3KMJA

Crystal structure of vset under condition b
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISYGDDYWLSRPRLTQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A612L protein
publication title Dimerization of a viral SET protein endows its function.
pubmed doi rcsb
molecule tags Viral protein
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3kmjA01
4YPEA 5JHNA 3N71A 5CCMA 4MI0A 1N6CA 4LDGA 5EX0A 2F69A 5EG2A 2W5ZA 2G46A 5JJ0A 3VUZA 1H3IA 3TG4A 3MO5A 3S7DA 4J83A 5TTFA 3F9ZA 2QPWA 3F9XA 5F6LA 5TEGA 1ZKKA 3RU0A 4H12A 5KJNA 4WUYA 1MVXA 2RFIA 1N6AA 3OXGA 4YNMA 3DALA 3CBMA 5F5EA 3OXLA 3MO0A 5LSZA 1N3JA 2O8JA 4J7IA 1ML9A 3OOIA 3DB5A 5CCLA 5KJMA 1O9SA 4RZ0A 3S7FA 3QWPA 3KMTA 4BUPA 1MVHA 4O6FA 4YPAA 5F59A 3S7BA 5JINA 5HI7A 1PEGA 5LSXA 3RAYA 3M55A 3OPEA 4MI5A 5T0MA 3KMAA 3IHXA 3RIBA 3M56A 5CPRB 1MUFA 4Z4PA 3M57A 3F9WA 5JIYA 4J7FA 5ARFA 5HQ8A 3KMJA 3MEKA 3QWWA 4IJ8A 3SWCA 2JV0A 3CBPA 4YPUA 3F9YA 3M54A 5KJLA 4E47A 3M53A 2R3AA 4YNPA 4NVQA 3CBOA 5ARGA 4QEPA 2W5YA 3MO2A 3M58A 4NJ5A 3RJWA 3M5AA 5T0KA 1MT6A 4AU7A 3PDNA 3S7JA 5F6KC 4C1QA 4JDSA 3BO5A 4YNDA 4O30A 2BQZA 3OS5A 5EX3A 4I51A 3VV0A 3QWVA 3K5KA 5AYFA 5T5GA 3S8PA 3FPDA 3SW9A 1XQHA 4FMUA 3M59A 3RQ4A 5KJKA 4JLGA 4J8OA 4IJDA 4QEOA 3TG5A 4QENA 3HNAA 3OXFA 5TH7A 3EP0A 2IGQA
chains in the Genus database with same CATH superfamily
4YPEA 5JHNA 3N71A 5CCMA 4MI0A 1N6CA 4LDGA 5EX0A 2F69A 5EG2A 2W5ZA 2G46A 5JJ0A 3VUZA 1H3IA 3TG4A 3MO5A 3S7DA 4J83A 5TTFA 3F9ZA 2QPWA 3F9XA 5F6LA 5TEGA 1ZKKA 3RU0A 4H12A 5KJNA 4WUYA 1MVXA 2RFIA 1N6AA 3OXGA 4YNMA 3DALA 3CBMA 5F5EA 3OXLA 3MO0A 5LSZA 1N3JA 2O8JA 4J7IA 1ML9A 3OOIA 3DB5A 5CCLA 5KJMA 1O9SA 4RZ0A 3S7FA 3QWPA 3KMTA 4BUPA 1MVHA 4O6FA 4YPAA 5F59A 3S7BA 5JINA 5HI7A 1PEGA 5LSXA 3RAYA 3M55A 3OPEA 4MI5A 5T0MA 3KMAA 3IHXA 3RIBA 3M56A 5CPRB 1MUFA 4Z4PA 3M57A 3F9WA 5JIYA 4J7FA 5ARFA 5HQ8A 3KMJA 3MEKA 3QWWA 4IJ8A 3SWCA 2JV0A 3CBPA 4YPUA 3F9YA 3M54A 5KJLA 4E47A 3M53A 2R3AA 4YNPA 4NVQA 3CBOA 5ARGA 4QEPA 2W5YA 3MO2A 3M58A 4NJ5A 3RJWA 3M5AA 5T0KA 1MT6A 4AU7A 3PDNA 3S7JA 5F6KC 4C1QA 4JDSA 3BO5A 4YNDA 4O30A 2BQZA 3OS5A 5EX3A 4I51A 3VV0A 3QWVA 3K5KA 5AYFA 5T5GA 3S8PA 3FPDA 3SW9A 1XQHA 4FMUA 3M59A 3RQ4A 5KJKA 4JLGA 4J8OA 4IJDA 4QEOA 3TG5A 4QENA 3HNAA 3OXFA 5TH7A 3EP0A 2IGQA
chains in the Genus database with same CATH topology
