5KJMA

Smyd2 in complex with az931
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
429
structure length
429
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, Synthesis, and Biological Activity of Substrate Competitive SMYD2 Inhibitors.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords N-lysine methyltransferase SMYD2
total genus 145
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5kjmA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5kjmA01
2PL2A 1Y8MA 5C1DA 2PQNA 4I9CA 4W9RA 3M59A 4UI9C 3R9AB 3LY9A 4H7YA 5FZRA 3PE3A 5ARFA 3ZHEA 4BT9A 1NA0A 4H12A 2C2LA 4JA9A 3M56A 3JYSA 4MI5A 4N3AA 4J8OA 3AS8A 2FI7A 5G04J 4XI0A 3OXFA 2IF4A 4HOUA 5T5GA 3HYMB 4AY5A 4G1TA 4KBQA 3OXLA 5BW8C 4IJ8A 3CBPA 3S7DA 3K9IA 3K5KA 3OPEA 5A7DB 2E2EA 4KXKB 3MO0A 3CVNA 1E96B 2VGYA 4O6FA 3M58A 3Q5MA 2Y4TA 4UQZA 1ELRA 4F3VA 4JHRA 5JINA 2YHCA 4C1QA 2LNIA 4HOSA 3S7BA 4YVQC 4YVOA 4I1AA 4XI9A 5T0KA 3ZFWA 3U4TA 3M5AA 4B94A 4G2VA 4I51A 4GZ5A 1ZBPA 2XPIA 2WQHA 3KMTA 3VTXA 5FTPA 2I6HA 4LDGA 3DALA 5F5EA 4U04A 3EP0A 3KD7A 5KJNA 3OS5A 3AS4A 3RQ4A 3LCAA 2QFCA 4RG6A 3ASGA 2ONDA 4CDRA 4N39A 1MT6A 5FT9A 1NA3A 3CK9A 5AYWD 2AVPA 5G04C 2OOEA 3E4BA 4YNDA 4LEUA 4G24A 1PC2A 2R3AA 2IGQA 4IN3B 1KT0A 4JL0A 3MA5A 4J83A 4J7IA 2PZIA 3QWWA 4JA7A 5A6CA 4HORA 5JHNA 1ZU2A 3QOUA 3UUXA 4Y6WA 1OUVA 5LSZA 3S7JA 1TJCA 3TAXA 4GYYA 3LPZA 4A1SA 3RAYA 2HO1A 5JJTA 4E47A 4U0SA 4UI9J 3QKYA 3GYZA 3KMJA 3FP3A 2KATA 4UI9K 4AM9A 3LKUA 1QZ2A 4ABNA 5JJ6A 3SW9A 4QEPA 5D0OD 5BT1A 1N6CA 3PDNA 4UQXA 3IHXA 5EG2A 2VGXB 3M53A 4J8FA 4G26A 2DBAA 2LSUA 4BWRA 2KC7A 3TGOA 2MHKA 5KJKA 3KAEA 1P5QA 4WUYA 3SWCA 4N3CA 2J9QA 5BNWA 3RU0A 1FCHA 3Q15A 4XIFA 3LYAA 2FF4A 3UQ3A 4IJDA 3PE4A 2JV0A 2C0MA 2XCBA 3EDTB 5CPRB 5HQ8A 1MUFA 3F9ZA 5HI7A 3ZPJA 3DB5A 3ULQA 3QWVA 4GCNA 3UPVA 3URZA 1W3BA 4N3BA 1HZ4A 4AU7A 4NRHB 4Y6CA 5TH7A 3MV2B 4BTBA 1QQEA 2WPVA 3CV0A 5D0QD 5JIYA 4WNEA 4HOQA 1O9SA 3GZ1A 4FMUA 1MVHA 2IFUA 5FJYA 3QWPA 1WM5A 3OOIA 4I2WA 3FFLA 4WNGA 3RO2A 2Y4UA 2XCCA 5LSXA 2FEZA 3RO3A 4N2SA 3IEGA 4RG9A 2KCKA 3S8PA 4KYOB 3U3WA 4I17A 2XGOA 3OXGA 3MEKA 5LCWJ 1WAO1 1PEGA 2XGMA 4U0ZA 3CBOA 1H3IA 5EX3A 1NZNA 2V5FA 3CK8A 4YPAA 2W5ZA 2G46A 4NQ0A 2PQRA 3CVPA 3ASDA 5ARGA 2W5YA 4JDSA 3MO2A 4RZ0A 2UY1B 4NJ5A 2GW1A 5FZQA 4EQFA 3RJWA 5F59A 5KJMA 3CK7A 4APOA 2VYIA 3Q47B 2P58C 4GCOA 5FZSA 3AS5A 1ZKKA 2F69A 4UQYA 2VSYA 4GYOA 5LCWC 5DIZA 4I2ZA 3VUZA 4GA1A 1MVXA 2JLBA 2KCLA 3ZGQA 4YPEA 2FBNA 3CVQA 3GZ2A 2UY1A 2XGSA 4MI0A 3M57A 3F9XA 4I9EA 5JJ0A 3LY7A 5CHEE 2R5SA 3CKBA 3ASFA 3NF1A 4GZ3A 1B89A 3SZ7A 4ME2A 1HH8A 4WNFA 3M54A 2HR2A 2YQ8A 5EKQD 3LY8A 3TG4A 3SF4A 4GA0A 4U07A 3F9YA 2VSNA 1KT1A 3TG5A 2NC9A 2RFIA 2BUGA 1KLXA 5F6LA 1XNFA 1N6AA 2XEVA 3FWVA 5EX0A 3BO5A 3VV0A 2QPWA 1ELWA 4N2QA 3ASHA 4G23A 4J8DA 4JLGA 4QENA 2VGXA 5CCLA 4Z4PA 3HNAA 1HXIA 2BQZA 3RKVA 4H7XA 3WXXA 4BTAA 3MKRA 5KJLA 3F9WA 3CEQA 4BT8A 5F6KC 5AYFA 4CGVA 3ESKA 4YPUA 3N71A 1N3JA 5CCMA 2LSVA 4J8EA 3MO5A 5M72A 4O30A 3Q4AB 3GW4A 4GPKA 4GA2A 4YNMA 3CBMA 3O48A 5DBKA 2Q7FA 2VQ2A 2O8JA 3BEEA 3KMAA 4YNPA 3QDNA 2KCVA 2UWJG 4J0UA 4G25A 3CVLA 3VTYA 1IHGA 3ZN3A 4N5CA 1XQHA 1A17A 4BUPA 3ZHEB 5G05C 5TEGA 2L6JA 5TTFA 4GYWA 4CGWA 1ML9A 4J7FA 2HYZA 5T0MA 4GZ6A 3M55A 4NVQA 3S7FA 4U0UA 3KS2A 1YA0A 3CKCA 4WNDA 3MV3B 4QEOA 3RJVA 2FO7A 2C0LA 4AY6A 1IYGA 5G05J 5JJ7A 4HOTA 4AIFA 3FPDA 3RIBA 3Q49B
chains in the Genus database with same CATH superfamily
1D8DA 1GW6A 1A5EA 4W9RA 2X3MA 3Q7FA 2QZAA 3LY9A 5FZRA 2DVWA 5ARFA 1LTXA 4EZKA 5EYPF 3EJNA 5AIJA 3SD5A 4H12A 5CERB 4MI5A 5CBOA 2WXJA 4Q94A 4J8OA 4AY5A 4L2LA 3JXJA 4C0EA 4G1TA 1TNYA 5BW8C 3S7DA 3FUIA 3K9IA 3K5KA 2F0YA 4GPMA 5A7DB 3BG1B 3MO0A 2IOLA 1E96B 2VGYA 4HI9A 3IHYA 1TN8A 1ELRA 4L7TA 2YHCA 4K0RA 2L6BA 1UN9A 3L6AA 4B94A 4GZ5A 2YHEA 2WQHA 3QC1A 1LD8A 3AAAC 5FTPA 2XHEA 2I6HA 2ZU6B 3V2OA 1S63A 5FINA 5F5EA 4TRQA 3OS5A 1V55E 2F8XK 3LXUX 3OTNA 3CHRA 4N39A 1Q2ZA 2BKGA 4QQIA 5BXOA 1E90A 3KEAA 4G24A 3PUJA 3TWRA 3ZU7B 1INZA 3Q7AA 4JL0A 2MRIA 4J83A 2PZIA 4NIKA 4HORA 3D9LA 4U95D 4IRUA 4Y6WA 4R7LA 4ZFHA 1TJCA 4BEPA 3RAYA 4ANXA 3CSTA 4E47A 3DXKG 4BX9A 3KMJA 1OWMA 2WXQA 1RZ4A 5JJ6A 4AV7A 3SW9A 4QEPA 4UQXA 2E0IA 4OAVB 2P9IG 4HRNA 1BD8A 3FTUA 2F8YA 3G2SA 3EHNA 2F37A 3DSTA 4BWRA 5AN8A 4PS7A 3TGOA 2WB2A 2CHWA 5KJKA 2WQ7A 3BQOA 4JB8P 3ZIMA 4N3CA 2MYOA 3C3OA 3AG2E 5BNWA 3ZNGA 3QB2A 3Q15A 3C3RA 4GMLA 3LYAA 5EN5D 5T3RA 3UQ3A 4IJDA 3PE4A 3HG0D 2XCBA 4FLBA 1MUFA 5HI7A 2P9PG 4BESA 3URZA 3MKQB 3ASNE 5T8IA 4TV3A 2X6KA 4PS8A 3QNKA 3L17A 3MV2B 4WWPA 3RK6A 5J90A 4U7EB 3ONKA 3CV0A 4U8VD 5D0QD 2ZGGA 3PZ4A 3GZ1A 4FMUA 3DPYA 3MKQA 5LOZA 5JHBA 1H0AA 4WNGA 3TJPA 5KNGA 2Y4UA 5LSXA 2P9NG 3RO3A 4N2SA 3UINC 2KCKA 4KYOB 3U3WA 5A23A 1BI7B 2KM4A 2P9SG 2VGEA 1BLXB 3NQPA 3BUAA 2XEHA 2XEEA 3Q78A 4AVXA 4B8AA 5EX3A 3RRUA 1OCRE 4FADA 2G46A 3BU8A 2H6HA 2EIJE 2RD0A 5E76A 3MO2A 4RZ0A 5IY5E 2J4BA 5KJMA 2VYIA 4LNUD 3FU0A 3MZLB 5FZSA 3KSLA 3LDZA 3ZXSA 4UQYA 4GYOA 4HXIA 3L16A 3VUZA 3TWQA 1H6KA 4J8SA 2ETAA 4LSZE 2VJ8A 4GZCA 3ABLE 1TR4A 3LY7A 4YDWA 4GTTA 4NURA 3QARA 5EDSA 4WNFA 4GMRA 2HR2A 5ANRA 3ZVVA 3EU9A 1N4SA 4JC8A 3SF4A 4GA0A 3FUEA 5EYLA 4DX7D 2VSNA 1XNFA 2Y1LE 2XEVA 5EX0A 3BO5A 1Y6IA 2WXPA 4AOFA 4RVBA 4N2QA 2BF0X 3BG0B 4J8DA 3I5PA 2VGXA 4CCAA 3PREA 5CCLA 4Z4PA 2I1JA 3U66A 3FH5A 1IQUA 3WG7E 2EQXA 5KJLA 3CEQA 2WXRA 5F6KC 4JHKA 1HS6A 4TXRA 3PRZA 4UWGA 3ULYA 1IQRA 2X6JA 3FUFA 3N71A 5CCMA 5M72A 3FUMA 4O30A 3IV0A 4KZCA 2V4LA 4JPSA 2R2LA 3O48A 5DBKA 2NSZA 1FT1A 2O8JA 3ZW3A 3AU4A 3JQ0A 5C2YA 1UN8A 1K3ZD 3JUIA 4FP7A 4G25A 3CVLA 3FU6A 3TWTA 1XQHA 4O60A 4OVUA 1Z3XA 4BUPA 5G05C 1PAQA 2R59A 4I43A 4J7FA 3LJNA 3E37A 5AQBA 3LEWA 2DYSE 2WXFA 2GRPB 4C0MA 3RJVA 4G11A 5G05J 4HNAD 4XE0A 5KNHD 3PNTB 2PQNA 1H2TC 1TNZA 3Q9UC 3FTWA 2AJAA 1NA0A 1OWNA 5HS0A 4XX5A 4GAAA 5G04J 5G2NA 3EIQC 1EDUA 4BETA 3OXLA 4KXKB 3SGHA 1TNBA 2BKKB 2LUHA 3Q5MA 4IYPA 5CEAA 4F3VA 4JHRA 4C1QA 4HOSA 4YVOA 2J49A 1N9AA 2WXNA 4Q96A 2XPIA 5B3SE 4EZJA 3C3QA 2NXPA 4PH4B 3KD7A 3TXNA 3RQ4A 4GU5A 4IULA 4RG6A 2KXPC 3O4ZA 4KZ0A 5JMND 3PEUB 3CK9A 1SZAA 3RRMB 