3KMJA

Crystal structure of vset under condition b
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISYGDDYWLSRPRLTQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dimerization of a viral SET protein endows its function.
pubmed doi rcsb
molecule tags Viral protein
molecule keywords A612L protein
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3kmjA01
3S8PA 2JV0A 4FMUA 3F9ZA 3DALA 4IJ8A 3DB5A 4AU7A 5JJ0A 3RAYA 3RU0A 3TG5A 3OOIA 3BO5A 5KJLA 3OPEA 5JIYA 5KJNA 2QPWA 5HQ8A 5T5GA 3SWCA 5ARFA 3MO2A 1H3IA 3PDNA 4J8OA 5CCLA 1ML9A 3M53A 5JINA 4JLGA 4YPEA 5TEGA 3M56A 1N6AA 1MUFA 4O6FA 4YNDA 3HNAA 4J7IA 5LSXA 5T0MA 4J7FA 4NVQA 5LSZA 3M55A 3M54A 4Z4PA 4LDGA 3MO0A 3KMAA 3OXGA 3S7BA 4O30A 2R3AA 5EX3A 4YPAA 3OS5A 3M58A 3QWPA 4MI0A 3S7JA 3OXFA 5F6KC 3QWVA 1MT6A 5CCMA 3VUZA 3QWWA 3CBOA 5T0KA 4RZ0A 4IJDA 2IGQA 5KJKA 4J83A 4E47A 3IHXA 5F5EA 4WUYA 4BUPA 4YNMA 5EX0A 1ZKKA 5TH7A 2F69A 5EG2A 5KJMA 4QEPA 2O8JA 3F9XA 3S7FA 4MI5A 5F6LA 3MO5A 4YPUA 3FPDA 2W5ZA 3M59A 2W5YA 5TTFA 3N71A 1N6CA 4NJ5A 3CBMA 3KMTA 5F59A 3F9WA 5ARGA 3S7DA 2BQZA 2G46A 1PEGA 5HI7A 4QENA 3CBPA 3EP0A 3KMJA 1MVHA 4C1QA 3SW9A 3M5AA 3RIBA 4YNPA 1XQHA 1MVXA 3M57A 5CPRB 5JHNA 3F9YA 3VV0A 3OXLA 2RFIA 1O9SA 3RJWA 3MEKA 3TG4A 4H12A 5AYFA 3RQ4A 4QEOA 3K5KA 4JDSA 4I51A 1N3JA
chains in the Genus database with same CATH superfamily
3S8PA 2JV0A 4FMUA 3F9ZA 3DALA 4IJ8A 3DB5A 4AU7A 5JJ0A 3RAYA 3RU0A 3TG5A 3OOIA 3BO5A 5KJLA 3OPEA 5JIYA 5KJNA 2QPWA 5HQ8A 5T5GA 3SWCA 5ARFA 3MO2A 1H3IA 3PDNA 4J8OA 5CCLA 1ML9A 3M53A 5JINA 4JLGA 4YPEA 5TEGA 3M56A 1N6AA 1MUFA 4O6FA 4YNDA 3HNAA 4J7IA 5LSXA 5T0MA 4J7FA 4NVQA 5LSZA 3M55A 3M54A 4Z4PA 4LDGA 3MO0A 3KMAA 3OXGA 3S7BA 4O30A 2R3AA 5EX3A 4YPAA 3OS5A 3M58A 3QWPA 4MI0A 3S7JA 3OXFA 5F6KC 3QWVA 1MT6A 5CCMA 3VUZA 3QWWA 3CBOA 5T0KA 4RZ0A 4IJDA 2IGQA 5KJKA 4J83A 4E47A 3IHXA 5F5EA 4WUYA 4BUPA 4YNMA 5EX0A 1ZKKA 5TH7A 2F69A 5EG2A 5KJMA 4QEPA 2O8JA 3F9XA 3S7FA 4MI5A 5F6LA 3MO5A 4YPUA 3FPDA 2W5ZA 3M59A 2W5YA 5TTFA 3N71A 1N6CA 4NJ5A 3CBMA 3KMTA 5F59A 3F9WA 5ARGA 3S7DA 2BQZA 2G46A 1PEGA 5HI7A 4QENA 3CBPA 3EP0A 3KMJA 1MVHA 4C1QA 3SW9A 3M5AA 3RIBA 4YNPA 1XQHA 1MVXA 3M57A 5CPRB 5JHNA 3F9YA 3VV0A 3OXLA 2RFIA 1O9SA 3RJWA 3MEKA 3TG4A 4H12A 5AYFA 3RQ4A 4QEOA 3K5KA 4JDSA 4I51A 1N3JA
