9I A;  3P2B A;  2C0M A;  2J09 A;  2J49 A;  3CSF A;  4JA7 A;  4I2Z A;  2OVB A;  4WUY A;  2JLB A;  4WAF A;  3UT8 A;  4F7A A;  3ESK A;  4RZ0 A;  3CLJ A;  3S7D A;  2FEZ A;  5KCM A;  4IYP A;  4I9C A;  3RRM B;  2V8S E;  1WM5 A;  1UN8 A;  4GZD A;  2AW6 A;  4HOU A;  4PS3 A;  3ZFW A;  4C0M A;  4XE0 A;  4GML A;  3ULQ A;  1UJK A;  4ME2 A;  3ML9 A;  2Y4T A;  1WAO 1;  2WXN A;  2FBN A;  4NJ5 A;  2KCL A;  2X6F A;  4EZL A;  2CHW A;  1ZBP A;  2IQC A;  2Q7F A;  3CHM A;  3FUI A;  3ONL A;  4IUL A;  4AY5 A;  3IKO B;  3MEK A;  4U0U A;  3FH5 A;  4TV3 A;  5FQ8 A;  1W3B A;  3K5K A;  3CQG B;  3VTY A;  4ABN A;  4LCT A;  3B7T A;  5EX0 A;  1HX8 A;  1JPL A;  4EZK A;  2XEV A;  5C1D A;  3PEV B;  4IRU A;  4JZY A;  4BUP A;  3M58 A;  4N2S A;  4Q69 A;  3RO3 A;  4E85 A;  4I9E A;  3CBP A;  2YHE A;  4U04 A;  1BPO A;  4AM9 A;  3FUL A;  2VGY A;  5CHE E;  3CVY A;  4G1T A;  2V4L A;  4YPE A;  2WQ6 A;  5AJL A;  1E90 A;  3BEE A;  3Q4A B;  3F9Y A;  3GZ1 A;  4BT9 A;  4KXK B;  4JHJ A;  4F53 A;  2E0I A;  3S7B A;  4BT8 A;  2C2L A;  5FTP A;  4CT0 A;  4FJY A;  3CQC B;  1EDU A;  4I43 A;  1H2T C;  1SQM A;  3M53 A;  1B89 A;  1U3D A;  5C2Y A;  2XRY A;  4PDX A;  4FP7 A;  2AXV A;  3ASF A;  5KJN A;  1H19 A;  2XGM A;  4FLH A;  3KMJ A;  4BTB A;  2VTB B;  2X38 A;  3L08 A;  4JDS A;  2VQ2 A;  3AU4 A;  3LY7 A;  5BPP A;  4IJD A;  2R5S A;  2OOE A;  3CIA A;  3ZYQ A;  4CRW A;  1OUV A;  5FJY A;  4FHJ A;  2FI7 A;  4KYO B;  5AJD A;  2FUL A;  2RD0 A;  3FUH A;  4KMO A;  3PUJ A;  5AIJ A;  3FDH A;  3VLD A;  3ZIM A;  5LCW J;  2O8J A;  3M59 A;  4IJ8 A;  2PZI A;  3F9X A;  4XKC A;  5FZQ A;  4D10 C;  4DK5 A;  2RFI A;  1MT6 A;  5G05 C;  4ACK A;  2CFU A;  4L1B A;  2L6J A;  2DCP A;  3CBM A;  2I1K A;  3UMV A;  2I2O A;  5FQ7 A;  2WXL A;  5JIN A;  4GZ3 A;  2R59 A;  4C0E A;  3CEQ A;  3CVL A;  3RQ4 A;  3QWW A;  4A1G A;  3Q15 A;  4OVU A;  4M3O A;  2AXZ A;  4LRZ A;  3SW9 A;  3D9K A;  5LSX A;  3NZU A;  2IU1 A;  1TJC A;  3FTZ A;  4YND A;  2WXG A;  4PS7 A;  3D9I A;  1OWM A;  4I1O B;  4JW1 A;  3L6A A;  3LPZ A;  4MKT A;  3KEZ A;  5T8I A;  2VSN A;  3I5P A;  3ML8 A;  4O6F A;  4TUU A;  5F6K C;  4NRH B;  4A55 A;  4WWO A;  3NQP A;  4J7I A;  5BV0 A;  2RG8 A;  3EJN A;  3QWP A;  4GYY A;  4HOQ A;  3BO5 A;  3MZL B;  4QEO A;  1HF8 A;  3RJW A;  4I6G A;  3CHP A;  3QJZ A;  3UT4 A;  4HOR A;  4ANV A;  4WNE