1EYHA 3ONLA 4YNDA 4LEUA 3CGHA 1JCSA 3CIAA 4LRZA 1TN6A 4ANUA 4M3OA 4O1OA 3UTMA 4HRMB 4FHJA 3UKRG 3D9OA 4JA7A 5A6CA 4I6GA 1WG0A 3E32A 1ZU2A 3QOUA 4WWNA 3VLEA 3S7JA 5BPPA 2WMOA 4A63B 2H6FA 2QY7A 5JJTA 3GYZA 4V3IA 2IOSA 2B6CA 4FJYA 4GTRA 3LKUA 2EIKE 2GRLA 3D9MA 3DEPA 3FTXA 4MS6A 1N6CA 1YYHA 5D2MC 4AIFA 1MX4A 2VGXB 3SQVA 3MX3A 3M53A 1FT2A 1TN7A 3KEZA 2DBAA 2LSUA 2KC7A 3UKUG 5T4YA 2VSOE 4ZHBA 3DEOA 4XKCA 4DLOA 1HF8A 4K5BA 1TEZA 5AJDA 4B0ZA 3RU0A 1FCHA 3JUEA 4XIFA 2FF4A 3G2WA 5CEDB 3S2AA 3DSWA 1PY1A 2C0MA 5JA4D 2PM6A 3VLDA 3AJIA 4GTPA 2A5UA 3F9ZA 5CMYA 3ZPJA 1TNOA 3ULQA 3UPVA 3IHVA 2IO2C 3LJ3A 3CVYA 4N3BA 2P9LG 3UM0A 2CFZA 1ELKA 1QQEA 3FU5A 3SBTB 3V30A 3ABME 3ABKE 1KZPA 3E30A 3IXEA 4WAFA 1O9SA 2IY0C 4EZLA 3QWPA 5ANLA 4EHMA 4G8KA 3FFLA 3RO2A 1LF8A 2R03A 2FEZA 3KSQA 1SVXA 4DX2A 3IEGA 5KWDA 3HVEA 3PZ3A 4RG9A 3S8PA 2BTDA 4LUNU 3U64A 2XQ0A 4E85A 3OXGA 5BV1A 4DLQA 4P29A 3PEVB 5AJLA 2AXZA 4NQ0A 1LD7A 4F7AA 3FUDA 3HVEB 4OVVA 2PQRA 4D10C 2ZXWE 3ASDA 2UY1B 4NJ5A 4EQFA 4E6HA 3CK7A 1OXJA 2QC9A 3EUVA 2QYUA 3P1UA 1JCRA 4RSYA 5DIZA 4I2ZA 3FUJA 4FU3A 5LCWC 2V4HC 3P2BA 2KCLA 3CVQA 5JHAA 2UY1A 4JEHA 2XGSA 1DNPA 1Z3YA 3TWSA 3SI5A 4I9EA 4LNGA 5H7PA 5CHEE 3ASFA 4GZ3A 4F6RD 3HHMA 1O1SA 1U3CA 2XENA 2YQ8A 4JD2G 3SFZA 2Y0BG 3MGBA 3L22A 3Q79A 4YDOA 4U07A 3HIZA 2RFIA 1KLXA 4PDXA 1WY6A 1OWOA 2VTBB 1DCQA 3DSVA 3MYVA 1E8WA 2J07A 2HE0A 4ANWA 1DC2A 1ELWA 4DJAA 3LS8A 4JLGA 5FQ7A 2NYJA 3RKVA 4H7XA 1N4RA 3WXXA 3EHQA 3MKRA 3F9WA 2L0TB 4U8YD 4LNBA 3CHQA 1XGWA 4DX6D 3DXMG 1BU9A 3SFXA 1N3JA 4RLYA 2LSVA 1HU3A 2AXUA 4GA2A 5FQ4A 3ZYKA 3CBMA 4M7CA 3L82A 4HLLA 4DX5D 2H6GA 4KVMA 3MJWA 4UWKA 4YNPA 2J4DA 3U9WA 4J0UA 1N11A 3VTYA 3L9TA 2RFAA 1IHGA 1RW2A 4N5CA 4UWLA 3T8KA 2X6IA 3ZHEB 2AW6A 3I4GA 2L6JA 3HXEA 1ML9A 2LXMA 4I1OB 5CRUA 3KS2A 4EBAG 4PUCA 5CRVA 2V8SE 4XZ4A 1O5MA 3MV3B 5ENOD 1SA5A 1IYGA 4C48B 5JJ7A 3FPDA 3RIBA 3Q49B 3FDHA 4C9BB 5AARA 3ISMC 3RRNB 3B95A 4QFVA 4JHJA 3HXFA 1H6OA 4BT9A 4ILHB 3UT8A 3B13A 3JYSA 3M56A 3SHFA 3PVLA 3AS8A 4XI0A 1G3NB 2YNQA 3OXFA 4BX8A 3GZSA 4HI8A 4HOUA 5T5GA 2KZTB 1SW6A 4KBQA 4IJ8A 1NI1A 3ZXPA 3CBPA 2L9BA 5G55A 3OPEA 2E2EA 1MJ0A 2LAIA 4DI3A 3APCA 3W9FA 3CVNA 1OCZE 3M58A 2OV8A 2Y4TA 4UQZA 5JINA 3UIOC 3S7BA 4YVQC 5KCMA 4EECA 5T0KA 3ZFWA 3U4TA 4JZYA 1E7VA 4G2VA 4HLEA 5BXUA 4I51A 4XKBA 1ZBPA 2WXOA 1MQSA 3DALA 2XRYA 5KJNA 1FPPA 1L5JA 4L1BA 5CECB 3LCAA 2CHXA 4U96D 2QFCA 3D9IA 2ONDA 2MOWA 3TXMA 4CDRA 1MT6A 1EPUA 5LFAA 1NA3A 5ENTD 1VDYA 5AYWD 1O1TA 3LVQE 1BI8B 5G04C 1DCEA 2OOEA 4CEMA 3ASOE 2A5EA 4HFGA 1PC2A 4KVOA 2IGQA 3ESLA 4IN3B 4BERA 3UT4A 4HVBA 4BSXA 4J7IA 1X81A 5LP0A 4GTQA 4F1PA 3UUXA 1OUVA 2AXVA 4N5QA 3TAXA 4GYYA 4CDNA 2HO1A 4DI4A 4ANVA 3CHSA 4YDYA 4ILGA 3FP3A 1MZCA 4UI9K 4AM9A 1QZ2A 4ABNA 2I1KA 2CFUA 2R17C 3AG1E 3EU5A 4FA6A 2V0PA 3PDNA 1IXVA 1NL4A 1V54E 2GGFA 2RFMA 4FHKA 4AEZC 4TXPA 4J8FA 1HG5A 3D9KA 4FULA 5D66A 2KZTA 1P5QA 2KBXA 1KZOA 5AQAA 1AP7A 4ATZD 4GTSA 2JV0A 3V2XA 3PZ1A 3EDTB 5CPRB 2Y69E 1N95A 3ZYLA 3LVRE 5FWQA 1MX6A 3T5XA 1D8EA 1SZ9A 3W9GA 5ITZF 4AU7A 3DPDA 3PZ2A 4Y6CA 5TH7A 1ZB1A 2WPVA 4CRWA 1QYMA 4FLHA 3Q73A 4UUCA 2I2OA 3CVXA 1MVHA 2IFUA 5FJYA 2VSXE 3IBEA 1DVPA 4I2WA 3PUKA 4OAUC 3CHOA 2DWZA 1OWPA 4KT6B 4I17A 3MEKA 5LCWJ 1PEGA 2R05A 4X8QA 3JQ1A 3CBOA 4Q69A 3FULA 2V5FA 4RQIA 3CK8A 2W5ZA 2OCCE 4BFRA 4TXQA 4U8HA 4DRXE 3ZRHA 5ARGA 1N4QA 1D9SA 5ENQD 2OEWA 3G2UA 3PS6A 5F59A 4APOA 2P9UG 3HXCA 2P58C 4GCOA 3FTYA 5J08A 2WQ6A 2WXIA 1ZKKA 1E8YA 3NOGD 4LERA 3ML9A 1MVXA 3ZGQA 1FVFA 4YPEA 2FBNA 3CVVA 4GTMA 3CLJA 5JJ0A 2WXLA 2LXLA 3CKBA 4AXHA 1B89A 3SZ7A 4ME2A 3EIJA 1HH8A 3HDXA 2VTBA 3CSFA 1H2UA 5EKQD 3OAWA 3LY8A 1QNFA 2EINE 3TG4A 1Z6TA 4NACA 4CYMD 1KT1A 2NC9A 1S70B 5BUZA 3FWVA 2OEVA 3RSEG 3VV0A 4G23A 4QENA 1UG3A 2BQZA 2LO6A 4EBAA 4BTAA 1AWCB 2HM8A 4BT8A 3NAWA 2DIWA 3CVWA 3EHRA 5AYFA 4CGVA 4F53A 3SBSA 1OWLA 2B0OE 2P9KG 2X6FA 2J09A 3FUNA 1HFAA 1UW4B 2IU1A 2EIME 3Q4AB 3GW4A 4GPKA 4YNMA 2QYJA 1HX8A 1FVHA 2VQ2A 3BEEA 4URKA 4CZ2D 2KCVA 4GTVA 3T5VA 2OVBA 3HRAA 2RG8A 3D3MA 4GB9A 1A17A 3SO8A 5TEGA 1JPLA 4GYWA 5B1AE 3CQGB 2HYZA 4GZ6A 3M55A 4NVQA 3L13A 3S7FA 2WXHA 3CKCA 3FEXA 4F1SA 4B93B 2XPYA 4HOTA 2PL2A 1Y8MA 5C1DA 3TWVA 4I9CA 3M59A 4UI9C 3R9AB 3NBNB 3T9KA 2H6IA 2FO1E 4JEUA 4H7YA 3PE3A 1K8KG 3FH7A 5AQ7A 3DRAA 4DUIA 3PZDA 3ZHEA 1YCSB 2IEJA 2ZISA 3E34A 5FQ6A 3UX4A 2C2LA 4JA9A 3RAUA 1HG2A 4N3AA 3ZEFA 3C72A 3FU3A 2FI7A 3CHPA 5KBAA 1N0RA 2IF4A 3HYMB 1N94A 3AG3E 3FTSA 1O1RA 2CG2A 2WVIA 5ENRD 3G2TA 4O6FA 4L2YA 1U3DA 4GZDA 5LX8A 1S0PA 5HKPA 1UJJA 3TL5A 2GRMA 3SFYA 2DZOA 2LNIA 4OYSA 3PH0C 4I1AA 1OCCE 4XI9A 3M5AA 2WXKA 1OCOE 2GROB 3KMTA 3VTXA 1MX2A 3B7SA 3APFA 4LDGA 4HQDA 4U04A 1HO8A 5CMWA 3ML8A 3EP0A 1E7UA 3D9PA 4MKTA 4U63A 1H6PA 3AS4A 2ETCA 3D9HA 2A4ZA 2DCPA 3MCXA 3C98A 1N54A 3ASGA 3Q9NC 5FT9A 3FUKA 5FQ8A 3VLFA 2AVPA 1JWGA 2ZGDA 3G2VA 3E4BA 4APFA 3TWUA 3HXBA 2Y3AA 2JEKA 2R3AA 2IQCA 2BEDA 3R9MA 2PNNA 1KT0A 3MA5A 3DSXA 3QWWA 4L9PA 4O1PA 3UM1A 5EIBE 2M63A 3SY2A 1UJKA 3NOCD 2XZDG 5JHNA 3R7RA 5LSZA 2R02A 4JW1A 3LPZA 4A1SA 1TJFA 2WMNA 3FH8A 2ILRA 5AENA 1OT8A 4U0SA 4UI9J 2RKKA 3QKYA 3CQCB 2GRQB 2IJGX 2KATA 3J5QB 1X5BA 5FIOA 2XS1A 4JXTA 3ZYQA 2GRRB 3F6QA 2WXMA 5D0OD 5BT1A 3UMVA 2WXGA 3I4RB 4ACLA 3B7BA 3IHXA 5EG2A 3APDA 4PS3A 3D9JA 4G26A 3CVUA 2XS8A 1MYOA 2MHKA 3KAEA 3IKOB 4MBGA 4WUYA 4CT0A 3SWCA 5ENSD 1JWFA 2J9QA 4I1MA 2J8SD 1U2VG 2WM9A 2YINA 4HRLA 4DX1A 3C5RA 4I6JA 5HQ8A 3DSUA 4UWFA 2J08A 3DB5A 2AWIA 4HS2A 4J6IA 3QWVA 4GCNA 1EF1C 1W3BA 1NP7A 1N4PA 4MRUA 3FY4A 3SNXA 1HZ4A 4J8YA 3DBSA 4NRHB 4YDEA 4ATGA 1K1BA 4BTBA 3V79K 3DWLG 1N0QA 3TWXA 5JIYA 4WNEA 4HOQA 2DZNA 4KMOA 2FULA 2XZTG 3FTZA 3TWWA 1WM5A 3OOIA 3UI2A 2XCCA 4MLPA 3HXDA 2XGOA 4L23A 3CHMA 1WAO1 5E75A 3UT7A 2XGMA 4CDMA 4ACKA 4U0ZA 3FEYA 3T8MA 2OVFA 1H3IA 3NB2A 3EHMA 4K5AB 1NZNA 4YPAA 5ENPD 4AP2A 3CVPA 2W5YA 4JDSA 1JUQA 3QJZA 3QK0A 4K03A 2GRNB 3E33A 2GW1A 4TUUA 5FZQA 4EPZA 1K1AA 3RJWA 2LAHA 3Q47B 5HRYA 3Q75A 3AS5A 2F69A 2VSYA 1TNUA 5AAOA 4GA1A 2JLBA 3UM3A 3GZ2A 4DK5A 4MI0A 4I6EA 4Z68A 3B7UX 3M57A 2XRZA 3F9XA 1IHBA 1HE8A 4DPRA 4GTOA 2R5SA 4A1GA 3FUHA 3NF1A 1UOHA 1TYQG 3JXIA 2CHZA 3M54A 3ENEA 1SA4A 2PM7A 2IO3C 2EILE 3FTVA 3UXGA 1NFIE 3J5PA 5ENNA 3X2QE 3QAQA 2P2CP 3F9YA 2IONA 3TG5A 4HB5A 2BUGA 5F6LA 1MHQA 5CBNA 1N6AA 4B89A 2ETBA 2ZIRA 4LCTA 3B7TA 1QBQA 3D9NA 2QPWA 3NZSA 3CR3A 3ASHA 3ZKJA 1E8XA 3ZYMA 4JVSA 3UM2A 5EILA 1S64A 3HNAA 1HXIA 1H2VC 3ULEG 1N52A 4A3TA 1JCQA 2X38A 1E8ZA 4G8LA 2L0IA 1WDYA 4K5CA 3AU5A 3ZUVB 4GMJA 4A3VA 3AG4E 3ESKA 4YPUA 3DSSA 4B8CB 4J8EA 2V5QC 3MO5A 3V31A 3UIPC 5BV0A 5B1BE 3NZUA 5AQ9A 4ILIA 4FC8A 4BSZB 4A55A 2Q7FA 4UWHA 4HBDA 3KMAA 4LG6A 3QDNA 1H19A 4BY6A 2UWJG 1Z5SC 4TUMA 3JCKC 3ZN3A 4XEIG 5EIDA 3B7RL 2XPZA 2CG3A 5TTFA 1SQMA 1IKND 1KPSB 4CGWA 4FJZA 2I9CA 2DYRE 1BPOA 5T0MA 2JABA 4U0UA 1YA0A 1YMPA 3R7QA 4J7WA 3L08A 3PNLB 4WNDA 4QEOA 1OY3D 3L54A 2FO7A 2C0LA 2X6HA 4AY6A 4CT4A 3FHEA 3I3NA 4WWOA 4AJWA
