5KJMA

Smyd2 in complex with az931
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
429
structure length
429
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Design, Synthesis, and Biological Activity of Substrate Competitive SMYD2 Inhibitors.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 145
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5kjmA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5kjmA01
3M57A 5F59A 4JA7A 3JYSA 3S8PA 3MV2B 2PL2A 4N5CA 3CK9A 3M53A 4JLGA 3CEQA 5AYWD 2C0MA 5JHNA 4UI9K 5D0OD 3RU0A 3CV0A 1N6AA 2C2LA 5CCLA 4GYOA 5LCWJ 4N3AA 5KJMA 3CVNA 1N6CA 5JJ0A 4GZ6A 3CBOA 3HNAA 1Y8MA 1ZKKA 1W3BA 3LY7A 4YNDA 4Z4PA 5G05C 3DB5A 4YPAA 3ASFA 4RG6A 2XCCA 2UWJG 1O9SA 2FEZA 3KD7A 3Q5MA 5CHEE 1MVHA 4AM9A 4H12A 3SF4A 3TGOA 2VYIA 3F9XA 3SWCA 3PDNA 1MVXA 2VGXA 3CK8A 2Y4TA 4UQZA 3EDTB 4G23A 4BUPA 2FF4A 3CBMA 3QWVA 3MA5A 4YVQC 2R3AA 3KMTA 2WQHA 2NC9A 2I6HA 2VSNA 4ABNA 4KXKB 2YHCA 5ARFA 4U0ZA 2RFIA 1MUFA 2AVPA 3KMJA 3CK7A 3QWWA 3RKVA 3AS4A 4U07A 2LSVA 2KC7A 3Q4AB 3EP0A 3KS2A 1B89A 3K9IA 4WNGA 4I2ZA 3KMAA 4IJ8A 5T0KA 3M59A 4GA2A 4GA1A 4F3VA 1ELRA 5FZRA 4YVOA 3CVLA 3MEKA 3ZHEA 1XQHA 3LPZA 4XIFA 5A6CA 2JV0A 3S7DA 5DBKA 4BTBA 3S7JA 3ASGA 2ONDA 3GYZA 4KYOB 2HR2A 2LNIA 1MT6A 4E47A 4HOQA 2F69A 4G2VA 3SZ7A 3FFLA 5EKQD 2OOEA 3RO2A 4GYYA 2HYZA 3NF1A 2L6JA 3FPDA 3LCAA 1NZNA 3U4TA 5FT9A 3VTXA 1H3IA 1PEGA 2BUGA 2UY1B 3SW9A 2FBNA 3HYMB 1ML9A 4J0UA 3OOIA 4KBQA 5JINA 4RZ0A 5CCMA 3UUXA 5ARGA 3GZ1A 3VUZA 4UI9C 4APOA 5BW8C 4HOSA 4LDGA 3ASDA 5KJKA 4N2QA 4C1QA 3DALA 5G04C 2MHKA 4AY6A 3MKRA 2IGQA 3ESKA 3ZGQA 2IFUA 1KT1A 4MI5A 2Y4UA 1ZU2A 3BO5A 2PZIA 5FZQA 5KJLA 3PE4A 4NVQA 2QPWA 5JJTA 3F9YA 4J7FA 5F6LA 4CGVA 3ZFWA 4I17A 5LCWC 5A7DB 2R5SA 4GPKA 3QDNA 3LY8A 4UQXA 3CKCA 3M55A 2QFCA 5BNWA 4RG9A 4GCNA 5F6KC 1ELWA 4IJDA 4GYWA 3MV3B 3TAXA 5LSZA 5EX3A 4BWRA 3K5KA 4MI0A 3U3WA 4N39A 2HO1A 1OUVA 3F9WA 4GZ5A 4J83A 3RAYA 3ASHA 3CKBA 3LY9A 3TG4A 2J9QA 2LSUA 4Y6WA 3RIBA 4N2SA 1IHGA 5HQ8A 5TH7A 1ZBPA 3ULQA 4HORA 1YA0A 1E96B 3LYAA 3OS5A 4BT9A 2XGMA 3S7FA 4XI0A 4BTAA 2G46A 2UY1A 2VQ2A 4G1TA 3N71A 3UQ3A 4EQFA 2DBAA 4J7IA 5C1DA 3OPEA 3UPVA 4GCOA 5D0QD 4AIFA 1QZ2A 3AS5A 3QOUA 3AS8A 4XI9A 4I1AA 2E2EA 4J8EA 1FCHA 5BT1A 1QQEA 1A17A 2FO7A 3RJWA 4I51A 4N3CA 1N3JA 3M5AA 5M72A 2KCVA 2VSYA 3MO0A 4G24A 4I9CA 4YNPA 3O48A 3VV0A 5F5EA 3RQ4A 5FZSA 4WUYA 4I9EA 4J8DA 3M54A 2XGSA 4WNEA 5CPRB 3F9ZA 3WXXA 1NA3A 4CDRA 3M58A 3RO3A 5AYFA 5FJYA 5G05J 3URZA 3CVPA 4GA0A 3OXGA 3GW4A 3RJVA 4UQYA 4U04A 1WM5A 4HOTA 4H7XA 4CGWA 3GZ2A 2YQ8A 2P58C 3MO5A 3Q15A 4Y6CA 4JL0A 1TJCA 3OXLA 5EX0A 2KCKA 1WAO1 4N3BA 4WNDA 1NA0A 5T0MA 5KJNA 3R9AB 2C0LA 3QWPA 1HXIA 2VGYA 1IYGA 3BEEA 3TG5A 3FP3A 2PQNA 3Q47B 2KATA 5T5GA 4YPUA 3M56A 2GW1A 3MO2A 3CVQA 5TEGA 1KLXA 3PE3A 3Q49B 2XEVA 3CBPA 4O6FA 1HH8A 3KAEA 2XGOA 4NRHB 5EG2A 2WPVA 4G25A 2O8JA 2W5YA 3ZPJA 4LEUA 3E4BA 4JA9A 4NJ5A 3IHXA 4IN3B 2JLBA 4JHRA 1KT0A 4QEPA 2VGXB 1P5QA 1HZ4A 4J8FA 4WNFA 4ME2A 5DIZA 4HOUA 5HI7A 5JIYA 4W9RA 4O30A 4YPEA 3ZN3A 5JJ7A 2KCLA 2BQZA 4JDSA 3S7BA 4U0SA 5LSXA 2W5ZA 4GZ3A 5JJ6A 4B94A 4AU7A 2XPIA 3FWVA 5FTPA 5TTFA 4QEOA 2PQRA 2Q7FA 4YNMA 1PC2A 4BT8A 2XCBA 2IF4A 4A1SA 4I2WA 3OXFA 4FMUA 4NQ0A 3QKYA 1XNFA 2V5FA 4U0UA 3LKUA 4G26A 4H7YA 4UI9J 3VTYA 3IEGA 4QENA 3ZHEB 4J8OA 5G04J 2FI7A 4AY5A
chains in the Genus database with same CATH superfamily
4A63B 4U7EB 3HDXA 3APDA 4N5CA 3CK9A 4YDOA 4AJWA 1TNBA 2Y1LE 5AYWD 3C3QA 1IHBA 1UJJA 3I3NA 5D0OD 3UIPC 5CCLA 4ACKA 3FUMA 2XRYA 2GRQB 3SGHA 3CVNA 3HNAA 1HU3A 3ULEG 3CHMA 3LY7A 2RFMA 4Z4PA 5G05C 2IEJA 5HKPA 3SBTB 2UWJG 2B0OE 2FEZA 4DX2A 4FA6A 1XGWA 2ZXWE 3PH0C 4JC8A 3KSQA 3Q5MA 3CIAA 5FWQA 4ZHBA 1FVHA 2WXPA 3S2AA 3I5PA 4H12A 2CHXA 3KEAA 3PDNA 1V55E 2KZTB 2VGXA 2Y4TA 4G23A 3DWLG 2FF4A 3MZLB 3CBMA 2BF0X 2R3AA 2WQHA 2NC9A 2I6HA 1IXVA 3ESLA 4ANUA 4CDNA 1EYHA 5ARFA 3DSWA 2RFIA 1MUFA 5AAOA 2V0PA 5AJLA 2P2CP 3PZ4A 3FTSA 4U07A 2LSVA 3Q4AB 3EU5A 3EP0A 1Z3YA 3B7UX 4BSXA 4XKCA 2OVBA 4A3VA 1UN9A 5T0KA 3DSUA 1VDYA 4GA1A 2JEKA 1ELKA 4UWFA 1Z5SC 3ZHEA 4DLQA 4XIFA 5B1AE 4TRQA 3W9FA 2LUHA 4BTBA 4GTQA 2ONDA 4A55A 3TWWA 2RD0A 3RO2A 4GYYA 3NF1A 3FPDA 2WXKA 3VTXA 4OAUC 1BI8B 1H3IA 2UY1B 3SW9A 3UM3A 2CG2A 1N54A 3DPDA 3FU5A 5EYLA 5KBAA 5JINA 4MBGA 2AW6A 2BEDA 5CCMA 3U66A 1AP7A 1H2VC 5B1BE 4UI9C 3VUZA 2BTDA 3AG4E 3DALA 4GU5A 3ESKA 2IFUA 4MI5A 1MHQA 1ZU2A 3BO5A 5KJLA 3NZUA 2KZTA 4HFGA 1DC2A 4J7FA 3FTWA 1E7VA 4CGVA 2E0IA 1BLXB 1MX4A 5A7DB 3E30A 1UN8A 1V54E 4XZ4A 5CMWA 1Z3XA 2MYOA 1FT1A 3LEWA 3V30A 3M55A 2QFCA 2V8SE 3FHEA 1LD8A 1ELWA 3SHFA 2V4HC 3UI2A 4ILHB 4IJDA 4GYWA 3TAXA 4I6GA 5LSZA 4GMJA 3O4ZA 4BFRA 2P9KG 4F7AA 4FLBA 2HO1A 3CKBA 2J9QA 2LSUA 2P9UG 5TH7A 4IYPA 4GMRA 4PS7A 3P1UA 1ZBPA 4APFA 1N0QA 4K0RA 3UM2A 4EPZA 2XGMA 4GTOA 4GTVA 3QNKA 1N4PA 2UY1A 2VQ2A 4G1TA 2DCPA 1N52A 4OYSA 2DBAA 5BXOA 3V31A 1TJFA 2EINE 1JCQA 3DRAA 3V2OA 3G2SA 3QOUA 1X5BA 4ILGA 5EN5D 3TWRA 1N3JA 3M5AA 4MS6A 3R9MA 4G24A 2X6JA 1SQMA 3RQ4A 4LNGA 3ZVVA 5JHAA 5AQBA 4RVBA 3QC1A 2VTBB 1H6KA 3B13A 1NA3A 1NP7A 3Q9UC 4B0ZA 5A23A 3I4RB 3RO3A 5AYFA 4KVMA 5FJYA 5G05J 1HG5A 3B7RL 3CVPA 2A4ZA 3OXGA 3X2QE 4LCTA 2LXLA 1OCCE 2LXMA 1WM5A 1K1BA 3GZ2A 3VLDA 2OCCE 3FTUA 5FQ4A 2P58C 4Y6CA 4JL0A 1TJCA 3D9NA 3UT7A 1WAO1 1N4QA 1H19A 4DUIA 3Q47B 2IQCA 2YINA 3BG1B 3HXEA 1SW6A 3M56A 2GW1A 2ZU6B 3PE3A 4YDEA 3E33A 2XGOA 4NRHB 3FH5A 2WPVA 2J49A 4G25A 2O8JA 3ULYA 1HS6A 2W5YA 4LEUA 3E4BA 4JA9A 1TNZA 5CMYA 4NJ5A 1KT0A 1TYQG 4RLYA 2EQXA 1P5QA 1HZ4A 5CBOA 3CVXA 3Q75A 4DPRA 5HI7A 5JIYA 2KCLA 4O60A 4JDSA 2CHWA 2ZGGA 3S7BA 4DK5A 4GMLA 2W5ZA 4GZ3A 2IO2C 2VTBA 3TL5A 3IBEA 3PVLA 2I9CA 3Q78A 1LTXA 4YNMA 3B7SA 4LRZA 2X6FA 3CHRA 3TWUA 3PUJA 3HXBA 3ENEA 1TEZA 4EZJA 2ILRA 4UI9J 4ZFHA 2Y69E 3Q7AA 2FI7A 4AY5A 4J8YA 3AJIA 3PZ3A 5F59A 3JYSA 2P9LG 2WQ7A 3ML8A 3CSFA 4GTPA 3RRNB 3CEQA 2L6BA 1N94A 1AWCB 5JHNA 3CV0A 4CCAA 4GYOA 2GRNB 4FHJA 4N3AA 1DCEA 5JJ0A 3CBOA 1Y8MA 4YNDA 3HXCA 4DX1A 4YPAA 3DSSA 2J09A 3ZIMA 1OWOA 4L7TA 2XCCA 1O9SA 3KD7A 4BY6A 5EIDA 5CEDB 3TXNA 5CECB 1D8DA 4U8VD 1OCRE 3FUEA 