A;  4J8E A;  3LVR E;  3SBT B;  5G04 C;  4FU3 A;  3T8M A;  4J0U A;  4F3V A;  4HS2 A;  3D3M A;  4NUR A;  5CCM A;  3HVE A;  4YPA A;  1OWL A;  3ZYK A;  3BG0 B;  2WPV A;  3B13 A;  3D9J A;  3T5X A;  3EDT B;  3QDN A;  3FHE A;  3QK0 A;  1DNP A;  4HLE A;  5T0K A;  2PM6 A;  3FUN A;  2OVF A;  4HOT A;  2ION A;  3S7J A;  3OS5 A;  1N6C A;  5EX3 A;  1A17 A;  4K0R A;  4G2V A;  3OXF A;  3FFL A;  2VJ8 A;  1E7U A;  2X6H A;  4YNP A;  4L7T A;  3ZHE A;  3QNK A;  4KZC A;  1H0A A;  3MKQ A;  3RJV A;  2LAI A;  4AJW A;  4DLQ A;  3Q49 B;  2PQN A;  3ESL A;  4KVO A;  4APF A;  4F1S A;  5HQ8 A;  4EBA G;  4BTA A;  1XNF A;  4GA2 A;  1HO8 A;  3L16 A;  5A6C A;  3L22 A;  1MVX A;  2J9Q A;  2X3M A;  4C9B B;  3I4R B;  3MO2 A;  3CKC A;  4L2L A;  4ILH B;  4JHR A;  3ZPJ A;  5KJM A;  5ENN A;  2I1J A;  3CBO A;  5ARF A;  1E96 B;  3TXN A;  4ANW A;  4DPR A;  3LYA A;  5LX8 A;  2BF0 X;  1UJJ A;  2MHK A;  4OYS A;  5HI7 A;  5BUZ A;  2WXI A;  4JHK A;  5FT9 A;  3CGH A;  3GZS A;  2V0P A;  2LSU A;  3DPD A;  3D9O A;  3FUJ A;  4ACL A;  2VSO E;  4ILG A;  4EBA A;  1IHG A;  2QFC A;  4AVX A;  4ANU A;  2G46 A;  3FH8 A;  4GAA A;  3PNT B;  4H12 A;  2XGS A;  2WM9 A;  3FEX A;  3JQ0 A;  4AU7 A;  2XPI A;  3PDN A;  1E8W A;  3MCX A;  4JVS A;  3U66 A;  1X5B A;  2KCV A;  2MRI A;  2V5F A;  3LCA A;  4J8S A;  5ANL A;  4BSX A;  4CDR A;  4Z4P A;  3G2T A;  1UG3 A;  1GW6 A;  3OXG A;  4K03 A;  4N3C A;  4N3A A;  1E8X A;  2I9C A;  3FTX A;  3AS4 A;  4UI9 K;  3B7U X;  1H2U A;  4BY6 A;  4EPZ A;  1YA0 A;  4GZ6 A;  2WXQ A;  4LER A;  3FUE A;  1Z3X A;  4JXT A;  3LS8 A;  4GYW A;  1E8Z A;  4U0S A;  3FEY A;  4A3V A;  4CDN A;  1FVF A;  4AXH A;  4AY6 A;  3ASD A;  2J08 A;  2J4D A;  5LOZ A;  3JCK C;  1N52 A;  3G2W A;  1VDY A;  3LJ3 A;  2OND A;  4FMU A;  2WXR A;  3UX4 A;  5JIY A;  1HS6 A;  2XCB A;  4FLB A;  5TTF A;  3TJP A;  3PNL B;  3HVE B;  5F5E A;  3U3W A;  4ILI A;  4MS6 A;  4MI0 A;  4GCN A;  4DI3 A;  3URZ A;  1NA3 A;  3CVV A;  3S2A A;  4JL0 A;  5D0Q D;  3APD A;  5FZS A;  3TG4 A;  3I3N A;  3TXM A;  3ZHE B;  3T5V A;  3AU5 A;  2J07 A;  3MKQ B;  5JHB A;  1E7V A;  2IJG X;  3FUM A;  5D0O D;  5LFA A;  1TEZ A;  2KM4 A;  2WB2 A;  1FCH A;  1PY1 A;  4XZ4 A;  1H2V C;  3EIJ A;  2YHC A;  3FTY A;  1SZ9 A;  2NC9 A;  1Z3Y A;  3IV0 A;  2AVP A;  4B8C B;  4CCA A;  1PAQ A;  1ZKK A;  3F9Z A;  5F59 A;  5T4Y A;  