chains in the Genus database with same CATH topology
3FDHA 2PL2A 1Y8MA 5C1DA 1GW6A 2PQNA 3PNTB 4I9CA 4W9RA 2X3MA 4C9BB 3M59A 4UI9C 3R9AB 4JEUA 3RRNB 3LY9A 4H7YA 5FZRA 1H2TC 3PE3A 3FH7A 3FTWA 5ARFA 4EZKA 4QFVA 4JHJA 3PZDA 3ZHEA 4BT9A 1NA0A 3EJNA 4ILHB 5AIJA 5FQ6A 3SD5A 3UX4A 4H12A 1OWNA 3UT8A 2C2LA 4JA9A 4GAAA 3B13A 3JYSA 4XX5A 3M56A 1HG2A 2WXJA 4N3AA 3PVLA 4Q94A 3SHFA 3FU3A 3ZEFA 3AS8A 2FI7A 3CHPA 5G04J 4J8OA 4XI0A 3OXFA 2YNQA 4BX8A 2IF4A 3GZSA 4HOUA 5G2NA 5T5GA 2KZTB 3EIQC 1EDUA 3HYMB 4AY5A 4L2LA 4C0EA 4G1TA 4KBQA 3OXLA 5BW8C 4IJ8A 3CBPA 3S7DA 3FUIA 2L9BA 3K9IA 5G55A 3FTSA 3K5KA 3OPEA 5A7DB 2E2EA 2LAIA 3BG1B 2CG2A 4KXKB 2IOLA 2WVIA 3SGHA 4DI3A 3APCA 3MO0A 3CVNA 1E96B 2VGYA 3G2TA 4O6FA 4L2YA 3M58A 3IHYA 2OV8A 2Y4TA 3Q5MA 1U3DA 4GZDA 4IYPA 5LX8A 1S0PA 4UQZA 4WWOA 1ELRA 1UJJA 3TL5A 4F3VA 2GRMA 4JHRA 4L7TA 2YHCA 5JINA 4C1QA 2LNIA 4K0RA 4OYSA 3S7BA 4HOSA 4YVQC 3PH0C 4I1AA 4XI9A 2J49A 4YVOA 5KCMA 3ZFWA 4EECA 2WXNA 3U4TA 3M5AA 4JZYA 1E7VA 1UN9A 2WXKA 3L6AA 4B94A 4G2VA 4HLEA 4I51A 4GZ5A 4Q96A 4XKBA 1ZBPA 2XPIA 2WQHA 2YHEA 3QC1A 3KMTA 3VTXA 4EZJA 5FTPA 2XHEA 2WXOA 2NXPA 2I6HA 3B7SA 3APFA 1MQSA 3DALA 2ZU6B 4LDGA 5F5EA 2XRYA 4U04A 1HO8A 4PH4B 3KD7A 3ML8A 5CMWA 5KJNA 3EP0A 1L5JA 1E7UA 3D9PA 4MKTA 4L1BA 4U63A 3TXNA 4TRQA 3OS5A 3AS4A 3RQ4A 3LCAA 3VUZA 4GU5A 2CHXA 3LXUX 2QFCA 4IULA 3D9IA 2A4ZA 2DCPA 3MCXA 4RG6A 3C98A 3OTNA 1N54A 3ASGA 3O4ZA 3CHRA 2ONDA 2MOWA 3TXMA 4N39A 4CDRA 1EPUA 4KZ0A 1MT6A 5FT9A 3FUKA 5LFAA 5FQ8A 3VLFA 1NA3A 3PEUB 3CK9A 1SZAA 3RRMB 1VDYA 5AYWD 2AVPA 3LVQE 1EYHA 5G04C 3ONLA 1JWGA 2OOEA 3G2VA 1E90A 3E4BA 4CEMA 4APFA 4YNDA 4LEUA 3CGHA 3CIAA 4G24A 4HFGA 4LRZA 1PC2A 3PUJA 4KVOA 4ANUA 2Y3AA 2JEKA 2R3AA 4M3OA 2IGQA 2IQCA 3ESLA 1INZA 4IN3B 1KT0A 4JL0A 2MRIA 4FHJA 3UT4A 4HVBA 3MA5A 4BSXA 3D9OA 4J83A 4J7IA 2PZIA 3QWWA 4JA7A 5A6CA 4I6GA 2M63A 4HORA 1UJKA 3D9LA 5JHNA 1ZU2A 5LP0A 3QOUA 4WWNA 4IRUA 3UUXA 4Y6WA 3R7RA 1OUVA 3VLEA 5LSZA 3S7JA 4R7LA 5BPPA 2AXVA 1TJCA 2WMOA 3TAXA 4JW1A 4GYYA 3LPZA 4A1SA 1TJFA 3RAYA 4CDNA 2HO1A 4ANXA 2QY7A 2WMNA 3CSTA 3FH8A 2ILRA 4DI4A 5AENA 5JJTA 4U0SA 4UI9J 4BX9A 4E47A 4ANVA 3CHSA 3QKYA 3GYZA 3KMJA 3CQCB 4ILGA 1OWMA 4V3IA 2IOSA 3FP3A 4FJYA 2WXQA 2IJGX 2KATA 4UI9K 4AM9A 3LKUA 1QZ2A 1X5BA 4ABNA 2I1KA 2CFUA 2R17C 3D9MA 2GRLA 5JJ6A 4AV7A 4JXTA 3ZYQA 3SW9A 4QEPA 3FTXA 2WXMA 4FA6A 4MS6A 5D0OD 5BT1A 3UMVA 1N6CA 2V0PA 2WXGA 3I4RB 3PDNA 4ACLA 4UQXA 3IHXA 5EG2A 4AIFA 2GGFA 2E0IA 2VGXB 3APDA 3MX3A 4FHKA 4PS3A 4AEZC 3M53A 3D9JA 3FTUA 3G2SA 4J8FA 1HG5A 3D9KA 3EHNA 4G26A 3KEZA 2DBAA 2LSUA 4BWRA 2KC7A 4FULA 5T4YA 3CVUA 4PS7A 3TGOA 2MHKA 2VSOE 2WB2A 2CHWA 5KJKA 2WQ7A 4XKCA 4DLOA 1HF8A 1TEZA 5AJDA 2KZTA 3KAEA 1P5QA 3IKOB 4WUYA 3ZIMA 4CT0A 4N3CA 3SWCA 4B0ZA 1JWFA 2J9QA 5BNWA 3RU0A 4I1MA 1FCHA 3QB2A 3Q15A 4XIFA 2WM9A 3LYAA 2FF4A 4GMLA 5T3RA 3G2WA 3UQ3A 4IJDA 3S2AA 2YINA 1PY1A 3PE4A 2JV0A 2C0MA 2PM6A 2XCBA 3EDTB 3VLDA 5CPRB 4FLBA 4I6JA 5HQ8A 1MUFA 2A5UA 3F9ZA 5CMYA 3ZYLA 4UWFA 2J08A 3LVRE 5HI7A 3ZPJA 3DB5A 2AWIA 4HS2A 3ULQA 5FWQA 4J6IA 3QWVA 4GCNA 3UPVA 3URZA 3T5XA 1EF1C 1W3BA 1NP7A 4MRUA 3MKQB 3IHVA 1SZ9A 3FY4A 3LJ3A 3CVYA 3SNXA 4N3BA 5T8IA 1HZ4A 4AU7A 4TV3A 3DPDA 2X6KA 3DBSA 4NRHB 3QNKA 3L17A 4PS8A 2CFZA 3MV2B 4Y6CA 1ELKA 4WWPA 3RK6A 4ATGA 4BTBA 5TH7A 1QQEA 3FU5A 5J90A 2WPVA 3CV0A 3ONKA 3SBTB 4CRWA 5D0QD 4FLHA 5JIYA 4WNEA 4HOQA 1O9SA 4WAFA 3GZ1A 4KMOA 2I2OA 4FMUA 2FULA 3CVXA 1MVHA 2IFUA 5FJYA 4EZLA 2VSXE 3FTZA 3IBEA 1DVPA 3QWPA 3MKQA 1WM5A 5ANLA 4I2WA 5LOZA 5JHBA 3OOIA 3FFLA 1H0AA 3PUKA 4WNGA 3RO2A 3TJPA 1LF8A 3CHOA 2Y4UA 2XCCA 5LSXA 2FEZA 3RO3A 4N2SA 3IEGA 3HVEA 4RG9A 4MLPA 2KCKA 3S8PA 2BTDA 4KYOB 4LUNU 1OWPA 5A23A 3U3WA 2KM4A 4KT6B 4I17A 2XGOA 3U64A 2XQ0A 3OXGA 4E85A 3MEKA 3CHMA 3NQPA 4L23A 5LCWJ 1WAO1 5E75A 3UT7A 5BV1A 1PEGA 2XGMA 4CDMA 4ACKA 4DLQA 4U0ZA 3FEYA 3JQ1A 3T8MA 4AVXA 2OVFA 1H3IA 3CBOA 4Q69A 4P29A 4B8AA 3EHMA 3FULA 3PEVB 5EX3A 1NZNA 2V5FA 3RRUA 3CK8A 5AJLA 4YPAA 2W5ZA 4FADA 2G46A 2AXZA 4NQ0A 4BFRA 4F7AA 3FUDA 3HVEB 4OVVA 4U8HA 4AP2A 2PQRA 3CVPA 3ZRHA 4D10C 3ASDA 5ARGA 2W5YA 2RD0A 4JDSA 1JUQA 3QJZA 5E76A 3QK0A 3MO2A 4RZ0A 2UY1B 4K03A 4NJ5A 2J4BA 2GW1A 4TUUA 3G2UA 5FZQA 4EQFA 4EPZA 3RJWA 3PS6A 2LAHA 4E6HA 5F59A 5KJMA 3CK7A 4APOA 2VYIA 3Q47B 2P58C 3FU0A 3MZLB 3FTYA 4GCOA 5J08A 2WQ6A 5FZSA 2WXIA 3AS5A 1ZKKA 3LDZA 3ZXSA 1E8YA 2F69A 3P1UA 4LERA 4UQYA 2VSYA 3ML9A 3L16A 4GYOA 4HXIA 3FUJA 4FU3A 4I2ZA 4GA1A 4RSYA 5DIZA 5LCWC 1H6KA 1MVXA 3P2BA 2JLBA 1FVFA 2KCLA 3ZGQA 4YPEA 3CVQA 2FBNA 3GZ2A 4J8SA 5JHAA 2UY1A 4JEHA 4DK5A 3CVVA 2XGSA 2VJ8A 1DNPA 4GZCA 3B7UX 4I6EA 1Z3YA 3CLJA 3M57A 4MI0A 2XRZA 3F9XA 3SI5A 4I9EA 1HE8A 5JJ0A 2WXLA 4DPRA 3LY7A 5CHEE 2R5SA 4A1GA 3CKBA 3FUHA 3ASFA 3NF1A 4GZ3A 4AXHA 1B89A 3SZ7A 4ME2A 3EIJA 4NURA 1HH8A 3QARA 5EDSA 4WNFA 2CHZA 3M54A 3HHMA 3ENEA 2HR2A 1U3CA 2PM7A 5ANRA 2YQ8A 2VTBA 3CSFA 3ZVVA 3SFZA 1H2UA 3FTVA 4MI5A 3MGBA 5EKQD 3OAWA 3L22A 1QNFA 3LY8A 4JC8A 3TG4A 1Z6TA 3SF4A 5ENNA 4GA0A 3QAQA 4U07A 4NACA 3FUEA 3F9YA 2IONA 3HIZA 2VSNA 1KT1A 3TG5A 2NC9A 2RFIA 2BUGA 1KLXA 4PDXA 1MHQA 1XNFA 1WY6A 2XEVA 1N6AA 5F6LA 4B89A 1OWOA 3MYVA 3FWVA 5BUZA 2VTBB 1E8WA 2J07A 5EX0A 4ANWA 3BO5A 4LCTA 3VV0A 1Y6IA 2WXPA 3B7TA 3D9NA 4AOFA 