1O5MA 3NOCD 1MVHA 1MJ0A 3JXJA 4AM9A 4GB9A 3ASOE 3MJWA 3LS8A 4A1GA 4K5BA 4JHKA 1N0RA 5LOZA 1FPPA 4ANVA 4FC8A 4UQZA 5FQ8A 4O1PA 1O1RA 1PY1A 4B89A 2JABA 2VSNA 4NURA 3VLEA 4KXKB 2WXHA 3QJZA 2EILE 4B93B 3KMJA 3QWWA 3RKVA 4ANXA 3KS2A 1B89A 2XEEA 3I4GA 5BV1A 4MKTA 3KMAA 1GW6A 4IJ8A 4GA2A 2RFAA 4HVBA 1ELRA 3CQCB 4YVOA 3ISMC 2XENA 5LX8A 3CVLA 3MEKA 1XQHA 3V2XA 2JV0A 1OCZE 5DBKA 1OY3D 3U9WA 3EIJA 3IKOB 4E47A 4HOQA 3CHPA 2F69A 1H2UA 3SZ7A 3CR3A 3L54A 3FFLA 4OAVB 3FU3A 4X8QA 3FTVA 5H7PA 1NZNA 1TN7A 2YNQA 1FVFA 4F1PA 2XS1A 1TN8A 2BUGA 2WXQA 3J5PA 2FBNA 3HYMB 3ABLE 4J0UA 3CVYA 2WXNA 2WQ6A 4BX9A 4RZ0A 1MZCA 3C3RA 3GZ1A 3AAAC 2IOLA 4HBDA 5AQ9A 1WDYA 2J4BA 4C1QA 4AEZC 3PS6A 3QARA 4AY6A 2EIKE 4B8AA 4AV7A 2IGQA 1UW4B 3ZGQA 4OVVA 5ENOD 1KT1A 2R03A 2KM4A 4R7LA 5FZQA 3PE4A 3FUNA 5G2NA 4HI8A 3F9YA 3CQGB 5ENQD 5F6LA 2XHEA 3ZFWA 3T8MA 4I17A 5LCWC 3ZU7B 1NI1A 3QDNA 3AU5A 3FU0A 3LY8A 3B95A 5AARA 3L82A 2PM6A 3IHYA 3FUIA 3TXMA 2IOSA 4K03A 1SVXA 1E8XA 3MV3B 4QQIA 5CEAA 3U3WA 3NOGD 2VJ8A 1JWGA 4N39A 2R17C 3VLFA 3ASHA 3LY9A 3HIZA 2OV8A 3EU9A 4DI4A 1IHGA 2DIWA 4EBAA 3ULQA 4HS2A 4HORA 2M63A 1E96B 3FEXA 4C9BB 3ZXSA 3S7FA 3ML9A 4D10C 2IO3C 4LNUD 4XI0A 2G46A 3QK0A 4L23A 4EQFA 3EHQA 3DXKG 5FQ7A 1U2VG 2ZIRA 2WXRA 4DLOA 3FDHA 1QZ2A 2XZTG 2E2EA 4EZLA 4J8EA 3UX4A 3ASNE 1OCOE 3RRMB 3T5XA 4RQIA 4UWHA 2KCVA 4Z68A 4YNPA 5F5EA 2F37A 2P9SG 5FZSA 4WUYA 3SFYA 2X38A 3U64A 2IY0C 1BPOA 2XGSA 3DEOA 4WNEA 5CPRB 3F9ZA 1SZ9A 2WXOA 2ETAA 3WXXA 3FTZA 3ONLA 4PH4B 3M58A 2J4DA 4L9PA 5AJDA 3G2UA 4GTTA 3URZA 4OVUA 2XPZA 3HVEB 4GA0A 4TXRA 1KZOA 2J08A 1S64A 3RAUA 4H7XA 4DJAA 3CVWA 4BEPA 4HOTA 3HRAA 3ZRHA 2YQ8A 4FP7A 2R05A 3L22A 3RSEG 4GAAA 3FULA 2XEHA 4U8HA 3OXLA 3IV0A 2WM9A 3NBNB 5G55A 4N3BA 4WNDA 1E8WA 4UWKA 3E34A 4GTRA 3CHSA 4J7WA 2IU1A 3UINC 2MOWA 5CRUA 2KATA 3DSTA 4TUMA 5FQ6A 2YHEA 3SQVA 3CVQA 2I1JA 1KLXA 3CBPA 4M3OA 4O6FA 2EIME 4JHJA 5EG2A 2KXPC 2J07A 3TWSA 4M7CA 2WVIA 3MGBA 5ANRA 1SA4A 2WXFA 2AXUA 4AXHA 2X6KA 2XZDG 3IHXA 4IN3B 3LDZA 1HG2A 5HS0A 2WXMA 4J8FA 4HOUA 3R7RA 5ENSD 4UUCA 1E7UA 2VGEA 3SO8A 4U0SA 1JCSA 2QZAA 1JPLA 2BKGA 1UJKA 3L08A 2XPIA 5TTFA 3ZXPA 1OT8A 5JMND 2IF4A 4A1SA 4XEIG 4ACLA 3ONKA 4I2WA 1N4SA 3PEVB 1XNFA 2V5FA 4HXIA 3HVEA 4B8CB 1NL4A 3PZDA 4HLLA 5ENNA 2X6HA 5KNHD 4WWOA 2RKKA 3IEGA 3QAQA 3FUJA 4HNAD 2DYSE 5E76A 2GRPB 3M57A 2IJGX 4L1BA 3S8PA 3MV2B 3LVRE 2HE0A 3M53A 2DVWA 3D9OA 2P9NG 5T8IA 5BV0A 2F8YA 1TNYA 2LO6A 2WXJA 2OEVA 5LCWJ 5C2YA 4GZ6A 1ZKKA 3R7QA 3DB5A 3ASFA 4RG6A 3UXGA 1OWLA 5EDSA 5CHEE 4AOFA 4C0EA 3FH7A 3SF4A 2NXPA 3C72A 3TGOA 3DEPA 3F9XA 3SWCA 4DI3A 1HX8A 3CK8A 3JQ0A 3B7BA 1H2TC 3APFA 4AVXA 3UKRG 3D9JA 4ABNA 2RG8A 4U0ZA 4DRXE 3CK7A 3AS4A 2KC7A 4ATGA 3K9IA 3ZYLA 4I2ZA 3UTMA 2EIJE 1H6PA 4Q94A 4XX5A 4BX8A 3BUAA 4F3VA 5FZRA 1MX6A 4HRLA 3CHOA 4I6EA 3CLJA 4CYMD 2GRLA 3GYZA 2HR2A 1MT6A 4AP2A 4G8LA 4GTSA 3PNLB 4G2VA 5EKQD 1JWFA 2HYZA 2L6JA 3PREA 3LCAA 4P29A 3E37A 3AG2E 3J5QB 3T5VA 1KZPA 4RSYA 1PEGA 4NACA 1K8KG 3OOIA 4KBQA 2XPYA 1QBQA 3FEYA 3UUXA 5ARGA 3T8KA 1K1AA 4LSZE 3IHVA 4JB8P 4APOA 5BW8C 4HOSA 3MKQB 4LDGA 4IULA 4N2QA 3BG0B 1H0AA 3MKRA 1JUQA 3UT8A 3APCA 1INZA 5CRVA 5D2MC 2PZIA 2BKKB 3FUHA 4C0MA 4NVQA 3DSXA 3RK6A 2AJAA 1JCRA 4JPSA 2R5SA 4GPKA 3L16A 3DBSA 2CHZA 4L2LA 3IXEA 4UQXA 3FTYA 3CKCA 2QY7A 4RG9A 5EYPF 3D9PA 2WXGA 4KT6B 2AXZA 1H6OA 2FO1E 3K5KA 4MI0A 3BQOA 1OUVA 4GZ5A 2HM8A 2ZGDA 4ATZD 3D9IA 4Y6WA 3RIBA 4N2SA 3D9KA 3ABKE 3EUVA 1ZB1A 2L9BA 1K3ZD 2I2OA 5ENRD 3CVVA 3OS5A 4BT9A 4LG6A 4MLPA 4E6HA 4BTAA 1EPUA 3N71A 2F0YA 4HRNA 3FH8A 5C1DA 3LXUX 1D8EA 5EILA 2WMOA 3MKQA 4EECA 2OVFA 3AS5A 4XI9A 4J6IA 3D3MA 1A17A 4G11A 4KMOA 4LUNU 3ZW3A 5M72A 1HFAA 2DYRE 3MO0A 5J08A 4KZ0A 4LERA 2AWIA 2L0TB 4J8DA 3UIOC 2GGFA 4PS8A 4HQDA 2DZOA 3EHMA 4KVOA 3OAWA 5BPPA 4CRWA 3Q73A 4MRUA 1SZAA 4V3IA 1YYHA 3GW4A 3HG0D 3RJVA 4UQYA 2LAHA 5FIOA 1WG0A 3Q9NC 4JEHA 3SD5A 2P9PG 2KCKA 4BSZB 4TUUA 3E32A 2C0LA 5KNGA 3R9AB 5IY5E 1HXIA 4GZCA 2XS8A 4WWPA 3FP3A 2PQNA 3ZKJA 4GPMA 4YPUA 1KPSB 4DX6D 2GRRB 4C48B 5TEGA 3MYVA 2ETCA 3Q49B 2ETBA 4CZ2D 1HH8A 3KAEA 2NSZA 3D9HA 4HB5A 4Q96A 1O1TA 3ZYQA 1HF8A 2GROB 3ZUVB 4JHRA 3HXFA 5CBNA 4F6RD 2CG3A 4BERA 4U63A 5DIZA 1BU9A 4FJYA 4W9RA 2BQZA 2H6HA 3BU8A 2WB2A 1RZ4A 4B94A 3CGHA 3FWVA 1IKND 3FUKA 2Q7FA 3L9TA 3MX3A 2NYJA 4JW1A 1PC2A 2XCBA 3OXFA 4DX5D 4FMUA 4NQ0A 4U0UA 2PNNA 4JVSA 2A5EA 4G26A 4FLHA 3VTYA 2R59A 4URKA 4QENA 3KSLA 4J8OA 3SFZA 3HXDA 1BD8A 3JXIA 4JA7A 3ZYMA 1IQUA 1U3CA 3Q79A 3G2TA 1Q2ZA 2PL2A 1WY6A 5T4YA 4JLGA 4WWNA 5LP0A 5AQAA 2C0MA 2QYJA 2H6GA 1RW2A 1QNFA 1N11A 4UI9K 3ZNGA 3RU0A 1N6AA 2C2LA 3PRZA 1L5JA 4J8SA 3SY2A 5AIJA 4FHKA 3ABME 5KJMA 3D9MA 3NB2A 1N6CA 1W3BA 3FUDA 5KCMA 1MX2A 1DCQA 3CSTA 2X3MA 2ZISA 3AG1E 4I6JA 5LFAA 3T9KA 3C5RA 3HHMA 1S63A 2VYIA 2Y0BG 1MVXA 2QYUA 3SI5A 2H6IA 3EDTB 5KWDA 4BUPA 5J90A 1SA5A 3RRUA 3QWVA 3MA5A 4YVQC 3KMTA 3PZ2A 3DSVA 1LF8A 2YHCA 3EIQC 1TNUA 1BI7B 5T3RA 2AVPA 2WXLA 4CDMA 3G2VA 4I1MA 4WNGA 3SFXA 4XKBA 4A3TA 4XE0A 3EHRA 2CFZA 3PZ1A 3M59A 3QB2A 4JEUA 5AN8A 4JXTA 3AG3E 3OTNA 3CVUA 3LPZA 4TXQA 5A6CA 3S7DA 3S7JA 2V5QC 3ASGA 1HE8A 4KYOB 2PM7A 2LNIA 3SBSA 3UM1A 4ILIA 2A5UA 3TWXA 4K5AB 2OOEA 3EJNA 3U4TA 5FT9A 1N4RA 3GZSA 4BETA 2R2LA 4EHMA 3P2BA 1ML9A 1E90A 4HRMB 4EBAG 4Q69A 4FADA 4U96D 2LAIA 4FU3A 3CHQA 1MYOA 2XQ0A 5HRYA 2B6CA 3ASDA 3LJNA 5KJKA 3FTXA 1DVPA 5G04C 2MHKA 1EF1C 4PUCA 3L13A 4GZDA 3UM0A 5ANLA 2DWZA 2Y4UA 3NQPA 4I43A 2QPWA 2OEWA 3TWQA 3JQ1A 5JJTA 3UMVA 4CT4A 4DX7D 2L0IA 2DZNA 1O1SA 1MQSA 4N5QA 3SNXA 3DXMG 2XRZA 4O1OA 1TNOA 4YDYA 1E8YA 5BNWA 1S70B 5CERB 4GCNA 5F6KC 1E8ZA 2VSOE 2P9IG 1OWNA 1UOHA 2X6IA 3FUFA 4GTMA 4CEMA 4I1OB 5EX3A 3ZYKA 4BWRA 2IONA 3NZSA 3FU6A 3LVQE 1HO8A 2V4LA 2KBXA 3KEZA 5E75A 4G8KA 3FY4A 3F9WA 1Y6IA 1LD7A 4J83A 3RAYA 3V79K 3TG4A 1N95A 4WAFA 5HQ8A 4YDWA 5ENPD 1YA0A 4CT0A 1IQRA 3LYAA 3LJ3A 5JA4D 3W9GA 5BUZA 4U8YD 3UQ3A 1QYMA 3Q7FA 4J7IA 3EHNA 2MRIA 1NFIE 3OPEA 4JD2G 5FINA 3UPVA 2QC9A 4GCOA 5D0QD 3PUKA 1A5EA 5EIBE 3L17A 4AIFA 3AS8A 4I1AA 4F1SA 1FCHA 5BT1A 1QQEA 2FO7A 3RJWA 4I51A 1N9AA 4N3CA 1U3DA 1D9SA 2VSYA 4I9CA 5AENA 3O48A 3VV0A 2I1KA 1DNPA 4I9EA 4FJZA 5B3SE 3M54A 2WMNA 4CDRA 3JCKC 2GRMA 2J8SD 4F53A 4EZKA 3D9LA 4TXPA 4JZYA 4FULA 4UWGA 3F6QA 3L6AA 4U04A 4CGWA 1Z6TA 3MO5A 3Q15A 4ANWA 1UG3A 2FULA 5EX0A 1NA0A 1G3NB 3JUEA 5T0MA 5KJNA 3QWPA 1EDUA 3TJPA 2VGYA 4LNBA 4BESA 1IYGA 3BEEA 4PS3A 3TG5A 2CFUA 2R02A 3PNTB 3MCXA 1X81A 5T5GA 3MO2A 3TWVA 5ENTD 5BXUA 1FT2A 2XEVA 4PDXA 3ZEFA 3NAWA 3ZPJA 3WG7E 3UKUG 4U95D 3C3OA 2JLBA 4QEPA 3B7TA 2VGXB 5D66A 2H6FA 2VSXE 3JUIA 1PAQA 4KZCA 4WNFA 4ME2A 5ITZF 3TWTA 4O30A 4YPEA 3ZN3A 5JJ7A 4NIKA 2F8XK 1YCSB 3DPYA 5LSXA 1OWMA 5JJ6A 4HLEA 4TV3A 4AU7A 2AXVA 5FTPA 1TN6A 4QEOA 5JHBA 2PQRA 3C98A 5AQ7A 4BT8A 4K5CA 4E85A 3PEUB 4UWLA 4L2YA 3UT4A 3QKYA 4HI9A 3LKUA 3G2WA 4H7YA 1OWPA 2WXIA 1TR4A 1S0PA 3ZHEB 4QFVA 5G04J 2Y3AA 3AU4A 1YMPA 4IRUA 1OXJA