chains in the Genus database with same CATH topology
3S8PA 2JV0A 4FMUA 3F9ZA 3DALA 4IJ8A 3DB5A 4AU7A 5JJ0A 3RAYA 3RU0A 3TG5A 3OOIA 3BO5A 5KJLA 3OPEA 5JIYA 5KJNA 2QPWA 5HQ8A 5T5GA 3SWCA 5ARFA 3MO2A 1H3IA 3PDNA 4J8OA 5CCLA 1ML9A 3M53A 5JINA 4JLGA 4YPEA 5TEGA 3M56A 1N6AA 1MUFA 4O6FA 4YNDA 3HNAA 4J7IA 5LSXA 5T0MA 4J7FA 4NVQA 5LSZA 3M55A 3M54A 4Z4PA 4LDGA 3MO0A 3KMAA 3OXGA 3S7BA 4O30A 2R3AA 5EX3A 4YPAA 3OS5A 3M58A 3QWPA 4MI0A 3S7JA 3OXFA 5F6KC 3QWVA 1MT6A 5CCMA 3VUZA 3QWWA 3CBOA 5T0KA 4RZ0A 4IJDA 2IGQA 5KJKA 4J83A 4E47A 3IHXA 5F5EA 4WUYA 4BUPA 4YNMA 5EX0A 1ZKKA 5TH7A 2F69A 5EG2A 5KJMA 4QEPA 2O8JA 3F9XA 3S7FA 4MI5A 5F6LA 3MO5A 4YPUA 3FPDA 2W5ZA 3M59A 2W5YA 5TTFA 3N71A 1N6CA 4NJ5A 3CBMA 3KMTA 5F59A 3F9WA 5ARGA 3S7DA 2BQZA 2G46A 1PEGA 5HI7A 4QENA 3CBPA 3EP0A 3KMJA 1MVHA 4C1QA 3SW9A 3M5AA 3RIBA 4YNPA 1XQHA 1MVXA 3M57A 5CPRB 5JHNA 3F9YA 3VV0A 3OXLA 2RFIA 1O9SA 3RJWA 3MEKA 3TG4A 4H12A 5AYFA 3RQ4A 4QEOA 3K5KA 4JDSA 4I51A 1N3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S8P A;  2JV0 A;  4FMU A;  3F9Z A;  3DAL A;  4IJ8 A;  3DB5 A;  4AU7 A;  5JJ0 A;  3RAY A;  3RU0 A;  3TG5 A;  3OOI A;  3BO5 A;  5KJL A;  3OPE A;  5JIY A;  5KJN A;  2QPW A;  5HQ8 A;  5T5G A;  3SWC A;  5ARF A;  3MO2 A;  1H3I A;  3PDN A;  4J8O A;  5CCL A;  1ML9 A;  3M53 A;  5JIN A;  4JLG A;  4YPE A;  5TEG A;  3M56 A;  1N6A A;  1MUF A;  4O6F A;  4YND A;  3HNA A;  4J7I A;  5LSX A;  5T0M A;  4J7F A;  4NVQ A;  5LSZ A;  3M55 A;  3M54 A;  4Z4P A;  4LDG A;  3MO0 A;  3KMA A;  3OXG A;  3S7B A;  4O30 A;  2R3A A;  5EX3 A;  4YPA A;  3OS5 A;  3M58 A;  3QWP A;  4MI0 A;  3S7J A;  3OXF A;  5F6K C;  3QWV A;  1MT6 A;  5CCM A;  3VUZ A;  3QWW A;  3CBO A;  5T0K A;  4RZ0 A;  4IJD A;  2IGQ A;  5KJK A;  4J83 A;  4E47 A;  3IHX A;  5F5E A;  4WUY A;  4BUP A;  4YNM A;  5EX0 A;  1ZKK A;  5TH7 A;  2F69 A;  5EG2 A;  5KJM A;  4QEP A;  2O8J A;  3F9X A;  3S7F A;  4MI5 A;  5F6L A;  3MO5 A;  4YPU A;  3FPD A;  2W5Z A;  3M59 A;  2W5Y A;  5TTF A;  3N71 A;  