2QPWA 3NZSA 1ELWA 4RVBA 3CR3A 3ASHA 4DJAA 4N2QA 1E8XA 2BF0X 3LS8A 3ZYMA 4G23A 3BG0B 4J8DA 4JVSA 4JLGA 4QENA 3I5PA 2VGXA 4CCAA 3PREA 5CCLA 5FQ7A 1UG3A 3HNAA 2I1JA 4Z4PA 1HXIA 3U66A 2BQZA 5T0KA 3RKVA 2LO6A 3FH5A 1H2VC 4H7XA 4EBAA 1IQUA 3WXXA 4BTAA 1N52A 2EQXA 4A3TA 3MKRA 2X38A 5KJLA 1E8ZA 3F9WA 2L0TB 2HM8A 3CEQA 2WXRA 4BT8A 4JHKA 5F6KC 1HS6A 2DIWA 3CVWA 2L0IA 3PRZA 5AYFA 3CHQA 4UWGA 1XGWA 4CGVA 3AU5A 4F53A 4GMJA 4A3VA 1IQRA 2X6JA 3FUFA 3ESKA 3SBSA 4YPUA 1OWLA 3N71A 1N3JA 2X6FA 2J09A 3FUNA 4B8CB 1HFAA 1UW4B 2LSVA 4J8EA 2IU1A 5CCMA 1HU3A 3FUMA 5M72A 3MO5A 4O30A 3IV0A 4KZCA 2V4LA 3Q4AB 4JPSA 3GW4A 5BV0A 4GPKA 2AXUA 3NZUA 4GA2A 5FQ4A 4ILIA 3ZYKA 4YNMA 3CBMA 3O48A 4FC8A 5DBKA 4A55A 1HX8A 1FVHA 2Q7FA 4UWHA 2NSZA 2VQ2A 2O8JA 4KVMA 3ZW3A 3AU4A 3JQ0A 5C2YA 3BEEA 1UN8A 3KMAA 4URKA 3MJWA 3JUIA 4UWKA 4YNPA 2J4DA 4FP7A 3QDNA 2KCVA 1H19A 4BY6A 2UWJG 3T5VA 3U9WA 4J0UA 4G25A 3CVLA 3FU6A 3VTYA 2OVBA 1IHGA 2RG8A 3JCKC 4N5CA 4UWLA 3ZN3A 1XQHA 3D3MA 4GB9A 1A17A 1Z3XA 2X6IA 4OVUA 4BUPA 3ZHEB 2AW6A 5G05C 5TEGA 3B7RL 3I4GA 2XPZA 2R59A 1PAQA 2CG3A 2L6JA 5TTFA 1SQMA 1JPLA 4GYWA 4I43A 4FJZA 4CGWA 1ML9A 3CQGB 4J7FA 2I9CA 4I1OB 2HYZA 1BPOA 5T0MA 4GZ6A 3M55A 4NVQA 3L13A 3S7FA 3LEWA 2WXHA 4U0UA 3KS2A 4EBAG 1YA0A 3CKCA 4PUCA 3R7QA 2WXFA 3L08A 3PNLB 4WNDA 2V8SE 3FEXA 4XZ4A 3MV3B 4QEOA 4C0MA 3L54A 4F1SA 3RJVA 2FO7A 4G11A 2XPYA 2C0LA 2X6HA 4AY6A 1IYGA 4CT4A 5G05J 3FHEA 4XE0A 5JJ7A 3I3NA 4HOTA 3HDXA 3FPDA 3RIBA 3Q49B 4AJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PL2 A;  1Y8M A;  5C1D A;  2PQN A;  4I9C A;  4W9R A;  3M59 A;  4UI9 C;  3R9A B;  3LY9 A;  4H7Y A;  5FZR A;  3PE3 A;  5ARF A;  3ZHE A;  4BT9 A;  1NA0 A;  4H12 A;  2C2L A;  4JA9 A;  3M56 A;  3JYS A;  4MI5 A;  4N3A A;  4J8O A;  3AS8 A;  2FI7 A;  5G04 J;  4XI0 A;  3OXF A;  2IF4 A;  4HOU A;  5T5G A;  3HYM B;  4AY5 A;  4G1T A;  4KBQ A;  3OXL A;  5BW8 C;  4IJ8 A;  3CBP A;  3S7D A;  3K9I A;  3K5K A;  3OPE A;  5A7D B;  2E2E A;  4KXK B;  3MO0 A;  3CVN A;  1E96 B;  2VGY A;  4O6F A;  3M58 A;  3Q5M A;  2Y4T A;  4UQZ A;  1ELR A;  4F3V A;  4JHR A;  5JIN A;  2YHC A;  4C1Q A;  2LNI A;  4HOS A;  3S7B A;  4YVQ C;  4YVO A;  4I1A A;  4XI9 A;  5T0K A;  3ZFW A;  3U4T A;  3M5A A;  4B94 A;  4G2V A;  4I51 A;  4GZ5 A;  1ZBP A;  2XPI A;  2WQH A;  3KMT A;  3VTX A;  5FTP A;  2I6H A;  4LDG A;  3DAL A;  5F5E A;  4U04 A;  3EP0 A;  3KD7 A;  5KJN A;  3OS5 A;  3AS4 A;  3RQ4 A;  3LCA A;  2QFC A;  4RG6 A;  3ASG A;  2OND A;  4CDR A;  4N39 A;  1MT6 A;  5FT9 A;  1NA3 A;  3CK9 A;  5AYW D;  2AVP A;  5G04 C;  2OOE A;  3E4B A;  4YND A;  4LEU A;  4G24 A;  1PC2 A;  2R3A A;  2IGQ A;  4IN3 B;  1KT0 A;  4JL0 A;  3MA5 A;  4J83 A;  4J7I A;  2PZI A;  3QWW A;  4JA7 A;  5A6C A;  4HOR A;  5JHN A;  1ZU2 A;  3QOU A;  3UUX A;  4Y6W A;  1OUV A;  5LSZ A;  3S7J A;  1TJC A;  3TAX A;  4GYY A;  3LPZ A;  4A1S A;  3RAY A;  2HO1 A;  5JJT A;  4E47 A;  4U0S A;  4UI9 J;  3QKY A;  3GYZ A;  3KMJ A;  3FP3 A;  2KAT A;  4UI9 K;  4AM9 A;  3LKU A;  1QZ2 A;  4ABN A;  5JJ6 A;  3SW9 A;  4QEP A;  5D0O D;  5BT1 A;  1N6C A;  3PDN A;  4UQX A;  3IHX A;  5EG2 A;  2VGX B;  3M53 A;  4J8F A;  4G26 A;  2DBA A;  2LSU A;  4BWR A;  2KC7 A;  3TGO A;  2MHK A;  5KJK A;  3KAE A;  1P5Q A;  4WUY A;  3SWC A;  4N3C A;  2J9Q A;  5BNW A;  3RU0 A;  1FCH A;  3Q15 A;  4XIF A;  3LYA A;  2FF4 A;  3UQ3 A;  4IJD A;  3PE4 A;  2JV0 A;  2C0M A;  2XCB A;  3EDT B;  5CPR B;  5HQ8 A;  1MUF A;  3F9Z A;  5HI7 A;  3ZPJ A;  3DB5 A;  3ULQ A;  3QWV A;  4GCN A;  3UPV A;  3URZ A;  1W3B A;  4N3B A;  1HZ4 A;  4AU7 A;  4NRH B;  4Y6C A;  5TH7 A;  3MV2 B;  4BTB A;  1QQE A;  2WPV A;  3CV0 A;  5D0Q D;  5JIY A;  4WNE A;  4HOQ A;  1O9S A;  3GZ1 A;  4FMU A;  1MVH A;  2IFU A;  5FJY A;  3QWP A;  1WM5 A;  3OOI A;  4I2W A;  3FFL A;  4WNG A;  3RO2 A;  2Y4U A;  2XCC A;  5LSX A;  2FEZ A;  3RO3 A;  4N2S A;  3IEG A;  4RG9 A;  2KCK A;  3S8P A;  4KYO B;  3U3W A;  4I17 A;  2XGO A;  3OXG A;  3MEK A;  5LCW J;  1WAO 1;  1PEG A;  2XGM A;  4U0Z A;  3CBO A;  1H3I A;  5EX3 A;  1NZN A;  2V5F A;  3CK8 A;  4YPA A;  2W5Z A;  2G46 A;  4NQ0 A;  2PQR A;  3CVP A;  3ASD A;  5ARG A;  2W5Y A;  4JDS A;  3MO2 A;  4RZ0 A;  2UY1 B;  4NJ5 A;  2GW1 A;  5FZQ A;  4EQF A;  3RJW A;  5F59 A;  5KJM A;  3CK7 A;  4APO A;  2VYI A;  3Q47 B;  2P58 C;  4GCO A;  5FZS A;  3AS5 A;  1ZKK A;  2F69 A;  4UQY A;  2VSY A;  4GYO A;  5LCW C;  5DIZ A;  4I2Z A;  3VUZ A;  4GA1 A;  1MVX A;  2JLB A;  2KCL A;  3ZGQ A;  4YPE A;  2FBN A;  3CVQ A;  3GZ2 A;  2UY1 A;  2XGS A;  4MI0 A;  3M57 A;  3F9X A;  4I9E A;  5JJ0 A;  3LY7 A;  5CHE E;  2R5S A;  3CKB A;  3ASF A;  3NF1 A;  4GZ3 A;  1B89 A;  3SZ7 A;  4ME2 A;  1HH8 A;  4WNF A;  3M54 A;  2HR2 A;  2YQ8 A;  5EKQ D;  3LY8 A;  3TG4 A;  3SF4 A;  4GA0 A;  4U07 A;  3F9Y A;  2VSN A;  1KT1 A;  3TG5 A;  2NC9 A;  2RFI A;  2BUG A;  1KLX A;  5F6L A;  1XNF A;  1N6A A;  2XEV A;  3FWV A;  5EX0 A;  3BO5 A;  3VV0 A;  2QPW A;  1ELW A;  4N2Q A;  3ASH A;  4G23 A;  4J8D A;  4JLG A;  4QEN A;  2VGX A;  5CCL A;  4Z4P A;  3HNA A;  1HXI A;  2BQZ A;  3RKV A;  4H7X A;  3WXX A;  4BTA A;  3MKR A;  5KJL A;  3F9W A;  3CEQ A;  4BT8 A;  5F6K C;  5AYF A;  4CGV A;  3ESK A;  4YPU A;  3N71 A;  1N3J A;  5CCM A;  2LSV A;  4J8E A;  3MO5 A;  5M72 A;  4O30 A;  3Q4A B;  3GW4 A;  4GPK A;  4GA2 A;  4YNM A;  3CBM A;  3O48 A;  5DBK A;  2Q7F A;  2VQ2 A;  2O8J A;  3BEE A;  3KMA A;  4YNP A;  3QDN A;  2KCV A;  2UWJ G;  4J0U A;  4G25 A;  3CVL A;  3VTY A;  1IHG A;  3ZN3 A;  4N5C A;  1XQH A;  1A17 A;  4BUP A;  3ZHE B;  5G05 C;  5TEG A;  2L6J A;  5TTF A;  4GYW A;  4CGW A;  1ML9 A;  4J7F A;  2HYZ A;  5T0M A;  4GZ6 A;  3M55 A;  4NVQ A;  3S7F A;  4U0U A;  3KS2 A;  1YA0 A;  3CKC A;  4WND A;  3MV3 B;  4QEO A;  3RJV A;  2FO7 A;  2C0L A;  4AY6 A;  1IYG A;  5G05 J;  5JJ7 A;  4HOT A;  4AIF A;  3FPD A;  3RIB A;  3Q49 B; 
#chains in the Genus database with same CATH topology