chains in the Genus database with same CATH topology
3M57A 5F59A 4JA7A 3JYSA 3ZYMA 3HDXA 2IJGX 1IQUA 4L1BA 3S8PA 1U3CA 3MV2B 2WQ7A 3ML8A 3LVRE 3G2TA 2PL2A 3APDA 4N5CA 1WY6A 3CK9A 5T4YA 3CSFA 3M53A 4JLGA 4WWNA 3RRNB 3D9OA 4AJWA 3CEQA 5LP0A 5AYWD 5T8IA 2C0MA 5JHNA 1UJJA 3I3NA 5BV0A 1QNFA 4UI9K 5D0OD 2LO6A 3RU0A 3CV0A 2WXJA 4CCAA 1N6AA 2C2LA 3PRZA 5CCLA 4ACKA 3FUMA 4GYOA 1L5JA 4J8SA 5LCWJ 2XRYA 4FHJA 5C2YA 5AIJA 4FHKA 4N3AA 5KJMA 3D9MA 3SGHA 3CVNA 1N6CA 5JJ0A 4GZ6A 3CBOA 3HNAA 1Y8MA 1HU3A 3CHMA 1ZKKA 1W3BA 3LY7A 4YNDA 3R7QA 4Z4PA 5G05C 3DB5A 4YPAA 3FUDA 2J09A 5KCMA 1OWOA 3ZIMA 3ASFA 4L7TA 3SBTB 4RG6A 2XCCA 3CSTA 2UWJG 1O9SA 2X3MA 2FEZA 3KD7A 1OWLA 4FA6A 1XGWA 4BY6A 4I6JA 5EDSA 3PH0C 4JC8A 3TXNA 3Q5MA 5CHEE 5LFAA 3CIAA 3FUEA 1MVHA 4AOFA 5FWQA 1FVHA 2WXPA 4AM9A 4GB9A 3S2AA 4C0EA 3I5PA 3HHMA 3FH7A 4H12A 3MJWA 3LS8A 3SF4A 2NXPA 2CHXA 4A1GA 3TGOA 2VYIA 3F9XA 4JHKA 3PDNA 1MVXA 3SWCA 4DI3A 2KZTB 2VGXA 1HX8A 3CK8A 5LOZA 3JQ0A 4ANVA 2Y4TA 4FC8A 3EDTB 4UQZA 5FQ8A 4G23A 3SI5A 1TEZA 4BUPA 2FF4A 1PY1A 3MZLB 5J90A 3CBMA 3RRUA 1H2TC 2BF0X 3MA5A 3QWVA 4YVQC 3APFA 4B89A 2WQHA 2NC9A 4AVXA 2R3AA 3KMTA 2I6HA 3D9JA 2VSNA 3ESLA 1LF8A 4ABNA 4NURA 4ANUA 2RG8A 4CDNA 3VLEA 1EYHA 2WXHA 2YHCA 4KXKB 4U0ZA 5ARFA 3QJZA 2RFIA 3EIQC 1MUFA 5T3RA 2V0PA 5AJLA 2AVPA 3KMJA 2WXLA 3CK7A 3QWWA 3RKVA 4CDMA 3AS4A 3FTSA 4U07A 2LSVA 3G2VA 4ANXA 2KC7A 3Q4AB 4ATGA 3EP0A 3KS2A 1B89A 1Z3YA 4I1MA 3K9IA 3ZYLA 3B7UX 3I4GA 4WNGA 4BSXA 4XKCA 4XKBA 4A3TA 2OVBA 4XE0A 4I2ZA 5BV1A 4A3VA 4MKTA 3KMAA 1GW6A 2CFZA 4IJ8A 1UN9A 5T0KA 4Q94A 3M59A 4GA2A 4XX5A 4BX8A 1VDYA 3QB2A 4GA1A 2JEKA 4JEUA 4JXTA 4HVBA 3OTNA 4F3VA 1ELRA 5FZRA 3CQCB 4YVOA 1ELKA 5LX8A 3CVUA 4UWFA 3CVLA 3MEKA 3ZHEA 1XQHA 4DLQA 3LPZA 4XIFA 5A6CA 2JV0A 3CHOA 4I6EA 4TRQA 3CLJA 3S7DA 5DBKA 4BTBA 2GRLA 3S7JA 3U9WA 3ASGA 2ONDA 1HE8A 3GYZA 2HR2A 4KYOB 3EIJA 2PM7A 3IKOB 4A55A 2LNIA 1MT6A 4AP2A 4HOQA 4E47A 3SBSA 3CHPA 2F69A 2RD0A 4ILIA 3PNLB 4G2VA 1H2UA 3SZ7A 3CR3A 2A5UA 3L54A 3FFLA 5EKQD 2OOEA 3RO2A 1JWFA 3FU3A 4GYYA 2HYZA 3NF1A 2L6JA 3EJNA 2WXKA 3LCAA 3PREA 4P29A 3FTVA 1NZNA 3U4TA 3T5VA 5FT9A 3VTXA 2YNQA 3GZSA 1FVFA 4RSYA 1H3IA 1PEGA 2BUGA 2UY1B 2WXQA 4NACA 3SW9A 2CG2A 2FBNA 3HYMB 3P2BA 1N54A 1ML9A 4J0UA 1E90A 3CVYA 3DPDA 3OOIA 4EBAG 3FU5A 4KBQA 5JINA 2WXNA 2XPYA 4Q69A 2AW6A 3FEYA 4BX9A 4FADA 5CCMA 2WQ6A 2LAIA 3UUXA 3U66A 5ARGA 4RZ0A 3GZ1A 3IHVA 4FU3A 1H2VC 3VUZA 4UI9C 2IOLA 4APOA 3CHQA 5BW8C 4HOSA 3MKQB 2BTDA 2XQ0A 4LDGA 4IULA 2J4BA 3ASDA 5KJKA 4N2QA 3FTXA 3DALA 4C1QA 4AEZC 1DVPA 3BG0B 5G04C 3PS6A 2MHKA 3QARA 4GU5A 4B8AA 1H0AA 3MKRA 4AV7A 4AY6A 2IGQA 3ESKA 1JUQA 1EF1C 1UW4B 4OVVA 3UT8A 3ZGQA 3APCA 4PUCA 1INZA 3L13A 2IFUA 4GZDA 1KT1A 4MI5A 5ANLA 1MHQA 2Y4UA 1ZU2A 3BO5A 2KM4A 2PZIA 4R7LA 3FUHA 4AY5A 5FZQA 5KJLA 3NQPA 3PE4A 4I43A 4C0MA 3NZUA 2KZTA 4NVQA 4HFGA 3FUNA 2QPWA 5G2NA 3JQ1A 5JJTA 3RK6A 3F9YA 4J7FA 3FTWA 1E7VA 3CQGB 5F6LA 3UMVA 4CT4A 4JPSA 2XHEA 4CGVA 2E0IA 2L0IA 3ZFWA 3T8MA 4I17A 5LCWC 5A7DB 2R5SA 4GPKA 1UN8A 1MQSA 3L16A 3QDNA 3DBSA 2CHZA 3SNXA 2XRZA 3AU5A 4XZ4A 4L2LA 3FU0A 3LY8A 5CMWA 4UQXA 1Z3XA 3FTYA 2PM6A 3IHYA 3CKCA 1E8YA 2QY7A 3LEWA 3FUIA 3M55A 3TXMA 2QFCA 5BNWA 2V8SE 3FHEA 4RG9A 4GCNA 5F6KC 3D9PA 1ELWA 2WXGA 3SHFA 1E8ZA 2IOSA 2VSOE 4ILHB 4K03A 1OWNA 1E8XA 4IJDA 4GYWA 3MV3B 2X6IA 3FUFA 4KT6B 3TAXA 4I6GA 2AXZA 4CEMA 5LSZA 4I1OB 5EX3A 3ZYKA 4GMJA 4BWRA 2IONA 3K5KA 3O4ZA 4MI0A 3NZSA 3FU6A 3U3WA 4BFRA 3LVQE 1HO8A 2VJ8A 1JWGA 4N39A 2V4LA 2R17C 3KEZA 4F7AA 4FLBA 5E75A 2HO1A 1OUVA 3FY4A 3F9WA 1Y6IA 4GZ5A 3VLFA 4J83A 3RAYA 3ASHA 3CKBA 2HM8A 3LY9A 3HIZA 3TG4A 2OV8A 2J9QA 2LSUA 3D9IA 4Y6WA 3RIBA 4DI4A 4WAFA 4N2SA 3D9KA 1IHGA 5HQ8A 5TH7A 4IYPA 4PS7A 2DIWA 3P1UA 1ZBPA 4EBAA 3ULQA 4HS2A 4APFA 4HORA 1YA0A 4CT0A 2M63A 4K0RA 2L9BA 1IQRA 1E96B 3LYAA 3FEXA 2I2OA 4C9BB 3ZXSA 3CVVA 4EPZA 3OS5A 4BT9A 2XGMA 3S7FA 4MLPA 3ML9A 3QNKA 3LJ3A 4E6HA 4D10C 4XI0A 4BTAA 5BUZA 2UY1A 2VQ2A 4G1TA 2G46A 2DCPA 3QK0A 1EPUA 1N52A 3N71A 4L23A 3UQ3A 4OYSA 4EQFA 2DBAA 4J7IA 3FH8A 5FQ7A 3LXUX 5C1DA 3EHNA 2MRIA 1TJFA 3OPEA 2WXRA 3UPVA 4GCOA 4DLOA 5D0QD 3FDHA 3PUKA 2WMOA 3MKQA 3L17A 4AIFA 4EECA 1QZ2A 2OVFA 3AS5A 3G2SA 3QOUA 3AS8A 4XI9A 4I1AA 2E2EA 4EZLA 4J8EA 4J6IA 4F1SA 1FCHA 5BT1A 1QQEA 1X5BA 3D3MA 1A17A 3UX4A 2FO7A 4G11A 4ILGA 4I51A 4KMOA 4LUNU 3RJWA 4N3CA 1N3JA 3M5AA 3ZW3A 5M72A 4MS6A 3RRMB 1HFAA 1U3DA 3T5XA 4UWHA 2KCVA 2VSYA 3MO0A 4G24A 5J08A 4I9CA 2X6JA 5AENA 3O48A 4YNPA 1SQMA 5F5EA 3RQ4A 3VV0A 3ZVVA 5JHAA 4KZ0A 5FZSA 2I1KA 4RVBA 1DNPA 3QC1A 4LERA 4WUYA 2VTBB 3U64A 2X38A 2AWIA 2L0TB 4FJZA 4I9EA 1BPOA 1H6KA 4J8DA 3M54A 2XGSA 4WNEA 2GGFA 4PS8A 5CPRB 3F9ZA 1SZ9A 2WXOA 3B13A 3WXXA 1NA3A 2WMNA 3FTZA 1NP7A 3JCKC 3ONLA 4CDRA 2GRMA 4PH4B 3M58A 2J4DA 4B0ZA 3EHMA 5A23A 3I4RB 4F53A 3RO3A 5AJDA 4EZKA 5AYFA 3G2UA 4KVMA 5FJYA 5G05J 4KVOA 3D9LA 1HG5A 3OAWA 3URZA 4OVUA 3B7RL 5BPPA 4CRWA 3CVPA 2XPZA 3HVEB 2A4ZA 4JZYA 4MRUA 1SZAA 4GA0A 3OXGA 4FULA 4UWGA 4V3IA 3GW4A 3L6AA 3RJVA 4UQYA 2J08A 4LCTA 2LAHA 4U04A 1WM5A 4HOTA 4H7XA 4DJAA 4CGWA 3CVWA 3ZRHA 3GZ2A 3VLDA 1Z6TA 3FTUA 5FQ4A 2YQ8A 2P58C 4FP7A 4JEHA 3SD5A 3Q15A 4Y6CA 3MO5A 4JL0A 3L22A 4ANWA 4GAAA 3FULA 1TJCA 1UG3A 4U8HA 2FULA 3OXLA 3D9NA 3IV0A 2KCKA 5EX0A 2WM9A 1WAO1 