4YPEA 5JHNA 3N71A 5CCMA 4MI0A 1N6CA 4LDGA 5EX0A 2F69A 5EG2A 2W5ZA 2G46A 5JJ0A 3VUZA 1H3IA 3TG4A 3MO5A 3S7DA 4J83A 5TTFA 3F9ZA 2QPWA 3F9XA 5F6LA 5TEGA 1ZKKA 3RU0A 4H12A 5KJNA 4WUYA 1MVXA 2RFIA 1N6AA 3OXGA 4YNMA 3DALA 3CBMA 5F5EA 3OXLA 3MO0A 5LSZA 1N3JA 2O8JA 4J7IA 1ML9A 3OOIA 3DB5A 5CCLA 5KJMA 1O9SA 4RZ0A 3S7FA 3QWPA 3KMTA 4BUPA 1MVHA 4O6FA 4YPAA 5F59A 3S7BA 5JINA 5HI7A 1PEGA 5LSXA 3RAYA 3M55A 3OPEA 4MI5A 5T0MA 3KMAA 3IHXA 3RIBA 3M56A 5CPRB 1MUFA 4Z4PA 3M57A 3F9WA 5JIYA 4J7FA 5ARFA 5HQ8A 3KMJA 3MEKA 3QWWA 4IJ8A 3SWCA 2JV0A 3CBPA 4YPUA 3F9YA 3M54A 5KJLA 4E47A 3M53A 2R3AA 4YNPA 4NVQA 3CBOA 5ARGA 4QEPA 2W5YA 3MO2A 3M58A 4NJ5A 3RJWA 3M5AA 5T0KA 1MT6A 4AU7A 3PDNA 3S7JA 5F6KC 4C1QA 4JDSA 3BO5A 4YNDA 4O30A 2BQZA 3OS5A 5EX3A 4I51A 3VV0A 3QWVA 3K5KA 5AYFA 5T5GA 3S8PA 3FPDA 3SW9A 1XQHA 4FMUA 3M59A 3RQ4A 5KJKA 4JLGA 4J8OA 4IJDA 4QEOA 3TG5A 4QENA 3HNAA 3OXFA 5TH7A 3EP0A 2IGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YPE A;  5JHN A;  3N71 A;  5CCM A;  4MI0 A;  1N6C A;  4LDG A;  5EX0 A;  2F69 A;  5EG2 A;  2W5Z A;  2G46 A;  5JJ0 A;  3VUZ A;  1H3I A;  3TG4 A;  3MO5 A;  3S7D A;  4J83 A;  5TTF A;  3F9Z A;  2QPW A;  3F9X A;  5F6L A;  5TEG A;  1ZKK A;  3RU0 A;  4H12 A;  5KJN A;  4WUY A;  1MVX A;  2RFI A;  1N6A A;  3OXG A;  4YNM A;  3DAL A;  3CBM A;  5F5E A;  3OXL A;  3MO0 A;  5LSZ A;  1N3J A;  2O8J A;  4J7I A;  1ML9 A;  3OOI A;  3DB5 A;  5CCL A;  5KJM A;  1O9S A;  4RZ0 A;  3S7F A;  3QWP A;  3KMT A;  4BUP A;  1MVH A;  4O6F A;  4YPA A;  5F59 A;  3S7B A;  5JIN A;  5HI7 A;  1PEG A;  5LSX A;  3RAY A;  3M55 A;  3OPE A;  4MI5 A;  5T0M A;  3KMA A;  3IHX A;  3RIB A;  3M56 A;  5CPR B;  1MUF A;  4Z4P A;  3M57 A;  3F9W A;  5JIY A;  4J7F A;  5ARF A;  5HQ8 A;  3KMJ A;  3MEK A;  3QWW A;  4IJ8 A;  3SWC A;  2JV0 A;  3CBP A;  4YPU A;  3F9Y A;  3M54 A;  5KJL A;  4E47 A;  3M53 A;  2R3A A;  4YNP A;  4NVQ A;  3CBO A;  5ARG A;  4QEP A;  2W5Y A;  3MO2 A;  3M58 A;  4NJ5 A;  3RJW A;  3M5A A;  5T0K A;  1MT6 A;  4AU7 A;  3PDN A;  3S7J A;  5F6K C;  4C1Q A;  4JDS A;  3BO5 A;  4YND A;  4O30 A;  2BQZ A;  3OS5 A;  5EX3 A;  4I51 A;  3VV0 A;  3QWV A;  3K5K A;  5AYF A;  5T5G A;  3S8P A;  3FPD A;  3SW9 A;  1XQH A;  4FMU A;  3M59 A;  3RQ4 A;  5KJK A;  4JLG A;  4J8O A;  4IJD A;  4QEO A;  3TG5 A;  4QEN A;  3HNA A;  3OXF A;  5TH7 A;  3EP0 A;  2IGQ A; 
#chains in the Genus database with same CATH topology