 1D8D A;  1GW6 A;  1A5E A;  4W9R A;  2X3M A;  3Q7F A;  2QZA A;  3LY9 A;  5FZR A;  2DVW A;  5ARF A;  1LTX A;  4EZK A;  5EYP F;  3EJN A;  5AIJ A;  3SD5 A;  4H12 A;  5CER B;  4MI5 A;  5CBO A;  2WXJ A;  4Q94 A;  4J8O A;  4AY5 A;  4L2L A;  3JXJ A;  4C0E A;  4G1T A;  1TNY A;  5BW8 C;  3S7D A;  3FUI A;  3K9I A;  3K5K A;  2F0Y A;  4GPM A;  5A7D B;  3BG1 B;  3MO0 A;  2IOL A;  1E96 B;  2VGY A;  4HI9 A;  3IHY A;  1TN8 A;  1ELR A;  4L7T A;  2YHC A;  4K0R A;  2L6B A;  1UN9 A;  3L6A A;  4B94 A;  4GZ5 A;  2YHE A;  2WQH A;  3QC1 A;  1LD8 A;  3AAA C;  5FTP A;  2XHE A;  2I6H A;  2ZU6 B;  3V2O A;  1S63 A;  5FIN A;  5F5E A;  4TRQ A;  3OS5 A;  1V55 E;  2F8X K;  3LXU X;  3OTN A;  3CHR A;  4N39 A;  1Q2Z A;  2BKG A;  4QQI A;  5BXO A;  1E90 A;  3KEA A;  4G24 A;  3PUJ A;  3TWR A;  3ZU7 B;  1INZ A;  3Q7A A;  4JL0 A;  2MRI A;  4J83 A;  2PZI A;  4NIK A;  4HOR A;  3D9L A;  4U95 D;  4IRU A;  4Y6W A;  4R7L A;  4ZFH A;  1TJC A;  4BEP A;  3RAY A;  4ANX A;  3CST A;  4E47 A;  3DXK G;  4BX9 A;  3KMJ A;  1OWM A;  2WXQ A;  1RZ4 A;  5JJ6 A;  4AV7 A;  3SW9 A;  4QEP A;  4UQX A;  2E0I A;  4OAV B;  2P9I G;  4HRN A;  1BD8 A;  3FTU A;  2F8Y A;  3G2S A;  3EHN A;  2F37 A;  3DST A;  4BWR A;  5AN8 A;  4PS7 A;  3TGO A;  2WB2 A;  2CHW A;  5KJK A;  2WQ7 A;  3BQO A;  4JB8 P;  3ZIM A;  4N3C A;  2MYO A;  3C3O A;  3AG2 E;  5BNW A;  3ZNG A;  3QB2 A;  3Q15 A;  3C3R A;  4GML A;  3LYA A;  5EN5 D;  5T3R A;  3UQ3 A;  4IJD A;  3PE4 A;  3HG0 D;  2XCB A;  4FLB A;  1MUF A;  5HI7 A;  2P9P G;  4BES A;  3URZ A;  3MKQ B;  3ASN E;  5T8I A;  4TV3 A;  2X6K A;  4PS8 A;  3QNK A;  3L17 A;  3MV2 B;  4WWP A;  3RK6 A;  5J90 A;  4U7E B;  3ONK A;  3CV0 A;  4U8V D;  5D0Q D;  2ZGG A;  3PZ4 A;  3GZ1 A;  4FMU A;  3DPY A;  3MKQ A;  5LOZ A;  5JHB A;  1H0A A;  4WNG A;  3TJP A;  5KNG A;  2Y4U A;  5LSX A;  2P9N G;  3RO3 A;  4N2S A;  3UIN C;  2KCK A;  4KYO B;  3U3W A;  5A23 A;  1BI7 B;  2KM4 A;  2P9S G;  2VGE A;  1BLX B;  3NQP A;  3BUA A;  2XEH A;  2XEE A;  3Q78 A;  4AVX A;  4B8A A;  5EX3 A;  3RRU A;  1OCR E;  4FAD A;  2G46 A;  3BU8 A;  2H6H A;  2EIJ E;  2RD0 A;  5E76 A;  3MO2 A;  4RZ0 A;  5IY5 E;  2J4B A;  5KJM A;  2VYI A;  4LNU D;  3FU0 A;  3MZL B;  5FZS A;  3KSL A;  3LDZ A;  3ZXS A;  4UQY A;  4GYO A;  4HXI A;  3L16 A;  3VUZ A;  3TWQ A;  1H6K A;  4J8S A;  2ETA A;  4LSZ E;  2VJ8 A;  4GZC A;  3ABL E;  1TR4 A;  3LY7 A;  4YDW A;  4GTT A;  4NUR A;  3QAR A;  5EDS A;  4WNF A;  4GMR A;  2HR2 A;  5ANR A;  3ZVV A;  3EU9 A;  1N4S A;  4JC8 A;  3SF4 A;  4GA0 A;  3FUE A;  5EYL A;  4DX7 D;  2VSN A;  1XNF A;  2Y1L E;  2XEV A;  5EX0 A;  3BO5 A;  1Y6I A;  2WXP A;  4AOF A;  4RVB A;  4N2Q A;  2BF0 X;  3BG0 B;  4J8D A;  3I5P A;  2VGX A;  4CCA A;  3PRE A;  5CCL A;  4Z4P A;  2I1J A;  3U66 A;  3FH5 A;  1IQU A;  3WG7 E;  2EQX A;  5KJL A;  3CEQ A;  2WXR A;  5F6K C;  4JHK A;  1HS6 A;  4TXR A;  3PRZ A;  4UWG A;  3ULY A;  1IQR A;  2X6J A;  3FUF A;  3N71 A;  5CCM A;  5M72 A;  3FUM A;  4O30 A;  3IV0 A;  4KZC A;  2V4L A;  4JPS A;  2R2L A;  3O48 A;  5DBK A;  2NSZ A;  1FT1 A;  2O8J A;  3ZW3 A;  3AU4 A;  3JQ0 A;  5C2Y A;  1UN8 A;  1K3Z D;  3JUI A;  4FP7 A;  4G25 A;  3CVL A;  3FU6 A;  3TWT A;  1XQH A;  4O60 A;  4OVU A;  1Z3X A;  4BUP A;  5G05 C;  1PAQ A;  2R59 A;  4I43 A;  4J7F A;  3LJN A;  3E37 A;  5AQB A;  3LEW A;  2DYS E;  2WXF A;  2GRP B;  4C0M A;  3RJV A;  4G11 A;  5G05 J;  4HNA D;  4XE0 A;  5KNH D;  3PNT B;  2PQN A;  1H2T C;  1TNZ A;  3Q9U C;  3FTW A;  2AJA A;  1NA0 A;  1OWN A;  5HS0 A;  4XX5 A;  4GAA A;  5G04 J;  5G2N A;  3EIQ C;  1EDU A;  4BET A;  3OXL A;  4KXK B;  3SGH A;  1TNB A;  2BKK B;  2LUH A;  3Q5M A;  4IYP A;  5CEA A;  4F3V A;  4JHR A;  4C1Q A;  4HOS A;  4YVO A;  2J49 A;  1N9A A;  2WXN A;  4Q96 A;  2XPI A;  5B3S E;  4EZJ A;  3C3Q A;  2NXP A;  4PH4 B;  3KD7 A;  3TXN A;  3RQ4 A;  4GU5 A;  4IUL A;  4RG6 A;  2KXP C;  3O4Z A;  4KZ0 A;  5JMN D;  3PEU B;  3CK9 A;  1SZA A;  3RRM B;  1EYH A;  3ONL A;  4YND A;  4LEU A;  3CGH A;  1JCS A;  3CIA A;  4LRZ A;  1TN6 A;  4ANU A;  4M3O A;  4O1O A;  3UTM A;  4HRM B;  4FHJ A;  3UKR G;  3D9O A;  4JA7 A;  5A6C A;  4I6G A;  1WG0 A;  3E32 A;  1ZU2 A;  3QOU A;  4WWN A;  3VLE A;  3S7J A;  5BPP A;  2WMO A;  4A63 B;  2H6F A;  2QY7 A;  5JJT A;  3GYZ A;  4V3I A;  2IOS A;  2B6C A;  4FJY A;  4GTR A;  3LKU A;  2EIK E;  2GRL A;  3D9M A;  3DEP A;  3FTX A;  4MS6 A;  1N6C A;  1YYH A;  5D2M C;  4AIF A;  1MX4 A;  2VGX B;  3SQV A;  3MX3 A;  3M53 A;  1FT2 A;  1TN7 A;  3KEZ A;  2DBA A;  2LSU A;  2KC7 A;  3UKU G;  5T4Y A;  2VSO E;  4ZHB A;  3DEO A;  4XKC A;  4DLO A;  1HF8 A;  4K5B A;  1TEZ A;  5AJD A;  4B0Z A;  3RU0 A;  1FCH A;  3JUE A;  4XIF A;  2FF4 A;  3G2W A;  5CED B;  3S2A A;  3DSW A;  1PY1 A;  2C0M A;  5JA4 D;  2PM6 A;  3VLD A;  3AJI A;  4GTP A;  2A5U A;  3F9Z A;  5CMY A;  3ZPJ A;  1TNO A;  3ULQ A;  3UPV A;  3IHV A;  2IO2 C;  3LJ3 A;  3CVY A;  4N3B A;  2P9L G;  3UM0 A;  2CFZ A;  1ELK A;  1QQE A;  3FU5 A;  3SBT B;  3V30 A;  3ABM E;  3ABK E;  1KZP A;  3E30 A;  3IXE A;  4WAF A;  1O9S A;  2IY0 C;  4EZL A;  3QWP A;  5ANL A;  4EHM A;  4G8K A;  3FFL A;  3RO2 A;  1LF8 A;  2R03 A;  2FEZ A;  3KSQ A;  1SVX A;  4DX2 A;  3IEG A;  5KWD A;  3HVE A;  3PZ3 A;  4RG9 A;  3S8P A;  2BTD A;  4LUN U;  3U64 A;  2XQ0 A;  4E85 A;  3OXG A;  5BV1 A;  4DLQ A;  4P29 A;  3PEV B;  5AJL A;  2AXZ A;  4NQ0 A;  1LD7 A;  4F7A A;  3FUD A;  3HVE B;  4OVV A;  2PQR A;  4D10 C;  2ZXW E;  3ASD A;  2UY1 B;  4NJ5 A;  4EQF A;  4E6H A;  3CK7 A;  1OXJ A;  2QC9 A;  3EUV A;  2QYU A;  3P1U A;  1JCR A;  4RSY A;  5DIZ A;  4I2Z A;  3FUJ A;  4FU3 A;  5LCW C;  2V4H C;  3P2B A;  2KCL A;  3CVQ A;  5JHA A;  2UY1 A;  4JEH A;  2XGS A;  1DNP A;  1Z3Y A;  3TWS A;  3SI5 A;  4I9E A;  4LNG A;  5H7P A;  5CHE E;  3ASF A;  4GZ3 A;  4F6R D;  3HHM A;  1O1S A;  1U3C A;  2XEN A;  2YQ8 A;  4JD2 G;  3SFZ A;  2Y0B G;  3MGB A;  3L22 A;  3Q79 A;  4YDO A;  4U07 A;  3HIZ A;  2RFI A;  1KLX A;  4PDX A;  1WY6 A;  1OWO A;  2VTB B;  1DCQ A;  3DSV A;  3MYV A;  1E8W A;  2J07 A;  2HE0 A;  4ANW A;  1DC2 A;  1ELW A;  4DJA A;  3LS8 A;  4JLG A;  5FQ7 A;  2NYJ A;  3RKV A;  4H7X A;  1N4R A;  3WXX A;  3EHQ A;  3MKR A;  3F9W A;  2L0T B;  4U8Y D;  4LNB A;  