3UT7A 5G55A 4N3BA 4WNDA 1NA0A 1E8WA 4TUUA 4UWKA 5T0MA 5KJNA 3R9AB 2C0LA 1H19A 3QWPA 1EDUA 3CHSA 3TJPA 1HXIA 2IU1A 2VGYA 4GZCA 1IYGA 3BEEA 4PS3A 3TG5A 2CFUA 4WWPA 2MOWA 3FP3A 2PQNA 3PNTB 3MCXA 3Q47B 2IQCA 2YINA 2KATA 3BG1B 5T5GA 4YPUA 3M56A 2GW1A 3MO2A 5FQ6A 3FPDA 2YHEA 2ZU6B 3CVQA 5TEGA 2I1JA 3MYVA 1KLXA 3PE3A 3Q49B 2XEVA 3CBPA 4M3OA 4O6FA 1HH8A 3KAEA 2NSZA 2XGOA 4JHJA 4NRHB 5EG2A 4PDXA 3ZEFA 2J07A 4Q96A 3FH5A 2WPVA 2J49A 2WVIA 3MGBA 4G25A 2O8JA 1HS6A 3ZPJA 2W5YA 5ANRA 4LEUA 3E4BA 4JA9A 2WXFA 2AXUA 3ZYQA 4AXHA 2X6KA 5CMYA 3IHXA 1HF8A 4NJ5A 4IN3B 3LDZA 2JLBA 4JHRA 1KT0A 1HG2A 4QEPA 3B7TA 2VGXB 2EQXA 2VSXE 2CG3A 3JUIA 1P5QA 1HZ4A 2WXMA 3CVXA 4J8FA 1PAQA 4KZCA 4WNFA 4ME2A 4U63A 5DIZA 4HOUA 4DPRA 5HI7A 3R7RA 5JIYA 4FJYA 4W9RA 4O30A 4YPEA 3ZN3A 5JJ7A 2KCLA 2WB2A 2BQZA 1E7UA 4JDSA 2CHWA 3S7BA 4U0SA 4DK5A 4GMLA 1OWMA 2W5ZA 5LSXA 4GZ3A 1JPLA 5JJ6A 4HLEA 4B94A 1UJKA 3L08A 3CGHA 4TV3A 2XPIA 3TL5A 2AXVA 2VTBA 4AU7A 3FWVA 5FTPA 5TTFA 4QEOA 3IBEA 3PVLA 5JHBA 2PQRA 2Q7FA 3FUKA 2I9CA 3C98A 3MX3A 4YNMA 4JW1A 1PC2A 3B7SA 4BT8A 2XCBA 4LRZA 3PEUB 2X6FA 4E85A 3CHRA 4UWLA 2IF4A 4L2YA 4A1SA 4ACLA 3ONKA 3PUJA 4I2WA 3UT4A 3OXFA 4FMUA 3PEVB 3ENEA 4NQ0A 3QKYA 1XNFA 2V5FA 4U0UA 3LKUA 4HXIA 4JVSA 3G2WA 4G26A 3HVEA 1OWPA 2ILRA 4H7YA 3PZDA 4UI9J 2WXIA 4B8CB 4EZJA 5ENNA 2X6HA 4WWOA 4FLHA 1S0PA 3VTYA 2R59A 3IEGA 3QAQA 3FUJA 3ZHEB 4URKA 4QENA 4J8OA 4QFVA 5G04J 5E76A 3SFZA 2FI7A 2Y3AA 3AU4A 4IRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M57 A;  5F59 A;  4JA7 A;  3JYS A;  3S8P A;  3MV2 B;  2PL2 A;  4N5C A;  3CK9 A;  3M53 A;  4JLG A;  3CEQ A;  5AYW D;  2C0M A;  5JHN A;  4UI9 K;  5D0O D;  3RU0 A;  3CV0 A;  1N6A A;  2C2L A;  5CCL A;  4GYO A;  5LCW J;  4N3A A;  5KJM A;  3CVN A;  1N6C A;  5JJ0 A;  4GZ6 A;  3CBO A;  3HNA A;  1Y8M A;  1ZKK A;  1W3B A;  3LY7 A;  4YND A;  4Z4P A;  5G05 C;  3DB5 A;  4YPA A;  3ASF A;  4RG6 A;  2XCC A;  2UWJ G;  1O9S A;  2FEZ A;  3KD7 A;  3Q5M A;  5CHE E;  1MVH A;  4AM9 A;  4H12 A;  3SF4 A;  3TGO A;  2VYI A;  3F9X A;  3SWC A;  3PDN A;  1MVX A;  2VGX A;  3CK8 A;  2Y4T A;  4UQZ A;  3EDT B;  4G23 A;  4BUP A;  2FF4 A;  3CBM A;  3QWV A;  3MA5 A;  4YVQ C;  2R3A A;  3KMT A;  2WQH A;  2NC9 A;  2I6H A;  2VSN A;  4ABN A;  4KXK B;  2YHC A;  5ARF A;  4U0Z A;  2RFI A;  1MUF A;  2AVP A;  3KMJ A;  3CK7 A;  3QWW A;  3RKV A;  3AS4 A;  4U07 A;  2LSV A;  2KC7 A;  3Q4A B;  3EP0 A;  3KS2 A;  1B89 A;  3K9I A;  4WNG A;  4I2Z A;  3KMA A;  4IJ8 A;  5T0K A;  3M59 A;  4GA2 A;  4GA1 A;  4F3V A;  1ELR A;  5FZR A;  4YVO A;  3CVL A;  3MEK A;  3ZHE A;  1XQH A;  3LPZ A;  4XIF A;  5A6C A;  2JV0 A;  3S7D A;  5DBK A;  4BTB A;  3S7J A;  3ASG A;  2OND A;  3GYZ A;  4KYO B;  2HR2 A;  2LNI A;  1MT6 A;  4E47 A;  4HOQ A;  2F69 A;  4G2V A;  3SZ7 A;  3FFL A;  5EKQ D;  2OOE A;  3RO2 A;  4GYY A;  2HYZ A;  3NF1 A;  2L6J A;  3FPD A;  3LCA A;  1NZN A;  3U4T A;  5FT9 A;  3VTX A;  1H3I A;  1PEG A;  2BUG A;  2UY1 B;  3SW9 A;  2FBN A;  3HYM B;  1ML9 A;  4J0U A;  3OOI A;  4KBQ A;  5JIN A;  4RZ0 A;  5CCM A;  3UUX A;  5ARG A;  3GZ1 A;  3VUZ A;  4UI9 C;  4APO A;  5BW8 C;  4HOS A;  4LDG A;  3ASD A;  5KJK A;  4N2Q A;  4C1Q A;  3DAL A;  5G04 C;  2MHK A;  4AY6 A;  3MKR A;  2IGQ A;  3ESK A;  3ZGQ A;  2IFU A;  1KT1 A;  4MI5 A;  2Y4U A;  1ZU2 A;  3BO5 A;  2PZI A;  5FZQ A;  5KJL A;  3PE4 A;  4NVQ A;  2QPW A;  5JJT A;  3F9Y A;  4J7F A;  5F6L A;  4CGV A;  3ZFW A;  4I17 A;  5LCW C;  5A7D B;  2R5S A;  4GPK A;  3QDN A;  3LY8 A;  4UQX A;  3CKC A;  3M55 A;  2QFC A;  5BNW A;  4RG9 A;  4GCN A;  5F6K C;  1ELW A;  4IJD A;  4GYW A;  3MV3 B;  3TAX A;  5LSZ A;  5EX3 A;  4BWR A;  3K5K A;  4MI0 A;  3U3W A;  4N39 A;  2HO1 A;  1OUV A;  3F9W A;  4GZ5 A;  4J83 A;  3RAY A;  3ASH A;  3CKB A;  3LY9 A;  3TG4 A;  2J9Q A;  2LSU A;  4Y6W A;  3RIB A;  4N2S A;  1IHG A;  5HQ8 A;  5TH7 A;  1ZBP A;  3ULQ A;  4HOR A;  1YA0 A;  1E96 B;  3LYA A;  3OS5 A;  4BT9 A;  2XGM A;  3S7F A;  4XI0 A;  4BTA A;  2G46 A;  2UY1 A;  2VQ2 A;  4G1T A;  3N71 A;  3UQ3 A;  4EQF A;  2DBA A;  4J7I A;  5C1D A;  3OPE A;  3UPV A;  4GCO A;  5D0Q D;  4AIF A;  1QZ2 A;  3AS5 A;  3QOU A;  3AS8 A;  4XI9 A;  4I1A A;  2E2E A;  4J8E A;  1FCH A;  5BT1 A;  1QQE A;  1A17 A;  2FO7 A;  3RJW A;  4I51 A;  4N3C A;  1N3J A;  3M5A A;  5M72 A;  2KCV A;  2VSY A;  3MO0 A;  4G24 A;  4I9C A;  4YNP A;  3O48 A;  3VV0 A;  5F5E A;  3RQ4 A;  5FZS A;  4WUY A;  4I9E A;  4J8D A;  3M54 A;  2XGS A;  4WNE A;  5CPR B;  3F9Z A;  3WXX A;  1NA3 A;  4CDR A;  3M58 A;  3RO3 A;  5AYF A;  5FJY A;  5G05 J;  3URZ A;  3CVP A;  4GA0 A;  3OXG A;  3GW4 A;  3RJV A;  4UQY A;  4U04 A;  1WM5 A;  4HOT A;  4H7X A;  4CGW A;  3GZ2 A;  2YQ8 A;  2P58 C;  3MO5 A;  3Q15 A;  4Y6C A;  4JL0 A;  1TJC A;  3OXL A;  5EX0 A;  2KCK A;  1WAO 1;  4N3B A;  4WND A;  1NA0 A;  5T0M A;  5KJN A;  3R9A B;  2C0L A;  3QWP A;  1HXI A;  2VGY A;  1IYG A;  3BEE A;  3TG5 A;  3FP3 A;  2PQN A;  3Q47 B;  2KAT A;  5T5G A;  4YPU A;  3M56 A;  2GW1 A;  3MO2 A;  3CVQ A;  5TEG A;  1KLX A;  3PE3 A;  3Q49 B;  2XEV A;  3CBP A;  4O6F A;  1HH8 A;  3KAE A;  2XGO A;  4NRH B;  5EG2 A;  2WPV A;  4G25 A;  2O8J A;  2W5Y A;  3ZPJ A;  4LEU A;  3E4B A;  4JA9 A;  4NJ5 A;  3IHX A;  4IN3 B;  2JLB A;  4JHR A;  1KT0 A;  4QEP A;  2VGX B;  1P5Q A;  1HZ4 A;  4J8F A;  4WNF A;  4ME2 A;  5DIZ A;  4HOU A;  5HI7 A;  5JIY A;  4W9R A;  4O30 A;  4YPE A;  3ZN3 A;  5JJ7 A;  2KCL A;  2BQZ A;  4JDS A;  3S7B A;  4U0S A;  5LSX A;  2W5Z A;  4GZ3 A;  5JJ6 A;  4B94 A;  4AU7 A;  2XPI A;  3FWV A;  5FTP A;  5TTF A;  4QEO A;  2PQR A;  2Q7F A;  4YNM A;  1PC2 A;  4BT8 A;  2XCB A;  2IF4 A;  4A1S A;  4I2W A;  3OXF A;  4FMU A;  4NQ0 A;  3QKY A;  1XNF A;  2V5F A;  4U0U A;  3LKU A;  4G26 A;  4H7Y A;  4UI9 J;  3VTY A;  3IEG A;  4QEN A;  3ZHE B;  4J8O A;  5G04 J;  2FI7 A;  4AY5 A; 
#chains in the Genus database with same CATH topology