 4YPE A;  5JHN A;  3N71 A;  5CCM A;  4MI0 A;  1N6C A;  4LDG A;  5EX0 A;  2F69 A;  5EG2 A;  2W5Z A;  2G46 A;  5JJ0 A;  3VUZ A;  1H3I A;  3TG4 A;  3MO5 A;  3S7D A;  4J83 A;  5TTF A;  3F9Z A;  2QPW A;  3F9X A;  5F6L A;  5TEG A;  1ZKK A;  3RU0 A;  4H12 A;  5KJN A;  4WUY A;  1MVX A;  2RFI A;  1N6A A;  3OXG A;  4YNM A;  3DAL A;  3CBM A;  5F5E A;  3OXL A;  3MO0 A;  5LSZ A;  1N3J A;  2O8J A;  4J7I A;  1ML9 A;  3OOI A;  3DB5 A;  5CCL A;  5KJM A;  1O9S A;  4RZ0 A;  3S7F A;  3QWP A;  3KMT A;  4BUP A;  1MVH A;  4O6F A;  4YPA A;  5F59 A;  3S7B A;  5JIN A;  5HI7 A;  1PEG A;  5LSX A;  3RAY A;  3M55 A;  3OPE A;  4MI5 A;  5T0M A;  3KMA A;  3IHX A;  3RIB A;  3M56 A;  5CPR B;  1MUF A;  4Z4P A;  3M57 A;  3F9W A;  5JIY A;  4J7F A;  5ARF A;  5HQ8 A;  3KMJ A;  3MEK A;  3QWW A;  4IJ8 A;  3SWC A;  2JV0 A;  3CBP A;  4YPU A;  3F9Y A;  3M54 A;  5KJL A;  4E47 A;  3M53 A;  2R3A A;  4YNP A;  4NVQ A;  3CBO A;  5ARG A;  4QEP A;  2W5Y A;  3MO2 A;  3M58 A;  4NJ5 A;  3RJW A;  3M5A A;  5T0K A;  1MT6 A;  4AU7 A;  3PDN A;  3S7J A;  5F6K C;  4C1Q A;  4JDS A;  3BO5 A;  4YND A;  4O30 A;  2BQZ A;  3OS5 A;  5EX3 A;  4I51 A;  3VV0 A;  3QWV A;  3K5K A;  5AYF A;  5T5G A;  3S8P A;  3FPD A;  3SW9 A;  1XQH A;  4FMU A;  3M59 A;  3RQ4 A;  5KJK A;  4JLG A;  4J8O A;  4IJD A;  4QEO A;  3TG5 A;  4QEN A;  3HNA A;  3OXF A;  5TH7 A;  3EP0 A;  2IGQ A; 
#chains in the Genus database with same CATH homology
 4YPE A;  5JHN A;  3N71 A;  5CCM A;  4MI0 A;  1N6C A;  4LDG A;  5EX0 A;  2F69 A;  5EG2 A;  2W5Z A;  2G46 A;  5JJ0 A;  3VUZ A;  1H3I A;  3TG4 A;  3MO5 A;  3S7D A;  4J83 A;  5TTF A;  3F9Z A;  2QPW A;  3F9X A;  5F6L A;  5TEG A;  1ZKK A;  3RU0 A;  4H12 A;  5KJN A;  4WUY A;  1MVX A;  2RFI A;  1N6A A;  3OXG A;  4YNM A;  3DAL A;  3CBM A;  5F5E A;  3OXL A;  3MO0 A;  5LSZ A;  1N3J A;  2O8J A;  4J7I A;  1ML9 A;  3OOI A;  3DB5 A;  5CCL A;  5KJM A;  1O9S A;  4RZ0 A;  3S7F A;  3QWP A;  3KMT A;  4BUP A;  1MVH A;  4O6F A;  4YPA A;  5F59 A;  3S7B A;  5JIN A;  5HI7 A;  1PEG A;  5LSX A;  3RAY A;  3M55 A;  3OPE A;  4MI5 A;  5T0M A;  3KMA A;  3IHX A;  3RIB A;  3M56 A;  5CPR B;  1MUF A;  4Z4P A;  3M57 A;  3F9W A;  5JIY A;  4J7F A;  5ARF A;  5HQ8 A;  3KMJ A;  3MEK A;  3QWW A;  4IJ8 A;  3SWC A;  2JV0 A;  3CBP A;  4YPU A;  3F9Y A;  3M54 A;  5KJL A;  4E47 A;  3M53 A;  2R3A A;  4YNP A;  4NVQ A;  3CBO A;  5ARG A;  4QEP A;  2W5Y A;  3MO2 A;  3M58 A;  4NJ5 A;  3RJW A;  3M5A A;  5T0K A;  1MT6 A;  4AU7 A;  3PDN A;  3S7J A;  5F6K C;  4C1Q A;  4JDS A;  3BO5 A;  4YND A;  4O30 A;  2BQZ A;  3OS5 A;  5EX3 A;  4I51 A;  3VV0 A;  3QWV A;  3K5K A;  5AYF A;  5T5G A;  3S8P A;  3FPD A;  3SW9 A;  1XQH A;  4FMU A;  3M59 A;  3RQ4 A;  5KJK A;  4JLG A;  4J8O A;  4IJD A;  4QEO A;  3TG5 A;  4QEN A;  3HNA A;  3OXF A;  5TH7 A;  3EP0 A;  2IGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...