3CHQ A;  1XGW A;  4DX6 D;  3DXM G;  1BU9 A;  3SFX A;  1N3J A;  4RLY A;  2LSV A;  1HU3 A;  2AXU A;  4GA2 A;  5FQ4 A;  3ZYK A;  3CBM A;  4M7C A;  3L82 A;  4HLL A;  4DX5 D;  2H6G A;  4KVM A;  3MJW A;  4UWK A;  4YNP A;  2J4D A;  3U9W A;  4J0U A;  1N11 A;  3VTY A;  3L9T A;  2RFA A;  1IHG A;  1RW2 A;  4N5C A;  4UWL A;  3T8K A;  2X6I A;  3ZHE B;  2AW6 A;  3I4G A;  2L6J A;  3HXE A;  1ML9 A;  2LXM A;  4I1O B;  5CRU A;  3KS2 A;  4EBA G;  4PUC A;  5CRV A;  2V8S E;  4XZ4 A;  1O5M A;  3MV3 B;  5ENO D;  1SA5 A;  1IYG A;  4C48 B;  5JJ7 A;  3FPD A;  3RIB A;  3Q49 B;  3FDH A;  4C9B B;  5AAR A;  3ISM C;  3RRN B;  3B95 A;  4QFV A;  4JHJ A;  3HXF A;  1H6O A;  4BT9 A;  4ILH B;  3UT8 A;  3B13 A;  3JYS A;  3M56 A;  3SHF A;  3PVL A;  3AS8 A;  4XI0 A;  1G3N B;  2YNQ A;  3OXF A;  4BX8 A;  3GZS A;  4HI8 A;  4HOU A;  5T5G A;  2KZT B;  1SW6 A;  4KBQ A;  4IJ8 A;  1NI1 A;  3ZXP A;  3CBP A;  2L9B A;  5G55 A;  3OPE A;  2E2E A;  1MJ0 A;  2LAI A;  4DI3 A;  3APC A;  3W9F A;  3CVN A;  1OCZ E;  3M58 A;  2OV8 A;  2Y4T A;  4UQZ A;  5JIN A;  3UIO C;  3S7B A;  4YVQ C;  5KCM A;  4EEC A;  5T0K A;  3ZFW A;  3U4T A;  4JZY A;  1E7V A;  4G2V A;  4HLE A;  5BXU A;  4I51 A;  4XKB A;  1ZBP A;  2WXO A;  1MQS A;  3DAL A;  2XRY A;  5KJN A;  1FPP A;  1L5J A;  4L1B A;  5CEC B;  3LCA A;  2CHX A;  4U96 D;  2QFC A;  3D9I A;  2OND A;  2MOW A;  3TXM A;  4CDR A;  1MT6 A;  1EPU A;  5LFA A;  1NA3 A;  5ENT D;  1VDY A;  5AYW D;  1O1T A;  3LVQ E;  1BI8 B;  5G04 C;  1DCE A;  2OOE A;  4CEM A;  3ASO E;  2A5E A;  4HFG A;  1PC2 A;  4KVO A;  2IGQ A;  3ESL A;  4IN3 B;  4BER A;  3UT4 A;  4HVB A;  4BSX A;  4J7I A;  1X81 A;  5LP0 A;  4GTQ A;  4F1P A;  3UUX A;  1OUV A;  2AXV A;  4N5Q A;  3TAX A;  4GYY A;  4CDN A;  2HO1 A;  4DI4 A;  4ANV A;  3CHS A;  4YDY A;  4ILG A;  3FP3 A;  1MZC A;  4UI9 K;  4AM9 A;  1QZ2 A;  4ABN A;  2I1K A;  2CFU A;  2R17 C;  3AG1 E;  3EU5 A;  4FA6 A;  2V0P A;  3PDN A;  1IXV A;  1NL4 A;  1V54 E;  2GGF A;  2RFM A;  4FHK A;  4AEZ C;  4TXP A;  4J8F A;  1HG5 A;  3D9K A;  4FUL A;  5D66 A;  2KZT A;  1P5Q A;  2KBX A;  1KZO A;  5AQA A;  1AP7 A;  4ATZ D;  4GTS A;  2JV0 A;  3V2X A;  3PZ1 A;  3EDT B;  5CPR B;  2Y69 E;  1N95 A;  3ZYL A;  3LVR E;  5FWQ A;  1MX6 A;  3T5X A;  1D8E A;  1SZ9 A;  3W9G A;  5ITZ F;  4AU7 A;  3DPD A;  3PZ2 A;  4Y6C A;  5TH7 A;  1ZB1 A;  2WPV A;  4CRW A;  1QYM A;  4FLH A;  3Q73 A;  4UUC A;  2I2O A;  3CVX A;  1MVH A;  2IFU A;  5FJY A;  2VSX E;  3IBE A;  1DVP A;  4I2W A;  3PUK A;  4OAU C;  3CHO A;  2DWZ A;  1OWP A;  4KT6 B;  4I17 A;  3MEK A;  5LCW J;  1PEG A;  2R05 A;  4X8Q A;  3JQ1 A;  3CBO A;  4Q69 A;  3FUL A;  2V5F A;  4RQI A;  3CK8 A;  2W5Z A;  2OCC E;  4BFR A;  4TXQ A;  4U8H A;  4DRX E;  3ZRH A;  5ARG A;  1N4Q A;  1D9S A;  5ENQ D;  2OEW A;  3G2U A;  3PS6 A;  5F59 A;  4APO A;  2P9U G;  3HXC A;  2P58 C;  4GCO A;  3FTY A;  5J08 A;  2WQ6 A;  2WXI A;  1ZKK A;  1E8Y A;  3NOG D;  4LER A;  3ML9 A;  1MVX A;  3ZGQ A;  1FVF A;  4YPE A;  2FBN A;  3CVV A;  4GTM A;  3CLJ A;  5JJ0 A;  2WXL A;  2LXL A;  3CKB A;  4AXH A;  1B89 A;  3SZ7 A;  4ME2 A;  3EIJ A;  1HH8 A;  3HDX A;  2VTB A;  3CSF A;  1H2U A;  5EKQ D;  3OAW A;  3LY8 A;  1QNF A;  2EIN E;  3TG4 A;  1Z6T A;  4NAC A;  4CYM D;  1KT1 A;  2NC9 A;  1S70 B;  5BUZ A;  3FWV A;  2OEV A;  3RSE G;  3VV0 A;  4G23 A;  4QEN A;  1UG3 A;  2BQZ A;  2LO6 A;  4EBA A;  4BTA A;  1AWC B;  2HM8 A;  4BT8 A;  3NAW A;  2DIW A;  3CVW A;  3EHR A;  5AYF A;  4CGV A;  4F53 A;  3SBS A;  1OWL A;  2B0O E;  2P9K G;  2X6F A;  2J09 A;  3FUN A;  1HFA A;  1UW4 B;  2IU1 A;  2EIM E;  3Q4A B;  3GW4 A;  4GPK A;  4YNM A;  2QYJ A;  1HX8 A;  1FVH A;  2VQ2 A;  3BEE A;  4URK A;  4CZ2 D;  2KCV A;  4GTV A;  3T5V A;  2OVB A;  3HRA A;  2RG8 A;  3D3M A;  4GB9 A;  1A17 A;  3SO8 A;  5TEG A;  1JPL A;  4GYW A;  5B1A E;  3CQG B;  2HYZ A;  4GZ6 A;  3M55 A;  4NVQ A;  3L13 A;  3S7F A;  2WXH A;  3CKC A;  3FEX A;  4F1S A;  4B93 B;  2XPY A;  4HOT A;  2PL2 A;  1Y8M A;  5C1D A;  3TWV A;  4I9C A;  3M59 A;  4UI9 C;  3R9A B;  3NBN B;  3T9K A;  2H6I A;  2FO1 E;  4JEU A;  4H7Y A;  3PE3 A;  1K8K G;  3FH7 A;  5AQ7 A;  3DRA A;  4DUI A;  3PZD A;  3ZHE A;  1YCS B;  2IEJ A;  2ZIS A;  3E34 A;  5FQ6 A;  3UX4 A;  2C2L A;  4JA9 A;  3RAU A;  1HG2 A;  4N3A A;  3ZEF A;  3C72 A;  3FU3 A;  2FI7 A;  3CHP A;  5KBA A;  1N0R A;  2IF4 A;  3HYM B;  1N94 A;  3AG3 E;  3FTS A;  1O1R A;  2CG2 A;  2WVI A;  5ENR D;  3G2T A;  4O6F A;  4L2Y A;  1U3D A;  4GZD A;  5LX8 A;  1S0P A;  5HKP A;  1UJJ A;  3TL5 A;  2GRM A;  3SFY A;  2DZO A;  2LNI A;  4OYS A;  3PH0 C;  4I1A A;  1OCC E;  4XI9 A;  3M5A A;  2WXK A;  1OCO E;  2GRO B;  3KMT A;  3VTX A;  1MX2 A;  3B7S A;  3APF A;  4LDG A;  4HQD A;  4U04 A;  1HO8 A;  5CMW A;  3ML8 A;  3EP0 A;  1E7U A;  3D9P A;  4MKT A;  4U63 A;  1H6P A;  3AS4 A;  2ETC A;  3D9H A;  2A4Z A;  2DCP A;  3MCX A;  3C98 A;  1N54 A;  3ASG A;  3Q9N C;  5FT9 A;  3FUK A;  5FQ8 A;  3VLF A;  2AVP A;  1JWG A;  2ZGD A;  3G2V A;  3E4B A;  4APF A;  3TWU A;  3HXB A;  2Y3A A;  2JEK A;  2R3A A;  2IQC A;  2BED A;  3R9M A;  2PNN A;  1KT0 A;  3MA5 A;  3DSX A;  3QWW A;  4L9P A;  4O1P A;  3UM1 A;  5EIB E;  2M63 A;  3SY2 A;  1UJK A;  3NOC D;  2XZD G;  5JHN A;  3R7R A;  5LSZ A;  2R02 A;  4JW1 A;  3LPZ A;  4A1S A;  1TJF A;  2WMN A;  3FH8 A;  2ILR A;  5AEN A;  1OT8 A;  4U0S A;  4UI9 J;  2RKK A;  3QKY A;  3CQC B;  2GRQ B;  2IJG X;  2KAT A;  3J5Q B;  1X5B A;  5FIO A;  2XS1 A;  4JXT A;  3ZYQ A;  2GRR B;  3F6Q A;  2WXM A;  5D0O D;  5BT1 A;  3UMV A;  2WXG A;  3I4R B;  4ACL A;  3B7B A;  3IHX A;  5EG2 A;  3APD A;  4PS3 A;  3D9J A;  4G26 A;  3CVU A;  2XS8 A;  1MYO A;  2MHK A;  3KAE A;  3IKO B;  4MBG A;  4WUY A;  4CT0 A;  3SWC A;  5ENS D;  1JWF A;  2J9Q A;  4I1M A;  2J8S D;  1U2V G;  2WM9 A;  2YIN A;  4HRL A;  4DX1 A;  3C5R A;  4I6J A;  5HQ8 A;  3DSU A;  4UWF A;  2J08 A;  3DB5 A;  2AWI A;  4HS2 A;  4J6I A;  3QWV A;  4GCN A;  1EF1 C;  1W3B A;  1NP7 A;  1N4P A;  4MRU A;  3FY4 A;  3SNX A;  1HZ4 A;  4J8Y A;  3DBS A;  4NRH B;  4YDE A;  4ATG A;  1K1B A;  