 4A63 B;  4U7E B;  3HDX A;  3APD A;  4N5C A;  3CK9 A;  4YDO A;  4AJW A;  1TNB A;  2Y1L E;  5AYW D;  3C3Q A;  1IHB A;  1UJJ A;  3I3N A;  5D0O D;  3UIP C;  5CCL A;  4ACK A;  3FUM A;  2XRY A;  2GRQ B;  3SGH A;  3CVN A;  3HNA A;  1HU3 A;  3ULE G;  3CHM A;  3LY7 A;  2RFM A;  4Z4P A;  5G05 C;  2IEJ A;  5HKP A;  3SBT B;  2UWJ G;  2B0O E;  2FEZ A;  4DX2 A;  4FA6 A;  1XGW A;  2ZXW E;  3PH0 C;  4JC8 A;  3KSQ A;  3Q5M A;  3CIA A;  5FWQ A;  4ZHB A;  1FVH A;  2WXP A;  3S2A A;  3I5P A;  4H12 A;  2CHX A;  3KEA A;  3PDN A;  1V55 E;  2KZT B;  2VGX A;  2Y4T A;  4G23 A;  3DWL G;  2FF4 A;  3MZL B;  3CBM A;  2BF0 X;  2R3A A;  2WQH A;  2NC9 A;  2I6H A;  1IXV A;  3ESL A;  4ANU A;  4CDN A;  1EYH A;  5ARF A;  3DSW A;  2RFI A;  1MUF A;  5AAO A;  2V0P A;  5AJL A;  2P2C P;  3PZ4 A;  3FTS A;  4U07 A;  2LSV A;  3Q4A B;  3EU5 A;  3EP0 A;  1Z3Y A;  3B7U X;  4BSX A;  4XKC A;  2OVB A;  4A3V A;  1UN9 A;  5T0K A;  3DSU A;  1VDY A;  4GA1 A;  2JEK A;  1ELK A;  4UWF A;  1Z5S C;  3ZHE A;  4DLQ A;  4XIF A;  5B1A E;  4TRQ A;  3W9F A;  2LUH A;  4BTB A;  4GTQ A;  2OND A;  4A55 A;  3TWW A;  2RD0 A;  3RO2 A;  4GYY A;  3NF1 A;  3FPD A;  2WXK A;  3VTX A;  4OAU C;  1BI8 B;  1H3I A;  2UY1 B;  3SW9 A;  3UM3 A;  2CG2 A;  1N54 A;  3DPD A;  3FU5 A;  5EYL A;  5KBA A;  5JIN A;  4MBG A;  2AW6 A;  2BED A;  5CCM A;  3U66 A;  1AP7 A;  1H2V C;  5B1B E;  4UI9 C;  3VUZ A;  2BTD A;  3AG4 E;  3DAL A;  4GU5 A;  3ESK A;  2IFU A;  4MI5 A;  1MHQ A;  1ZU2 A;  3BO5 A;  5KJL A;  3NZU A;  2KZT A;  4HFG A;  1DC2 A;  4J7F A;  3FTW A;  1E7V A;  4CGV A;  2E0I A;  1BLX B;  1MX4 A;  5A7D B;  3E30 A;  1UN8 A;  1V54 E;  4XZ4 A;  5CMW A;  1Z3X A;  2MYO A;  1FT1 A;  3LEW A;  3V30 A;  3M55 A;  2QFC A;  2V8S E;  3FHE A;  1LD8 A;  1ELW A;  3SHF A;  2V4H C;  3UI2 A;  4ILH B;  4IJD A;  4GYW A;  3TAX A;  4I6G A;  5LSZ A;  4GMJ A;  3O4Z A;  4BFR A;  2P9K G;  4F7A A;  4FLB A;  2HO1 A;  3CKB A;  2J9Q A;  2LSU A;  2P9U G;  5TH7 A;  4IYP A;  4GMR A;  4PS7 A;  3P1U A;  1ZBP A;  4APF A;  1N0Q A;  4K0R A;  3UM2 A;  4EPZ A;  2XGM A;  4GTO A;  4GTV A;  3QNK A;  1N4P A;  2UY1 A;  2VQ2 A;  4G1T A;  2DCP A;  1N52 A;  4OYS A;  2DBA A;  5BXO A;  3V31 A;  1TJF A;  2EIN E;  1JCQ A;  3DRA A;  3V2O A;  3G2S A;  3QOU A;  1X5B A;  4ILG A;  5EN5 D;  3TWR A;  1N3J A;  3M5A A;  4MS6 A;  3R9M A;  4G24 A;  2X6J A;  1SQM A;  3RQ4 A;  4LNG A;  3ZVV A;  5JHA A;  5AQB A;  4RVB A;  3QC1 A;  2VTB B;  1H6K A;  3B13 A;  1NA3 A;  1NP7 A;  3Q9U C;  4B0Z A;  5A23 A;  3I4R B;  3RO3 A;  5AYF A;  4KVM A;  5FJY A;  5G05 J;  1HG5 A;  3B7R L;  3CVP A;  2A4Z A;  3OXG A;  3X2Q E;  4LCT A;  2LXL A;  1OCC E;  2LXM A;  1WM5 A;  1K1B A;  3GZ2 A;  3VLD A;  2OCC E;  3FTU A;  5FQ4 A;  2P58 C;  4Y6C A;  4JL0 A;  1TJC A;  3D9N A;  3UT7 A;  1WAO 1;  1N4Q A;  1H19 A;  4DUI A;  3Q47 B;  2IQC A;  2YIN A;  3BG1 B;  3HXE A;  1SW6 A;  3M56 A;  2GW1 A;  2ZU6 B;  3PE3 A;  4YDE A;  3E33 A;  2XGO A;  4NRH B;  3FH5 A;  2WPV A;  2J49 A;  4G25 A;  2O8J A;  3ULY A;  1HS6 A;  2W5Y A;  4LEU A;  3E4B A;  4JA9 A;  1TNZ A;  5CMY A;  4NJ5 A;  1KT0 A;  1TYQ G;  4RLY A;  2EQX A;  1P5Q A;  1HZ4 A;  5CBO A;  3CVX A;  3Q75 A;  4DPR A;  5HI7 A;  5JIY A;  2KCL A;  4O60 A;  4JDS A;  2CHW A;  2ZGG A;  3S7B A;  4DK5 A;  4GML A;  2W5Z A;  4GZ3 A;  2IO2 C;  2VTB A;  3TL5 A;  3IBE A;  3PVL A;  2I9C A;  3Q78 A;  1LTX A;  4YNM A;  3B7S A;  4LRZ A;  2X6F A;  3CHR A;  3TWU A;  3PUJ A;  3HXB A;  3ENE A;  1TEZ A;  4EZJ A;  2ILR A;  4UI9 J;  4ZFH A;  2Y69 E;  3Q7A A;  2FI7 A;  4AY5 A;  4J8Y A;  3AJI A;  3PZ3 A;  5F59 A;  3JYS A;  2P9L G;  2WQ7 A;  3ML8 A;  3CSF A;  4GTP A;  3RRN B;  3CEQ A;  2L6B A;  1N94 A;  1AWC B;  5JHN A;  3CV0 A;  4CCA A;  4GYO A;  2GRN B;  4FHJ A;  4N3A A;  1DCE A;  5JJ0 A;  3CBO A;  1Y8M A;  4YND A;  3HXC A;  4DX1 A;  4YPA A;  3DSS A;  2J09 A;  3ZIM A;  1OWO A;  4L7T A;  2XCC A;  1O9S A;  3KD7 A;  4BY6 A;  5EID A;  5CED B;  3TXN A;  5CEC B;  1D8D A;  4U8V D;  1OCR E;  3FUE A;  1O5M A;  3NOC D;  1MVH A;  1MJ0 A;  3JXJ A;  4AM9 A;  4GB9 A;  3ASO E;  3MJW A;  3LS8 A;  4A1G A;  4K5B A;  4JHK A;  1N0R A;  5LOZ A;  1FPP A;  4ANV A;  4FC8 A;  4UQZ A;  5FQ8 A;  4O1P A;  1O1R A;  1PY1 A;  4B89 A;  2JAB A;  2VSN A;  4NUR A;  3VLE A;  4KXK B;  2WXH A;  3QJZ A;  2EIL E;  4B93 B;  3KMJ A;  3QWW A;  3RKV A;  4ANX A;  3KS2 A;  1B89 A;  2XEE A;  3I4G A;  5BV1 A;  4MKT A;  3KMA A;  1GW6 A;  4IJ8 A;  4GA2 A;  2RFA A;  4HVB A;  1ELR A;  3CQC B;  4YVO A;  3ISM C;  2XEN A;  5LX8 A;  3CVL A;  3MEK A;  1XQH A;  3V2X A;  2JV0 A;  1OCZ E;  5DBK A;  1OY3 D;  3U9W A;  3EIJ A;  3IKO B;  4E47 A;  4HOQ A;  3CHP A;  2F69 A;  1H2U A;  3SZ7 A;  3CR3 A;  3L54 A;  3FFL A;  4OAV B;  3FU3 A;  4X8Q A;  3FTV A;  5H7P A;  1NZN A;  1TN7 A;  2YNQ A;  1FVF A;  4F1P A;  2XS1 A;  1TN8 A;  2BUG A;  2WXQ A;  3J5P A;  2FBN A;  3HYM B;  3ABL E;  4J0U A;  3CVY A;  2WXN A;  2WQ6 A;  4BX9 A;  4RZ0 A;  1MZC A;  3C3R A;  3GZ1 A;  3AAA C;  2IOL A;  4HBD A;  5AQ9 A;  1WDY A;  2J4B A;  4C1Q A;  4AEZ C;  3PS6 A;  3QAR A;  4AY6 A;  2EIK E;  4B8A A;  4AV7 A;  2IGQ A;  1UW4 B;  3ZGQ A;  4OVV A;  5ENO D;  1KT1 A;  2R03 A;  2KM4 A;  4R7L A;  5FZQ A;  3PE4 A;  3FUN A;  5G2N A;  4HI8 A;  3F9Y A;  3CQG B;  5ENQ D;  5F6L A;  2XHE A;  3ZFW A;  3T8M A;  4I17 A;  5LCW C;  3ZU7 B;  1NI1 A;  3QDN A;  3AU5 A;  3FU0 A;  3LY8 A;  3B95 A;  5AAR A;  3L82 A;  2PM6 A;  3IHY A;  3FUI A;  3TXM A;  2IOS A;  4K03 A;  1SVX A;  1E8X A;  3MV3 B;  4QQI A;  5CEA A;  3U3W A;  3NOG D;  2VJ8 A;  1JWG A;  4N39 A;  2R17 C;  3VLF A;  3ASH A;  3LY9 A;  3HIZ A;  2OV8 A;  3EU9 A;  4DI4 A;  1IHG A;  2DIW A;  4EBA A;  3ULQ A;  4HS2 A;  4HOR A;  2M63 A;  1E96 B;  3FEX A;  4C9B B;  3ZXS A;  3S7F A;  3ML9 A;  4D10 C;  2IO3 C;  4LNU D;  4XI0 A;  2G46 A;  3QK0 A;  4L23 A;  4EQF A;  3EHQ A;  3DXK G;  5FQ7 A;  1U2V G;  2ZIR A;  2WXR A;  4DLO A;  3FDH A;  1QZ2 A;  2XZT G;  2E2E A;  4EZL A;  4J8E A;  3UX4 A;  3ASN E;  1OCO E;  3RRM B;  3T5X A;  4RQI A;  4UWH A;  2KCV A;  4Z68 A;  4YNP A;  5F5E A;  2F37 A;  2P9S G;  5FZS A;  4WUY A;  3SFY A;  2X38 A;  3U64 A;  2IY0 C;  1BPO A;  2XGS A;  3DEO A;  4WNE A;  5CPR B;  3F9Z A;  1SZ9 A;  2WXO A;  2ETA A;  