3M56 A;  3APC A;  4PUC A;  1XQH A;  1OWP A;  2CFZ A;  5J08 A;  3CVW A;  3EHM A;  2GW1 A;  4EZJ A;  1MVH A;  1H6K A;  3DAL A;  4JA9 A;  2CHZ A;  3GW4 A;  4LUN U;  3CK9 A;  4L2Y A;  2VGX A;  4B8A A;  2WXK A;  3TGO A;  4GMJ A;  5TH7 A;  2WXH A;  2WVI A;  3IHX A;  3CV0 A;  5TEG A;  2AXU A;  4G24 A;  3SNX A;  3RRU A;  1U3C A;  1PC2 A;  3HNA A;  5T5G A;  4DJA A;  2UWJ G;  3MGB A;  4NAC A;  3SGH A;  4B94 A;  2PQR A;  3WXX A;  5LP0 A;  4YVQ C;  5BT1 A;  1HU3 A;  2NSZ A;  1DVP A;  1JWG A;  3FTS A;  5DIZ A;  3VTX A;  3FU3 A;  3LEW A;  4UWH A;  3KAE A;  4KT6 B;  3FUF A;  4Q94 A;  3VV0 A;  3M57 A;  4AOF A;  3ZRH A;  1HH8 A;  5LCW C;  4C1Q A;  3FTU A;  4Y6C A;  3U4T A;  3HHM A;  3MKR A;  3QC1 A;  2LSV A;  3APF A;  3SBS A;  3ZEF A;  4I6E A;  1NA0 A;  4J7F A;  4YNM A;  1QNF A;  2M63 A;  5EKQ D;  3SWC A;  4XIF A;  2DBA A;  4EEC A;  5JJ0 A;  3ZYM A;  5EDS A;  3NZS A;  1S0P A;  4N39 A;  4FA6 A;  2KAT A;  5BV1 A;  4QEP A;  4FJZ A;  2XPZ A;  1IQU A;  1H3I A;  1MQS A;  1L5J A;  3CHQ A;  3JQ1 A;  3OPE A;  4UWK A;  5E75 A;  3UUX A;  1UW4 B;  3IHV A;  5JJ7 A;  2VSY A;  2BQZ A;  4I51 A;  2I6H A;  5JJ6 A;  2YIN A;  3CVX A;  3HYM B;  4UWL A;  4CGW A;  1ZU2 A;  3CVU A;  3AS5 A;  3G2V A;  3HDX A;  2X6I A;  2XGO A;  2L9B A;  2WXO A;  2AWI A;  3LY9 A;  2IFU A;  4UWF A;  3EP0 A;  4XI9 A;  5FQ4 A;  3OOI A;  4LDG A;  3L17 A;  2WXM A;  2R3A A;  3IHY A;  4UI9 J;  2A4Z A;  3PRZ A;  4U07 A;  4LEU A;  4Q96 A;  3MA5 A;  4U63 A;  4HVB A;  3FUD A;  3ZN3 A;  2F69 A;  1O9S A;  1JWF A;  2UY1 A;  3ZYL A;  3D9P A;  3R7R A;  5EG2 A;  3CVP A;  2JEK A;  5E76 A;  1EYH A;  4GA1 A;  4IN3 B;  4U0Z A;  1EF1 C;  4WWP A;  2W5Y A;  4I2W A;  4N5C A;  1MHQ A;  4RG6 A;  4GPK A;  1INZ A;  2BTD A;  2FF4 A;  2VGX B;  1KT0 A;  3O48 A;  1UN9 A;  3LDZ A;  1NP7 A;  3PRE A;  4G25 A;  3RK6 A;  1Y6I A;  3FUK A;  2PM7 A;  5G55 A;  5M72 A;  5BNW A;  3RU0 A;  5LSZ A;  4FHK A;  3SFZ A;  5J90 A;  4P29 A;  3CK8 A;  4A3T A;  3ENE A;  4CEM A;  2GRM A;  3FH7 A;  5CMY A;  3S7F A;  4FC8 A;  4Y6W A;  4GB9 A;  5FQ6 A;  3ZXS A;  5FZR A;  3ZVV A;  2WXF A;  4EQF A;  3P1U A;  4N3B A;  3N71 A;  4GU5 A;  1KLX A;  4JEU A;  4QFV A;  3RKV A;  3TAX A;  4JLG A;  4DI4 A;  3SZ7 A;  4URK A;  4CGV A;  3RO2 A;  4G23 A;  2HR2 A;  4PH4 B;  4RSY A;  2WXJ A;  4UQX A;  5AYF A;  4KBQ A;  3D9L A;  