4BTB A;  3V79 K;  3DWL G;  1N0Q A;  3TWX A;  5JIY A;  4WNE A;  4HOQ A;  2DZN A;  4KMO A;  2FUL A;  2XZT G;  3FTZ A;  3TWW A;  1WM5 A;  3OOI A;  3UI2 A;  2XCC A;  4MLP A;  3HXD A;  2XGO A;  4L23 A;  3CHM A;  1WAO 1;  5E75 A;  3UT7 A;  2XGM A;  4CDM A;  4ACK A;  4U0Z A;  3FEY A;  3T8M A;  2OVF A;  1H3I A;  3NB2 A;  3EHM A;  4K5A B;  1NZN A;  4YPA A;  5ENP D;  4AP2 A;  3CVP A;  2W5Y A;  4JDS A;  1JUQ A;  3QJZ A;  3QK0 A;  4K03 A;  2GRN B;  3E33 A;  2GW1 A;  4TUU A;  5FZQ A;  4EPZ A;  1K1A A;  3RJW A;  2LAH A;  3Q47 B;  5HRY A;  3Q75 A;  3AS5 A;  2F69 A;  2VSY A;  1TNU A;  5AAO A;  4GA1 A;  2JLB A;  3UM3 A;  3GZ2 A;  4DK5 A;  4MI0 A;  4I6E A;  4Z68 A;  3B7U X;  3M57 A;  2XRZ A;  3F9X A;  1IHB A;  1HE8 A;  4DPR A;  4GTO A;  2R5S A;  4A1G A;  3FUH A;  3NF1 A;  1UOH A;  1TYQ G;  3JXI A;  2CHZ A;  3M54 A;  3ENE A;  1SA4 A;  2PM7 A;  2IO3 C;  2EIL E;  3FTV A;  3UXG A;  1NFI E;  3J5P A;  5ENN A;  3X2Q E;  3QAQ A;  2P2C P;  3F9Y A;  2ION A;  3TG5 A;  4HB5 A;  2BUG A;  5F6L A;  1MHQ A;  5CBN A;  1N6A A;  4B89 A;  2ETB A;  2ZIR A;  4LCT A;  3B7T A;  1QBQ A;  3D9N A;  2QPW A;  3NZS A;  3CR3 A;  3ASH A;  3ZKJ A;  1E8X A;  3ZYM A;  4JVS A;  3UM2 A;  5EIL A;  1S64 A;  3HNA A;  1HXI A;  1H2V C;  3ULE G;  1N52 A;  4A3T A;  1JCQ A;  2X38 A;  1E8Z A;  4G8L A;  2L0I A;  1WDY A;  4K5C A;  3AU5 A;  3ZUV B;  4GMJ A;  4A3V A;  3AG4 E;  3ESK A;  4YPU A;  3DSS A;  4B8C B;  4J8E A;  2V5Q C;  3MO5 A;  3V31 A;  3UIP C;  5BV0 A;  5B1B E;  3NZU A;  5AQ9 A;  4ILI A;  4FC8 A;  4BSZ B;  4A55 A;  2Q7F A;  4UWH A;  4HBD A;  3KMA A;  4LG6 A;  3QDN A;  1H19 A;  4BY6 A;  2UWJ G;  1Z5S C;  4TUM A;  3JCK C;  3ZN3 A;  4XEI G;  5EID A;  3B7R L;  2XPZ A;  2CG3 A;  5TTF A;  1SQM A;  1IKN D;  1KPS B;  4CGW A;  4FJZ A;  2I9C A;  2DYR E;  1BPO A;  5T0M A;  2JAB A;  4U0U A;  1YA0 A;  1YMP A;  3R7Q A;  4J7W A;  3L08 A;  3PNL B;  4WND A;  4QEO A;  1OY3 D;  3L54 A;  2FO7 A;  2C0L A;  2X6H A;  4AY6 A;  4CT4 A;  3FHE A;  3I3N A;  4WWO A;  4AJW A; 
#chains in the Genus database with same CATH homology
 3FDH A;  2PL2 A;  1Y8M A;  5C1D A;  1GW6 A;  2PQN A;  3PNT B;  4I9C A;  4W9R A;  2X3M A;  4C9B B;  3M59 A;  4UI9 C;  3R9A B;  4JEU A;  3RRN B;  3LY9 A;  4H7Y A;  5FZR A;  1H2T C;  3PE3 A;  3FH7 A;  3FTW A;  5ARF A;  4EZK A;  4QFV A;  4JHJ A;  3PZD A;  3ZHE A;  4BT9 A;  1NA0 A;  3EJN A;  4ILH B;  5AIJ A;  5FQ6 A;  3SD5 A;  3UX4 A;  4H12 A;  1OWN A;  3UT8 A;  2C2L A;  4JA9 A;  4GAA A;  3B13 A;  3JYS A;  4XX5 A;  3M56 A;  1HG2 A;  2WXJ A;  4N3A A;  3PVL A;  4Q94 A;  3SHF A;  3FU3 A;  3ZEF A;  3AS8 A;  2FI7 A;  3CHP A;  5G04 J;  4J8O A;  4XI0 A;  3OXF A;  2YNQ A;  4BX8 A;  2IF4 A;  3GZS A;  4HOU A;  5G2N A;  5T5G A;  2KZT B;  3EIQ C;  1EDU A;  3HYM B;  4AY5 A;  4L2L A;  4C0E A;  4G1T A;  4KBQ A;  3OXL A;  5BW8 C;  4IJ8 A;  3CBP A;  3S7D A;  3FUI A;  2L9B A;  3K9I A;  5G55 A;  3FTS A;  3K5K A;  3OPE A;  5A7D B;  2E2E A;  2LAI A;  3BG1 B;  2CG2 A;  4KXK B;  2IOL A;  2WVI A;  3SGH A;  4DI3 A;  3APC A;  3MO0 A;  3CVN A;  1E96 B;  2VGY A;  3G2T A;  4O6F A;  4L2Y A;  3M58 A;  3IHY A;  2OV8 A;  2Y4T A;  3Q5M A;  1U3D A;  4GZD A;  4IYP A;  5LX8 A;  1S0P A;  4UQZ A;  4WWO A;  1ELR A;  1UJJ A;  3TL5 A;  4F3V A;  2GRM A;  4JHR A;  4L7T A;  2YHC A;  5JIN A;  4C1Q A;  2LNI A;  4K0R A;  4OYS A;  3S7B A;  4HOS A;  4YVQ C;  3PH0 C;  4I1A A;  4XI9 A;  2J49 A;  4YVO A;  5KCM A;  3ZFW A;  4EEC A;  2WXN A;  3U4T A;  3M5A A;  4JZY A;  1E7V A;  1UN9 A;  2WXK A;  3L6A A;  4B94 A;  4G2V A;  4HLE A;  4I51 A;  4GZ5 A;  4Q96 A;  4XKB A;  1ZBP A;  2XPI A;  2WQH A;  2YHE A;  3QC1 A;  3KMT A;  3VTX A;  4EZJ A;  5FTP A;  2XHE A;  2WXO A;  2NXP A;  2I6H A;  3B7S A;  3APF A;  1MQS A;  3DAL A;  2ZU6 B;  4LDG A;  5F5E A;  2XRY A;  4U04 A;  1HO8 A;  4PH4 B;  3KD7 A;  3ML8 A;  5CMW A;  5KJN A;  3EP0 A;  1L5J A;  1E7U A;  3D9P A;  4MKT A;  4L1B A;  4U63 A;  3TXN A;  4TRQ A;  3OS5 A;  3AS4 A;  3RQ4 A;  3LCA A;  3VUZ A;  4GU5 A;  2CHX A;  3LXU X;  2QFC A;  4IUL A;  3D9I A;  2A4Z A;  2DCP A;  3MCX A;  4RG6 A;  3C98 A;  3OTN A;  1N54 A;  3ASG A;  3O4Z A;  3CHR A;  2OND A;  2MOW A;  3TXM A;  4N39 A;  4CDR A;  1EPU A;  4KZ0 A;  1MT6 A;  5FT9 A;  3FUK A;  5LFA A;  5FQ8 A;  3VLF A;  1NA3 A;  3PEU B;  3CK9 A;  1SZA A;  3RRM B;  1VDY A;  5AYW D;  2AVP A;  3LVQ E;  1EYH A;  5G04 C;  3ONL A;  1JWG A;  2OOE A;  3G2V A;  1E90 A;  3E4B A;  4CEM A;  4APF A;  4YND A;  4LEU A;  3CGH A;  3CIA A;  4G24 A;  4HFG A;  4LRZ A;  1PC2 A;  3PUJ A;  4KVO A;  4ANU A;  2Y3A A;  2JEK A;  2R3A A;  4M3O A;  2IGQ A;  2IQC A;  3ESL A;  1INZ A;  4IN3 B;  1KT0 A;  4JL0 A;  2MRI A;  4FHJ A;  3UT4 A;  4HVB A;  3MA5 A;  4BSX A;  3D9O A;  4J83 A;  4J7I A;  2PZI A;  3QWW A;  4JA7 A;  5A6C A;  4I6G A;  2M63 A;  4HOR A;  1UJK A;  3D9L A;  5JHN A;  1ZU2 A;  5LP0 A;  3QOU A;  4WWN A;  4IRU A;  3UUX A;  4Y6W A;  3R7R A;  1OUV A;  3VLE A;  5LSZ A;  3S7J A;  4R7L A;  5BPP A;  2AXV A;  1TJC A;  2WMO A;  3TAX A;  4JW1 A;  4GYY A;  3LPZ A;  4A1S A;  1TJF A;  3RAY A;  4CDN A;  2HO1 A;  4ANX A;  2QY7 A;  2WMN A;  3CST A;  3FH8 A;  2ILR A;  4DI4 A;  5AEN A;  5JJT A;  4U0S A;  4UI9 J;  4BX9 A;  4E47 A;  4ANV A;  3CHS A;  3QKY A;  3GYZ A;  3KMJ A;  3CQC B;  4ILG A;  1OWM A;  4V3I A;  2IOS A;  3FP3 A;  4FJY A;  2WXQ A;  2IJG X;  2KAT A;  4UI9 K;  4AM9 A;  3LKU A;  1QZ2 A;  1X5B A;  4ABN A;  2I1K A;  2CFU A;  2R17 C;  3D9M A;  2GRL A;  5JJ6 A;  4AV7 A;  4JXT A;  3ZYQ A;  3SW9 A;  4QEP A;  3FTX A;  2WXM A;  4FA6 A;  4MS6 A;  5D0O D;  5BT1 A;  3UMV A;  1N6C A;  2V0P A;  2WXG A;  3I4R B;  3PDN A;  4ACL A;  4UQX A;  3IHX A;  5EG2 A;  4AIF A;  2GGF A;  2E0I A;  2VGX B;  3APD A;  3MX3 A;  4FHK A;  4PS3 A;  4AEZ C;  3M53 A;  3D9J A;  3FTU A;  3G2S A;  4J8F A;  1HG5 A;  3D9K A;  3EHN A;  4G26 A;  3KEZ A;  2DBA A;  2LSU A;  4BWR A;  2KC7 A;  4FUL A;  5T4Y A;  3CVU A;  4PS7 A;  3TGO A;  2MHK A;  2VSO E;  2WB2 A;  2CHW A;  5KJK A;  2WQ7 A;  4XKC A;  4DLO A;  1HF8 A;  1TEZ A;  5AJD A;  2KZT A;  3KAE