3WXX A;  3FTZ A;  3ONL A;  4PH4 B;  3M58 A;  2J4D A;  4L9P A;  5AJD A;  3G2U A;  4GTT A;  3URZ A;  4OVU A;  2XPZ A;  3HVE B;  4GA0 A;  4TXR A;  1KZO A;  2J08 A;  1S64 A;  3RAU A;  4H7X A;  4DJA A;  3CVW A;  4BEP A;  4HOT A;  3HRA A;  3ZRH A;  2YQ8 A;  4FP7 A;  2R05 A;  3L22 A;  3RSE G;  4GAA A;  3FUL A;  2XEH A;  4U8H A;  3OXL A;  3IV0 A;  2WM9 A;  3NBN B;  5G55 A;  4N3B A;  4WND A;  1E8W A;  4UWK A;  3E34 A;  4GTR A;  3CHS A;  4J7W A;  2IU1 A;  3UIN C;  2MOW A;  5CRU A;  2KAT A;  3DST A;  4TUM A;  5FQ6 A;  2YHE A;  3SQV A;  3CVQ A;  2I1J A;  1KLX A;  3CBP A;  4M3O A;  4O6F A;  2EIM E;  4JHJ A;  5EG2 A;  2KXP C;  2J07 A;  3TWS A;  4M7C A;  2WVI A;  3MGB A;  5ANR A;  1SA4 A;  2WXF A;  2AXU A;  4AXH A;  2X6K A;  2XZD G;  3IHX A;  4IN3 B;  3LDZ A;  1HG2 A;  5HS0 A;  2WXM A;  4J8F A;  4HOU A;  3R7R A;  5ENS D;  4UUC A;  1E7U A;  2VGE A;  3SO8 A;  4U0S A;  1JCS A;  2QZA A;  1JPL A;  2BKG A;  1UJK A;  3L08 A;  2XPI A;  5TTF A;  3ZXP A;  1OT8 A;  5JMN D;  2IF4 A;  4A1S A;  4XEI G;  4ACL A;  3ONK A;  4I2W A;  1N4S A;  3PEV B;  1XNF A;  2V5F A;  4HXI A;  3HVE A;  4B8C B;  1NL4 A;  3PZD A;  4HLL A;  5ENN A;  2X6H A;  5KNH D;  4WWO A;  2RKK A;  3IEG A;  3QAQ A;  3FUJ A;  4HNA D;  2DYS E;  5E76 A;  2GRP B;  3M57 A;  2IJG X;  4L1B A;  3S8P A;  3MV2 B;  3LVR E;  2HE0 A;  3M53 A;  2DVW A;  3D9O A;  2P9N G;  5T8I A;  5BV0 A;  2F8Y A;  1TNY A;  2LO6 A;  2WXJ A;  2OEV A;  5LCW J;  5C2Y A;  4GZ6 A;  1ZKK A;  3R7Q A;  3DB5 A;  3ASF A;  4RG6 A;  3UXG A;  1OWL A;  5EDS A;  5CHE E;  4AOF A;  4C0E A;  3FH7 A;  3SF4 A;  2NXP A;  3C72 A;  3TGO A;  3DEP A;  3F9X A;  3SWC A;  4DI3 A;  1HX8 A;  3CK8 A;  3JQ0 A;  3B7B A;  1H2T C;  3APF A;  4AVX A;  3UKR G;  3D9J A;  4ABN A;  2RG8 A;  4U0Z A;  4DRX E;  3CK7 A;  3AS4 A;  2KC7 A;  4ATG A;  3K9I A;  3ZYL A;  4I2Z A;  3UTM A;  2EIJ E;  1H6P A;  4Q94 A;  4XX5 A;  4BX8 A;  3BUA A;  4F3V A;  5FZR A;  1MX6 A;  4HRL A;  3CHO A;  4I6E A;  3CLJ A;  4CYM D;  2GRL A;  3GYZ A;  2HR2 A;  1MT6 A;  4AP2 A;  4G8L A;  4GTS A;  3PNL B;  4G2V A;  5EKQ D;  1JWF A;  2HYZ A;  2L6J A;  3PRE A;  3LCA A;  4P29 A;  3E37 A;  3AG2 E;  3J5Q B;  3T5V A;  1KZP A;  4RSY A;  1PEG A;  4NAC A;  1K8K G;  3OOI A;  4KBQ A;  2XPY A;  1QBQ A;  3FEY A;  3UUX A;  5ARG A;  3T8K A;  1K1A A;  4LSZ E;  3IHV A;  4JB8 P;  4APO A;  5BW8 C;  4HOS A;  3MKQ B;  4LDG A;  4IUL A;  4N2Q A;  3BG0 B;  1H0A A;  3MKR A;  1JUQ A;  3UT8 A;  3APC A;  1INZ A;  5CRV A;  5D2M C;  2PZI A;  2BKK B;  3FUH A;  4C0M A;  4NVQ A;  3DSX A;  3RK6 A;  2AJA A;  1JCR A;  4JPS A;  2R5S A;  4GPK A;  3L16 A;  3DBS A;  2CHZ A;  4L2L A;  3IXE A;  4UQX A;  3FTY A;  3CKC A;  2QY7 A;  4RG9 A;  5EYP F;  3D9P A;  2WXG A;  4KT6 B;  2AXZ A;  1H6O A;  2FO1 E;  3K5K A;  4MI0 A;  3BQO A;  1OUV A;  4GZ5 A;  2HM8 A;  2ZGD A;  4ATZ D;  3D9I A;  4Y6W A;  3RIB A;  4N2S A;  3D9K A;  3ABK E;  3EUV A;  1ZB1 A;  2L9B A;  1K3Z D;  2I2O A;  5ENR D;  3CVV A;  3OS5 A;  4BT9 A;  4LG6 A;  4MLP A;  4E6H A;  4BTA A;  1EPU A;  3N71 A;  2F0Y A;  4HRN A;  3FH8 A;  5C1D A;  3LXU X;  1D8E A;  5EIL A;  2WMO A;  3MKQ A;  4EEC A;  2OVF A;  3AS5 A;  4XI9 A;  4J6I A;  3D3M A;  1A17 A;  4G11 A;  4KMO A;  4LUN U;  3ZW3 A;  5M72 A;  1HFA A;  2DYR E;  3MO0 A;  5J08 A;  4KZ0 A;  4LER A;  2AWI A;  2L0T B;  4J8D A;  3UIO C;  2GGF A;  4PS8 A;  4HQD A;  2DZO A;  3EHM A;  4KVO A;  3OAW A;  5BPP A;  4CRW A;  3Q73 A;  4MRU A;  1SZA A;  4V3I A;  1YYH A;  3GW4 A;  3HG0 D;  3RJV A;  4UQY A;  2LAH A;  5FIO A;  1WG0 A;  3Q9N C;  4JEH A;  3SD5 A;  2P9P G;  2KCK A;  4BSZ B;  4TUU A;  3E32 A;  2C0L A;  5KNG A;  3R9A B;  5IY5 E;  1HXI A;  4GZC A;  2XS8 A;  4WWP A;  3FP3 A;  2PQN A;  3ZKJ A;  4GPM A;  4YPU A;  1KPS B;  4DX6 D;  2GRR B;  4C48 B;  5TEG A;  3MYV A;  2ETC A;  3Q49 B;  2ETB A;  4CZ2 D;  1HH8 A;  3KAE A;  2NSZ A;  3D9H A;  4HB5 A;  4Q96 A;  1O1T A;  3ZYQ A;  1HF8 A;  2GRO B;  3ZUV B;  4JHR A;  3HXF A;  5CBN A;  4F6R D;  2CG3 A;  4BER A;  4U63 A;  5DIZ A;  1BU9 A;  4FJY A;  4W9R A;  2BQZ A;  2H6H A;  3BU8 A;  2WB2 A;  1RZ4 A;  4B94 A;  3CGH A;  3FWV A;  1IKN D;  3FUK A;  2Q7F A;  3L9T A;  3MX3 A;  2NYJ A;  4JW1 A;  1PC2 A;  2XCB A;  3OXF A;  4DX5 D;  4FMU A;  4NQ0 A;  4U0U A;  2PNN A;  4JVS A;  2A5E A;  4G26 A;  4FLH A;  3VTY A;  2R59 A;  4URK A;  4QEN A;  3KSL A;  4J8O A;  3SFZ A;  3HXD A;  1BD8 A;  3JXI A;  4JA7 A;  3ZYM A;  1IQU A;  1U3C A;  3Q79 A;  3G2T A;  1Q2Z A;  2PL2 A;  1WY6 A;  5T4Y A;  4JLG A;  4WWN A;  5LP0 A;  5AQA A;  2C0M A;  2QYJ A;  2H6G A;  1RW2 A;  1QNF A;  1N11 A;  4UI9 K;  3ZNG A;  3RU0 A;  1N6A A;  2C2L A;  3PRZ A;  1L5J A;  4J8S A;  3SY2 A;  5AIJ A;  4FHK A;  3ABM E;  5KJM A;  3D9M A;  3NB2 A;  1N6C A;  1W3B A;  3FUD A;  5KCM A;  1MX2 A;  1DCQ A;  3CST A;  2X3M A;  2ZIS A;  3AG1 E;  4I6J A;  5LFA A;  3T9K A;  3C5R A;  3HHM A;  1S63 A;  2VYI A;  2Y0B G;  1MVX A;  2QYU A;  3SI5 A;  2H6I A;  3EDT B;  5KWD A;  4BUP A;  5J90 A;  1SA5 A;  3RRU A;  3QWV A;  3MA5 A;  4YVQ C;  3KMT A;  3PZ2 A;  3DSV A;  1LF8 A;  2YHC A;  3EIQ C;  1TNU A;  1BI7 B;  5T3R A;  2AVP A;  2WXL A;  4CDM A;  3G2V A;  4I1M A;  4WNG A;  3SFX A;  4XKB A;  4A3T A;  4XE0 A;  3EHR A;  2CFZ A;  3PZ1 A;  3M59 A;  3QB2 A;  4JEU A;  5AN8 A;  4JXT A;  3AG3 E;  3OTN A;  3CVU A;  3LPZ A;  4TXQ A;  5A6C A;  3S7D A;  3S7J A;  2V5Q C;  3ASG A;  1HE8 A;  4KYO B;  2PM7 A;  2LNI A;  3SBS A;  3UM1 A;  4ILI A;  2A5U A;  3TWX A;  4K5A B;  2OOE A;  3EJN A;  3U4T A;  5FT9 A;  1N4R A;  3GZS A;  4BET A;  2R2L A;  4EHM A;  3P2B A;  1ML9 A;  1E90 A;  4HRM B;  4EBA G;  4Q69 A;  4FAD A;  4U96 D;  2LAI A;  4FU3 A;  3CHQ A;  1MYO A;  2XQ0 A;  5HRY A;  2B6C A;  3ASD A;  3LJN A;  5KJK A;  3FTX A;  1DVP A;  5G04 C;  2MHK A;  1EF1 C;  4PUC A;  3L13 A;  4GZD A;  3UM0 A;  5ANL A;  2DWZ A;  2Y4U A;  3NQP A;  4I43 A;  2QPW A;  2OEW A;  3TWQ A;  3JQ1 A;  5JJT A;  3UMV A;  4CT4 A;  4DX7 D;  2L0I A;  2DZN A;  1O1S A;  1MQS A;  4N5Q A;  3SNX A;  3DXM G;  2XRZ A;  4O1O A;  1TNO A;  4YDY