3KS2 A;  5AYW D;  5CPR B;  3D9M A;  4AV7 A;  1HG5 A;  4GCO A;  5ANR A;  5BW8 C;  4J8F A;  1XGW A;  3G2S A;  3KMA A;  3Q5M A;  1SZA A;  3MYV A;  5AEN A;  4GA0 A;  4U8H A;  3CHO A;  3SD5 A;  1ML9 A;  3CK7 A;  2VSX E;  4CT4 A;  1EPU A;  3NF1 A;  3PE3 A;  1IYG A;  3JYS A;  4WNF A;  4E6H A;  4AP2 A;  2XPY A;  3UQ3 A;  3HIZ A;  2KC7 A;  2LAH A;  4PS8 A;  3VLE A;  5JHN A;  3PH0 C;  3ASH A;  4XKB A;  3UPV A;  5ARG A;  2XHE A;  3FPD A;  1NZN A;  3BG1 B;  2HO1 A;  4JEH A;  2IOS A;  5G2N A;  3L54 A;  5T0M A;  1OWN A;  2NXP A;  3F9W A;  2KCK A;  2GGF A;  4APO A;  2WQ7 A;  5G05 J;  1P5Q A;  3ZGQ A;  3SHF A;  4V3I A;  3ONK A;  3CHR A;  4WND A;  4G26 A;  3U9W A;  1HG2 A;  4B0Z A;  1KT1 A;  3O4Z A;  4CDM A;  3UT7 A;  3MO0 A;  2HYZ A;  3LVQ E;  2L0I A;  4O30 A;  2UY1 B;  4XX5 A;  2ZU6 B;  3L13 A;  1JUQ A;  2P58 C;  3MX3 A;  3Q47 B;  4XI0 A;  3LKU A;  1OWO A;  3U64 A;  4JPS A;  4I6J A;  1PEG A;  3C98 A;  1Z6T A;  3EHN A;  1QZ2 A;  3FY4 A;  1QQE A;  4KVM A;  3QAQ A;  4HFG A;  5CMW A;  5CCL A;  4R7L A;  4AEZ C;  4DLO A;  3ASG A;  4MI5 A;  4L23 A;  5KJL A;  3VUZ A;  4ATG A;  5KJK A;  3SI5 A;  1HFA A;  3CVQ A;  1FVH A;  3I4G A;  2KZT A;  3LXU X;  3DB5 A;  3FTW A;  3FU5 A;  3M5A A;  5JJT A;  1N54 A;  3QAR A;  4UWG A;  1LF8 A;  4G11 A;  3OAW A;  1Y8M A;  3OXL A;  4BX9 A;  3MV3 B;  3QKY A;  4J6I A;  3R9A B;  3RRN B;  4A1S A;  4WNG A;  3MV2 B;  3E4B A;  3QB2 A;  5G04 J;  1ELK A;  2LO6 A;  1HZ4 A;  2WMO A;  2LNI A;  3PS6 A;  4N2Q A;  3RIB A;  2MOW A;  2W5Z A;  1E8Y A;  4OVV A;  3MJW A;  1TJF A;  4B89 A;  4QEN A;  4WWN A;  4UQZ A;  4BX8 A;  4BFR A;  2QPW A;  3S8P A;  1N6A A;  2Y4U A;  2CG3 A;  2YQ8 A;  4I1M A;  3TL5 A;  1N3J A;  4UQY A;  3LY8 A;  5JHA A;  2A5U A;  1HE8 A;  4J8D A;  3GZ2 A;  4GYO A;  2ILR A;  3M55 A;  2Y3A A;  3PUK A;  3G2U A;  3ZW3 A;  1ELW A;  2CHX A;  3GYZ A;  4I17 A;  4TRQ A;  2XQ0 A;  2EQX A;  4GZ5 A;  2E2E A;  4HXI A;  5A23 A;  4E47 A;  4ANX A;  2HM8 A;  2XRZ A;  3KD7 A;  3VLF A;  3IEG A;  2IGQ A;  2JV0 A;  2QY7 A;  3PZD A;  2FO7 A;  3IBE A;  3JUI A;  3MO5 A;  3DBS A;  3FU0 A;  4H7X A;  1ELR A;  2WXP A;  3PEU B;  3KMT A;  5T3R A;  3FP3 A;  4BWR A;  3CST A;  4FAD A;  3B7R L;  2PL2 A;  3PVL A;  4JC8 A;  4J8O A;  1HXI A;  3FWV A;  4RVB A;  3FTV A;  3CR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...