A;  1P5Q A;  3IKO B;  4WUY A;  3ZIM A;  4CT0 A;  4N3C A;  3SWC A;  4B0Z A;  1JWF A;  2J9Q A;  5BNW A;  3RU0 A;  4I1M A;  1FCH A;  3QB2 A;  3Q15 A;  4XIF A;  2WM9 A;  3LYA A;  2FF4 A;  4GML A;  5T3R A;  3G2W A;  3UQ3 A;  4IJD A;  3S2A A;  2YIN A;  1PY1 A;  3PE4 A;  2JV0 A;  2C0M A;  2PM6 A;  2XCB A;  3EDT B;  3VLD A;  5CPR B;  4FLB A;  4I6J A;  5HQ8 A;  1MUF A;  2A5U A;  3F9Z A;  5CMY A;  3ZYL A;  4UWF A;  2J08 A;  3LVR E;  5HI7 A;  3ZPJ A;  3DB5 A;  2AWI A;  4HS2 A;  3ULQ A;  5FWQ A;  4J6I A;  3QWV A;  4GCN A;  3UPV A;  3URZ A;  3T5X A;  1EF1 C;  1W3B A;  1NP7 A;  4MRU A;  3MKQ B;  3IHV A;  1SZ9 A;  3FY4 A;  3LJ3 A;  3CVY A;  3SNX A;  4N3B A;  5T8I A;  1HZ4 A;  4AU7 A;  4TV3 A;  3DPD A;  2X6K A;  3DBS A;  4NRH B;  3QNK A;  3L17 A;  4PS8 A;  2CFZ A;  3MV2 B;  4Y6C A;  1ELK A;  4WWP A;  3RK6 A;  4ATG A;  4BTB A;  5TH7 A;  1QQE A;  3FU5 A;  5J90 A;  2WPV A;  3CV0 A;  3ONK A;  3SBT B;  4CRW A;  5D0Q D;  4FLH A;  5JIY A;  4WNE A;  4HOQ A;  1O9S A;  4WAF A;  3GZ1 A;  4KMO A;  2I2O A;  4FMU A;  2FUL A;  3CVX A;  1MVH A;  2IFU A;  5FJY A;  4EZL A;  2VSX E;  3FTZ A;  3IBE A;  1DVP A;  3QWP A;  3MKQ A;  1WM5 A;  5ANL A;  4I2W A;  5LOZ A;  5JHB A;  3OOI A;  3FFL A;  1H0A A;  3PUK A;  4WNG A;  3RO2 A;  3TJP A;  1LF8 A;  3CHO A;  2Y4U A;  2XCC A;  5LSX A;  2FEZ A;  3RO3 A;  4N2S A;  3IEG A;  3HVE A;  4RG9 A;  4MLP A;  2KCK A;  3S8P A;  2BTD A;  4KYO B;  4LUN U;  1OWP A;  5A23 A;  3U3W A;  2KM4 A;  4KT6 B;  4I17 A;  2XGO A;  3U64 A;  2XQ0 A;  3OXG A;  4E85 A;  3MEK A;  3CHM A;  3NQP A;  4L23 A;  5LCW J;  1WAO 1;  5E75 A;  3UT7 A;  5BV1 A;  1PEG A;  2XGM A;  4CDM A;  4ACK A;  4DLQ A;  4U0Z A;  3FEY A;  3JQ1 A;  3T8M A;  4AVX A;  2OVF A;  1H3I A;  3CBO A;  4Q69 A;  4P29 A;  4B8A A;  3EHM A;  3FUL A;  3PEV B;  5EX3 A;  1NZN A;  2V5F A;  3RRU A;  3CK8 A;  5AJL A;  4YPA A;  2W5Z A;  4FAD A;  2G46 A;  2AXZ A;  4NQ0 A;  4BFR A;  4F7A A;  3FUD A;  3HVE B;  4OVV A;  4U8H A;  4AP2 A;  2PQR A;  3CVP A;  3ZRH A;  4D10 C;  3ASD A;  5ARG A;  2W5Y A;  2RD0 A;  4JDS A;  1JUQ A;  3QJZ A;  5E76 A;  3QK0 A;  3MO2 A;  4RZ0 A;  2UY1 B;  4K03 A;  4NJ5 A;  2J4B A;  2GW1 A;  4TUU A;  3G2U A;  5FZQ A;  4EQF A;  4EPZ A;  3RJW A;  3PS6 A;  2LAH A;  4E6H A;  5F59 A;  5KJM A;  3CK7 A;  4APO A;  2VYI A;  3Q47 B;  2P58 C;  3FU0 A;  3MZL B;  3FTY A;  4GCO A;  5J08 A;  2WQ6 A;  5FZS A;  2WXI A;  3AS5 A;  1ZKK A;  3LDZ A;  3ZXS A;  1E8Y A;  2F69 A;  3P1U A;  4LER A;  4UQY A;  2VSY A;  3ML9 A;  3L16 A;  4GYO A;  4HXI A;  3FUJ A;  4FU3 A;  4I2Z A;  4GA1 A;  4RSY A;  5DIZ A;  5LCW C;  1H6K A;  1MVX A;  3P2B A;  2JLB A;  1FVF A;  2KCL A;  3ZGQ A;  4YPE A;  3CVQ A;  2FBN A;  3GZ2 A;  4J8S A;  5JHA A;  2UY1 A;  4JEH A;  4DK5 A;  3CVV A;  2XGS A;  2VJ8 A;  1DNP A;  4GZC A;  3B7U X;  4I6E A;  1Z3Y A;  3CLJ A;  3M57 A;  4MI0 A;  2XRZ A;  3F9X A;  3SI5 A;  4I9E A;  1HE8 A;  5JJ0 A;  2WXL A;  4DPR A;  3LY7 A;  5CHE E;  2R5S A;  4A1G A;  3CKB A;  3FUH A;  3ASF A;  3NF1 A;  4GZ3 A;  4AXH A;  1B89 A;  3SZ7 A;  4ME2 A;  3EIJ A;  4NUR A;  1HH8 A;  3QAR A;  5EDS A;  4WNF A;  2CHZ A;  3M54 A;  3HHM A;  3ENE A;  2HR2 A;  1U3C A;  2PM7 A;  5ANR A;  2YQ8 A;  2VTB A;  3CSF A;  3ZVV A;  3SFZ A;  1H2U A;  3FTV A;  4MI5 A;  3MGB A;  5EKQ D;  3OAW A;  3L22 A;  1QNF A;  3LY8 A;  4JC8 A;  3TG4 A;  1Z6T A;  3SF4 A;  5ENN A;  4GA0 A;  3QAQ A;  4U07 A;  4NAC A;  3FUE A;  3F9Y A;  2ION A;  3HIZ A;  2VSN A;  1KT1 A;  3TG5 A;  2NC9 A;  2RFI A;  2BUG A;  1KLX A;  4PDX A;  1MHQ A;  1XNF A;  1WY6 A;  2XEV A;  1N6A A;  5F6L A;  4B89 A;  1OWO A;  3MYV A;  3FWV A;  5BUZ A;  2VTB B;  1E8W A;  2J07 A;  5EX0 A;  4ANW A;  3BO5 A;  4LCT A;  3VV0 A;  1Y6I A;  2WXP A;  3B7T A;  3D9N A;  4AOF A;  2QPW A;  3NZS A;  1ELW A;  4RVB A;  3CR3 A;  3ASH A;  4DJA A;  4N2Q A;  1E8X A;  2BF0 X;  3LS8 A;  3ZYM A;  4G23 A;  3BG0 B;  4J8D A;  4JVS A;  4JLG A;  4QEN A;  3I5P A;  2VGX A;  4CCA A;  3PRE A;  5CCL A;  5FQ7 A;  1UG3 A;  3HNA A;  2I1J A;  4Z4P A;  1HXI A;  3U66 A;  2BQZ A;  5T0K A;  3RKV A;  2LO6 A;  3FH5 A;  1H2V C;  4H7X A;  4EBA A;  1IQU A;  3WXX A;  4BTA A;  1N52 A;  2EQX A;  4A3T A;  3MKR A;  2X38 A;  5KJL A;  1E8Z A;  3F9W A;  2L0T B;  2HM8 A;  3CEQ A;  2WXR A;  4BT8 A;  4JHK A;  5F6K C;  1HS6 A;  2DIW A;  3CVW A;  2L0I A;  3PRZ A;  5AYF A;  3CHQ A;  4UWG A;  1XGW A;  4CGV A;  3AU5 A;  4F53 A;  4GMJ A;  4A3V A;  1IQR A;  2X6J A;  3FUF A;  3ESK A;  3SBS A;  4YPU A;  1OWL A;  3N71 A;  1N3J A;  2X6F A;  2J09 A;  3FUN A;  4B8C B;  1HFA A;  1UW4 B;  2LSV A;  4J8E A;  2IU1 A;  5CCM A;  1HU3 A;  3FUM A;  5M72 A;  3MO5 A;  4O30 A;  3IV0 A;  4KZC A;  2V4L A;  3Q4A B;  4JPS A;  3GW4 A;  5BV0 A;  4GPK A;  2AXU A;  3NZU A;  4GA2 A;  5FQ4 A;  4ILI A;  3ZYK A;  4YNM A;  3CBM A;  3O48 A;  4FC8 A;  5DBK A;  4A55 A;  1HX8 A;  1FVH A;  2Q7F A;  4UWH A;  2NSZ A;  2VQ2 A;  2O8J A;  4KVM A;  3ZW3 A;  3AU4 A;  3JQ0 A;  5C2Y A;  3BEE A;  1UN8 A;  3KMA A;  4URK A;  3MJW A;  3JUI A;  4UWK A;  4YNP A;  2J4D A;  4FP7 A;  3QDN A;  2KCV A;  1H19 A;  4BY6 A;  2UWJ G;  3T5V A;  3U9W A;  4J0U A;  4G25 A;  3CVL A;  3FU6 A;  3VTY A;  2OVB A;  1IHG A;  2RG8 A;  3JCK C;  4N5C A;  4UWL A;  3ZN3 A;  1XQH A;  3D3M A;  4GB9 A;  1A17 A;  1Z3X A;  2X6I A;  4OVU A;  4BUP A;  3ZHE B;  2AW6 A;  5G05 C;  5TEG A;  3B7R L;  3I4G A;  2XPZ A;  2R59 A;  1PAQ A;  2CG3 A;  2L6J A;  5TTF A;  1SQM A;  1JPL A;  4GYW A;  4I43 A;  4FJZ A;  4CGW A;  1ML9 A;  3CQG B;  4J7F A;  2I9C A;  4I1O B;  2HYZ A;  1BPO A;  5T0M A;  4GZ6 A;  3M55 A;  4NVQ A;  3L13 A;  3S7F A;  3LEW A;  2WXH A;  4U0U A;  3KS2 A;  4EBA G;  1YA0 A;  3CKC A;  4PUC A;  3R7Q A;  2WXF A;  3L08 A;  3PNL B;  4WND A;  2V8S E;  3FEX A;  4XZ4 A;  3MV3 B;  4QEO A;  4C0M A;  3L54 A;  4F1S A;  3RJV A;  2FO7 A;  4G11 A;  2XPY A;  2C0L A;  2X6H A;  4AY6 A;  1IYG A;  4CT4 A;  5G05 J;  3FHE A;  4XE0 A;  5JJ7 A;  3I3N A;  4HOT A;  3HDX A;  3FPD A;  3RIB A;  3Q49 B;  4AJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...