A;  1E8Y A;  5BNW A;  1S70 B;  5CER B;  4GCN A;  5F6K C;  1E8Z A;  2VSO E;  2P9I G;  1OWN A;  1UOH A;  2X6I A;  3FUF A;  4GTM A;  4CEM A;  4I1O B;  5EX3 A;  3ZYK A;  4BWR A;  2ION A;  3NZS A;  3FU6 A;  3LVQ E;  1HO8 A;  2V4L A;  2KBX A;  3KEZ A;  5E75 A;  4G8K A;  3FY4 A;  3F9W A;  1Y6I A;  1LD7 A;  4J83 A;  3RAY A;  3V79 K;  3TG4 A;  1N95 A;  4WAF A;  5HQ8 A;  4YDW A;  5ENP D;  1YA0 A;  4CT0 A;  1IQR A;  3LYA A;  3LJ3 A;  5JA4 D;  3W9G A;  5BUZ A;  4U8Y D;  3UQ3 A;  1QYM A;  3Q7F A;  4J7I A;  3EHN A;  2MRI A;  1NFI E;  3OPE A;  4JD2 G;  5FIN A;  3UPV A;  2QC9 A;  4GCO A;  5D0Q D;  3PUK A;  1A5E A;  5EIB E;  3L17 A;  4AIF A;  3AS8 A;  4I1A A;  4F1S A;  1FCH A;  5BT1 A;  1QQE A;  2FO7 A;  3RJW A;  4I51 A;  1N9A A;  4N3C A;  1U3D A;  1D9S A;  2VSY A;  4I9C A;  5AEN A;  3O48 A;  3VV0 A;  2I1K A;  1DNP A;  4I9E A;  4FJZ A;  5B3S E;  3M54 A;  2WMN A;  4CDR A;  3JCK C;  2GRM A;  2J8S D;  4F53 A;  4EZK A;  3D9L A;  4TXP A;  4JZY A;  4FUL A;  4UWG A;  3F6Q A;  3L6A A;  4U04 A;  4CGW A;  1Z6T A;  3MO5 A;  3Q15 A;  4ANW A;  1UG3 A;  2FUL A;  5EX0 A;  1NA0 A;  1G3N B;  3JUE A;  5T0M A;  5KJN A;  3QWP A;  1EDU A;  3TJP A;  2VGY A;  4LNB A;  4BES A;  1IYG A;  3BEE A;  4PS3 A;  3TG5 A;  2CFU A;  2R02 A;  3PNT B;  3MCX A;  1X81 A;  5T5G A;  3MO2 A;  3TWV A;  5ENT D;  5BXU A;  1FT2 A;  2XEV A;  4PDX A;  3ZEF A;  3NAW A;  3ZPJ A;  3WG7 E;  3UKU G;  4U95 D;  3C3O A;  2JLB A;  4QEP A;  3B7T A;  2VGX B;  5D66 A;  2H6F A;  2VSX E;  3JUI A;  1PAQ A;  4KZC A;  4WNF A;  4ME2 A;  5ITZ F;  3TWT A;  4O30 A;  4YPE A;  3ZN3 A;  5JJ7 A;  4NIK A;  2F8X K;  1YCS B;  3DPY A;  5LSX A;  1OWM A;  5JJ6 A;  4HLE A;  4TV3 A;  4AU7 A;  2AXV A;  5FTP A;  1TN6 A;  4QEO A;  5JHB A;  2PQR A;  3C98 A;  5AQ7 A;  4BT8 A;  4K5C A;  4E85 A;  3PEU B;  4UWL A;  4L2Y A;  3UT4 A;  3QKY A;  4HI9 A;  3LKU A;  3G2W A;  4H7Y A;  1OWP A;  2WXI A;  1TR4 A;  1S0P A;  3ZHE B;  4QFV A;  5G04 J;  2Y3A A;  3AU4 A;  1YMP A;  4IRU A;  1OXJ A; 
#chains in the Genus database with same CATH homology
 3M57 A;  5F59 A;  4JA7 A;  3JYS A;  3ZYM A;  3HDX A;  2IJG X;  1IQU A;  4L1B A;  3S8P A;  1U3C A;  3MV2 B;  2WQ7 A;  3ML8 A;  3LVR E;  3G2T A;  2PL2 A;  3APD A;  4N5C A;  1WY6 A;  3CK9 A;  5T4Y A;  3CSF A;  3M53 A;  4JLG A;  4WWN A;  3RRN B;  3D9O A;  4AJW A;  3CEQ A;  5LP0 A;  5AYW D;  5T8I A;  2C0M A;  5JHN A;  1UJJ A;  3I3N A;  5BV0 A;  1QNF A;  4UI9 K;  5D0O D;  2LO6 A;  3RU0 A;  3CV0 A;  2WXJ A;  4CCA A;  1N6A A;  2C2L A;  3PRZ A;  5CCL A;  4ACK A;  3FUM A;  4GYO A;  1L5J A;  4J8S A;  5LCW J;  2XRY A;  4FHJ A;  5C2Y A;  5AIJ A;  4FHK A;  4N3A A;  5KJM A;  3D9M A;  3SGH A;  3CVN A;  1N6C A;  5JJ0 A;  4GZ6 A;  3CBO A;  3HNA A;  1Y8M A;  1HU3 A;  3CHM A;  1ZKK A;  1W3B A;  3LY7 A;  4YND A;  3R7Q A;  4Z4P A;  5G05 C;  3DB5 A;  4YPA A;  3FUD A;  2J09 A;  5KCM A;  1OWO A;  3ZIM A;  3ASF A;  4L7T A;  3SBT B;  4RG6 A;  2XCC A;  3CST A;  2UWJ G;  1O9S A;  2X3M A;  2FEZ A;  3KD7 A;  1OWL A;  4FA6 A;  1XGW A;  4BY6 A;  4I6J A;  5EDS A;  3PH0 C;  4JC8 A;  3TXN A;  3Q5M A;  5CHE E;  5LFA A;  3CIA A;  3FUE A;  1MVH A;  4AOF A;  5FWQ A;  1FVH A;  2WXP A;  4AM9 A;  4GB9 A;  3S2A A;  4C0E A;  3I5P A;  3HHM A;  3FH7 A;  4H12 A;  3MJW A;  3LS8 A;  3SF4 A;  2NXP A;  2CHX A;  4A1G A;  3TGO A;  2VYI A;  3F9X A;  4JHK A;  3PDN A;  1MVX A;  3SWC A;  4DI3 A;  2KZT B;  2VGX A;  1HX8 A;  3CK8 A;  5LOZ A;  3JQ0 A;  4ANV A;  2Y4T A;  4FC8 A;  3EDT B;  4UQZ A;  5FQ8 A;  4G23 A;  3SI5 A;  1TEZ A;  4BUP A;  2FF4 A;  1PY1 A;  3MZL B;  5J90 A;  3CBM A;  3RRU A;  1H2T C;  2BF0 X;  3MA5 A;  3QWV A;  4YVQ C;  3APF A;  4B89 A;  2WQH A;  2NC9 A;  4AVX A;  2R3A A;  3KMT A;  2I6H A;  3D9J A;  2VSN A;  3ESL A;  1LF8 A;  4ABN A;  4NUR A;  4ANU A;  2RG8 A;  4CDN A;  3VLE A;  1EYH A;  2WXH A;  2YHC A;  4KXK B;  4U0Z A;  5ARF A;  3QJZ A;  2RFI A;  3EIQ C;  1MUF A;  5T3R A;  2V0P A;  5AJL A;  2AVP A;  3KMJ A;  2WXL A;  3CK7 A;  3QWW A;  3RKV A;  4CDM A;  3AS4 A;  3FTS A;  4U07 A;  2LSV A;  3G2V A;  4ANX A;  2KC7 A;  3Q4A B;  4ATG A;  3EP0 A;  3KS2 A;  1B89 A;  1Z3Y A;  4I1M A;  3K9I A;  3ZYL A;  3B7U X;  3I4G A;  4WNG A;  4BSX A;  4XKC A;  4XKB A;  4A3T A;  2OVB A;  4XE0 A;  4I2Z A;  5BV1 A;  4A3V A;  4MKT A;  3KMA A;  1GW6 A;  2CFZ A;  4IJ8 A;  1UN9 A;  5T0K A;  4Q94 A;  3M59 A;  4GA2 A;  4XX5 A;  4BX8 A;  1VDY A;  3QB2 A;  4GA1 A;  2JEK A;  4JEU A;  4JXT A;  4HVB A;  3OTN A;  4F3V A;  1ELR A;  5FZR A;  3CQC B;  4YVO A;  1ELK A;  5LX8 A;  3CVU A;  4UWF A;  3CVL A;  3MEK A;  3ZHE A;  1XQH A;  4DLQ A;  3LPZ A;  4XIF A;  5A6C A;  2JV0 A;  3CHO A;  4I6E A;  4TRQ A;  3CLJ A;  3S7D A;  5DBK A;  4BTB A;  2GRL A;  3S7J A;  3U9W A;  3ASG A;  2OND A;  1HE8 A;  3GYZ A;  2HR2 A;  4KYO B;  3EIJ A;  2PM7 A;  3IKO B;  4A55 A;  2LNI A;  1MT6 A;  4AP2 A;  4HOQ A;  4E47 A;  3SBS A;  3CHP A;  2F69 A;  2RD0 A;  4ILI A;  3PNL B;  4G2V A;  1H2U A;  3SZ7 A;  3CR3 A;  2A5U A;  3L54 A;  3FFL A;  5EKQ D;  2OOE A;  3RO2 A;  1JWF A;  3FU3 A;  4GYY A;  2HYZ A;  3NF1 A;  2L6J A;  3EJN A;  2WXK A;  3LCA A;  3PRE A;  4P29 A;  3FTV A;  1NZN A;  3U4T A;  3T5V A;  5FT9 A;  3VTX A;  2YNQ A;  3GZS A;  1FVF A;  4RSY A;  1H3I A;  1PEG A;  2BUG A;  2UY1 B;  2WXQ A;  4NAC A;  3SW9 A;  2CG2 A;  2FBN A;  3HYM B;  3P2B A;  1N54 A;  1ML9 A;  4J0U A;  1E90 A;  3CVY A;  3DPD A;  3OOI A;  4EBA G;  3FU5 A;  4KBQ A;  5JIN A;  2WXN A;  2XPY A;  4Q69 A;  2AW6 A;  3FEY A;  4BX9 A;  4FAD A;  5CCM A;  2WQ6 A;  2LAI A;  3UUX A;  3U66 A;  5ARG A;  4RZ0 A;  3GZ1 A;  3IHV A;  4FU3 A;  1H2V C;  3VUZ A;  4UI9 C;  2IOL A;  4APO A;  3CHQ A;  5BW8 C;  4HOS A;  3MKQ B;  2BTD A;  2XQ0 A;  4LDG A;  4IUL A;  2J4B A;  3ASD A;  5KJK A;  4N2Q A;  3FTX A;  3DAL A;  4C1Q A;  4AEZ C;  1DVP A;  3BG0 B;  5G04 C;  3PS6 A;  2MHK A;  3QAR A;  4GU5 A;  4B8A A;  1H0A A;  3MKR A;  4AV7 A;  4AY6 A;  2IGQ A;  3ESK A;  1JUQ A;  1EF1 C;  1UW4 B;  4OVV A;  3UT8 A;  3ZGQ A;  3APC A;  4PUC A;  1INZ A;  3L13 A;  2IFU A;  4GZD A;  1KT1 A;  4MI5 A;  5ANL A;  1MHQ A;  2Y4U A;  1ZU2 A;  3BO5 A;  2KM4 A;  2PZI A;  4R7L A;  3FUH A;  4AY5 A;  5FZQ A;  5KJL A;  3NQP A;  3PE4 A;  4I43 A;  4C0M A;  3NZU A;  2KZT A;  4NVQ A;  4HFG A;  3FUN A;  2QPW A;  5G2N A;  3JQ1 A;  5JJT A;  3RK6 A;  3F9Y A;  4J7F A;  3FTW A;  1E7V A;  3CQG B;  5F6L A;  3UMV A;  4CT4 A;  4JPS A;  2XHE A;  4CGV A;  2E0I A;  2L0I A;  3ZFW A;  3T8M A;  4I17 A;  5LCW C;  5A7D B;  2R5S A;  4GPK A;  1UN8 A;  1MQS A;  3L16 A;  3QDN A;  3DBS A;  2CHZ A;  3SNX A;  2XRZ A;  3AU5 A;  4XZ4 A;  4L2L A;  3FU0 A;  3LY8 A;  5CMW A;  4UQX A;  1Z3X A;  3FTY A;  2PM6 A;  3IHY A;  3CKC A;  1E8Y A;  2QY7 A;  3LEW A;  3FUI A;  3M55 A;  3TXM A;  2QFC A;  5BNW A;  2V8S E;  3FHE A;  4RG9 A;  4GCN A;  5F6K C;  3D9P A;  1ELW A;  2WXG A;  3SHF A;  1E8Z A;  2IOS A;  2VSO E;  4ILH B;  4K03 A;  1OWN A;  1E8X A;  4IJD A;  4GYW A;  3MV3 B;  2X6I A;  3FUF A;  4KT6 B;  3TAX A;  4I6G A;  2AXZ A;  4CEM A;  5LSZ A;  4I1O B;  5EX3 A;  3ZYK A;  4GMJ A;  4BWR A;  2ION A;  3K5K A;  3O4Z A;  4MI0 A;  3NZS A;  3FU6 A;  3U3W A;  4BFR A;  3LVQ E;  1HO8 A;  2VJ8 A;  1JWG A;  4N39 A;  2V4L A;  2R17 C;  3KEZ A;  4F7A A;  4FLB A;  5E75 A;  2HO1 A;  1OUV A;  3FY4 A;  3F9W A;  1Y6I A;  4GZ5 A;  3VLF A;  4J83 A;  3RAY A;  3ASH A;  3CKB A;  2HM8 A;  3LY9 A;  3HIZ A;  3TG4 A;  2OV8 A;  2J9Q A;  2LSU A;  3D9I A;  4Y6W A;  3RIB A;  4DI4 A;  4WAF A;  4N2S A;  3D9K A;  1IHG A;  5HQ8 A;  5TH7 A;  4IYP A;  4PS7 A;  2DIW A;  3P1U A;  1ZBP A;  4EBA A;  3ULQ A;  4HS2 A;  4APF A;  4HOR A;  1YA0 A;  4CT0 A;  2M63 A;  4K0R A;  2L9B A;  1IQR A;  1E96 B;  3LYA A;  3FEX A;  2I2O A;  4C9B B;  3ZXS A;  3CVV A;  4EPZ A;  3OS5 A;  4BT9 A;  2XGM A;  3S7F A;  4MLP A;  3ML9 A;  3QNK A;  3LJ3 A;  4E6H A;  4D10 C;  4XI0 A;  4BTA A;  5BUZ A;  2UY1 A;  2VQ2 A;  4G1T A;  2G46 A;  2DCP A;  3QK0 A;  1EPU A;  1N52 A;  3N71 A;  4L23 A;  3UQ3 A;  4OYS A;  4EQF A;  2DBA A;  4J7I A;  3FH8 A;  5FQ7 A;  3LXU X;  5C1D A;  3EHN A;  2MRI A;  1TJF A;  3OPE A;  2WXR A;  3UPV A;  4GCO A;  4DLO A;  5D0Q D;  3FDH A;  3PUK A;  2WMO A;  3MKQ A;  3L17 A;  4AIF A;  4EEC A;  1QZ2 A;  2OVF A;  3AS5 A;  3G2S A;  3QOU A;  3AS8 A;  4XI9 A;  4I1A A;  2E2E A;  4EZL A;  4J8E A;  4J6I A;  4F1S A;  1FCH A;  5BT1 A;  1QQE A;  1X5B A;  3D3M A;  1A17 A;  3UX4 A;  2FO7 A;  4G11 A;  4ILG A;  4I51 A;  4KMO A;  4LUN U;  3RJW A;  4N3C A;  1N3J A;  3M5A A;  3ZW3 A;  5M72 A;  4MS6 A;  3RRM B;  1HFA A;  1U3D A;  3T5X A;  4UWH A;  2KCV A;  2VSY A;  3MO0 A;  4G24 A;  5J08 A;  4I9C A;  2X6J A;  5AEN A;  3O48 A;  4YNP A;  1SQM A;  5F5E A;  3RQ4 A;  3VV0 A;  3ZVV A;  5JHA A;  4KZ0 A;  5FZS A;  2I1K A;  4RVB A;  1DNP A;  3QC1 A;  4LER A;  4WUY A;  2VTB B;  3U64 A;  2X38 A;  2AWI A;  2L0T B;  4FJZ A;  4I9E A;  1BPO A;  1H6K A;  4J8D A;  3M54 A;  2XGS A;  4WNE A;  2GGF A;  4PS8 A;  5CPR B;  3F9Z A;  1SZ9 A;  2WXO A;  3B13 A;  3WXX A;  1NA3 A;  2WMN A;  3FTZ A;  1NP7 A;  3JCK C;  3ONL A;  4CDR A;  2GRM A;  4PH4 B;  3M58 A;  2J4D A;  4B0Z A;  3EHM A;  5A23 A;  3I4R B;  4F53 A;  3RO3 A;  5AJD A;  4EZK A;  5AYF A;  3G2U A;  4KVM A;  5FJY A;  5G05 J;  4KVO A;  3D9L A;  1HG5 A;  3OAW A;  3URZ A;  4OVU A;  3B7R L;  5BPP A;  4CRW A;  3CVP A;  2XPZ A;  3HVE B;  2A4Z A;  4JZY A;  4MRU A;  1SZA A;  4GA0 A;  3OXG A;  4FUL A;  4UWG A;  4V3I A;  3GW4 A;  3L6A A;  3RJV A;  4UQY A;  2J08 A;  4LCT A;  2LAH A;  4U04 A;  1WM5 A;  4HOT A;  4H7X A;  4DJA A;  4CGW A;  3CVW A;  3ZRH A;  3GZ2 A;  3VLD A;  1Z6T A;  3FTU A;  5FQ4 A;  2YQ8 A;  2P58 C;  4FP7 A;  4JEH A;  3SD5 A;  3Q15 A;  4Y6C A;  3MO5 A;  4JL0 A;  3L22 A;  4ANW A;  4GAA A;  3FUL A;  1TJC A;  1UG3 A;  4U8H A;  2FUL A;  3OXL A;  3D9N A;  3IV0 A;  2KCK A;  5EX0 A;  2WM9 A;  1WAO 1;  3UT7 A;  5G55 A;  4N3B A;  4WND A;  1NA0 A;  1E8W A;  4TUU A;  4UWK A;  5T0M A;  5KJN A;  3R9A B;  2C0L A;  1H19 A;  3QWP A;  1EDU A;  3CHS A;  3TJP A;  1HXI A;  2IU1 A;  2VGY A;  4GZC A;  1IYG A;  3BEE A;  4PS3 A;  3TG5 A;  2CFU A;  4WWP A;  2MOW A;  3FP3 A;  2PQN A;  3PNT B;  3MCX A;  3Q47 B;  2IQC A;  2YIN A;  2KAT A;  3BG1 B;  5T5G A;  4YPU A;  3M56 A;  2GW1 A;  3MO2 A;  5FQ6 A;  3FPD A;  2YHE A;  2ZU6 B;  3CVQ A;  5TEG A;  2I1J A;  3MYV A;  1KLX A;  3PE3 A;  3Q49 B;  2XEV A;  3CBP A;  4M3O A;  4O6F A;  1HH8 A;  3KAE A;  2NSZ A;  2XGO A;  4JHJ A;  4NRH B;  5EG2 A;  4PDX A;  3ZEF A;  2J07 A;  4Q96 A;  3FH5 A;  2WPV A;  2J49 A;  2WVI A;  3MGB A;  4G25 A;  2O8J A;  1HS6 A;  3ZPJ A;  2W5Y A;  5ANR A;  4LEU A;  3E4B A;  4JA9 A;  2WXF A;  2AXU A;  3ZYQ A;  4AXH A;  2X6K A;  5CMY A;  3IHX A;  1HF8 A;  4NJ5 A;  4IN3 B;  3LDZ A;  2JLB A;  4JHR A;  1KT0 A;  1HG2 A;  4QEP A;  3B7T A;  2VGX B;  2EQX A;  2VSX E;  2CG3 A;  3JUI A;  1P5Q A;  1HZ4 A;  2WXM A;  3CVX A;  4J8F A;  1PAQ A;  4KZC A;  4WNF A;  4ME2 A;  4U63 A;  5DIZ A;  4HOU A;  4DPR A;  5HI7 A;  3R7R A;  5JIY A;  4FJY A;  4W9R A;  4O30 A;  4YPE A;  3ZN3 A;  5JJ7 A;  2KCL A;  2WB2 A;  2BQZ A;  1E7U A;  4JDS A;  2CHW A;  3S7B A;  4U0S A;  4DK5 A;  4GML A;  1OWM A;  2W5Z A;  5LSX A;  4GZ3 A;  1JPL A;  5JJ6 A;  4HLE A;  4B94 A;  1UJK A;  3L08 A;  3CGH A;  4TV3 A;  2XPI A;  3TL5 A;  2AXV A;  2VTB A;  4AU7 A;  3FWV A;  5FTP A;  5TTF A;  4QEO A;  3IBE A;  3PVL A;  5JHB A;  2PQR A;  2Q7F A;  3FUK A;  2I9C A;  3C98 A;  3MX3 A;  4YNM A;  4JW1 A;  1PC2 A;  3B7S A;  4BT8 A;  2XCB A;  4LRZ A;  3PEU B;  2X6F A;  4E85 A;  3CHR A;  4UWL A;  2IF4 A;  4L2Y A;  4A1S A;  4ACL A;  3ONK A;  3PUJ A;  4I2W A;  3UT4 A;  3OXF A;  4FMU A;  3PEV B;  3ENE A;  4NQ0 A;  3QKY A;  1XNF A;  2V5F A;  4U0U A;  3LKU A;  4HXI A;  4JVS A;  3G2W A;  4G26 A;  3HVE A;  1OWP A;  2ILR A;  4H7Y A;  3PZD A;  4UI9 J;  2WXI A;  4B8C B;  4EZJ A;  5ENN A;  2X6H A;  4WWO A;  4FLH A;  1S0P A;  3VTY A;  2R59 A;  3IEG A;  3QAQ A;  3FUJ A;  3ZHE B;  4URK A;  4QEN A;  4J8O A;  4QFV A;  5G04 J;  5E76 A;  3SFZ A;  2FI7 A;  2Y3A A;  3AU4 A;  4IRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...