1N6C A;  4NJ5 A;  3CBM A;  3KMT A;  5F59 A;  3F9W A;  5ARG A;  3S7D A;  2BQZ A;  2G46 A;  1PEG A;  5HI7 A;  4QEN A;  3CBP A;  3EP0 A;  3KMJ A;  1MVH A;  4C1Q A;  3SW9 A;  3M5A A;  3RIB A;  4YNP A;  1XQH A;  1MVX A;  3M57 A;  5CPR B;  5JHN A;  3F9Y A;  3VV0 A;  3OXL A;  2RFI A;  1O9S A;  3RJW A;  3MEK A;  3TG4 A;  4H12 A;  5AYF A;  3RQ4 A;  4QEO A;  3K5K A;  4JDS A;  4I51 A;  1N3J A; 
#chains in the Genus database with same CATH topology
 3S8P A;  2JV0 A;  4FMU A;  3F9Z A;  3DAL A;  4IJ8 A;  3DB5 A;  4AU7 A;  5JJ0 A;  3RAY A;  3RU0 A;  3TG5 A;  3OOI A;  3BO5 A;  5KJL A;  3OPE A;  5JIY A;  5KJN A;  2QPW A;  5HQ8 A;  5T5G A;  3SWC A;  5ARF A;  3MO2 A;  1H3I A;  3PDN A;  4J8O A;  5CCL A;  1ML9 A;  3M53 A;  5JIN A;  4JLG A;  4YPE A;  5TEG A;  3M56 A;  1N6A A;  1MUF A;  4O6F A;  4YND A;  3HNA A;  4J7I A;  5LSX A;  5T0M A;  4J7F A;  4NVQ A;  5LSZ A;  3M55 A;  3M54 A;  4Z4P A;  4LDG A;  3MO0 A;  3KMA A;  3OXG A;  3S7B A;  4O30 A;  2R3A A;  5EX3 A;  4YPA A;  3OS5 A;  3M58 A;  3QWP A;  4MI0 A;  3S7J A;  3OXF A;  5F6K C;  3QWV A;  1MT6 A;  5CCM A;  3VUZ A;  3QWW A;  3CBO A;  5T0K A;  4RZ0 A;  4IJD A;  2IGQ A;  5KJK A;  4J83 A;  4E47 A;  3IHX A;  5F5E A;  4WUY A;  4BUP A;  4YNM A;  5EX0 A;  1ZKK A;  5TH7 A;  2F69 A;  5EG2 A;  5KJM A;  4QEP A;  2O8J A;  3F9X A;  3S7F A;  4MI5 A;  5F6L A;  3MO5 A;  4YPU A;  3FPD A;  2W5Z A;  3M59 A;  2W5Y A;  5TTF A;  3N71 A;  1N6C A;  4NJ5 A;  3CBM A;  3KMT A;  5F59 A;  3F9W A;  5ARG A;  3S7D A;  2BQZ A;  2G46 A;  1PEG A;  5HI7 A;  4QEN A;  3CBP A;  3EP0 A;  3KMJ A;  1MVH A;  4C1Q A;  3SW9 A;  3M5A A;  3RIB A;  4YNP A;  1XQH A;  1MVX A;  3M57 A;  5CPR B;  5JHN A;  3F9Y A;  3VV0 A;  3OXL A;  2RFI A;  1O9S A;  3RJW A;  3MEK A;  3TG4 A;  4H12 A;  5AYF A;  3RQ4 A;  4QEO A;  3K5K A;  4JDS A;  4I51 A;  1N3J A; 
#chains in the Genus database with same CATH homology
 3S8P A;  2JV0 A;  4FMU A;  3F9Z A;  3DAL A;  4IJ8 A;  3DB5 A;  4AU7 A;  5JJ0 A;  3RAY A;  3RU0 A;  3TG5 A;  3OOI A;  3BO5 A;  5KJL A;  3OPE A;  5JIY A;  5KJN A;  2QPW A;  5HQ8 A;  5T5G A;  3SWC A;  5ARF A;  3MO2 A;  1H3I A;  3PDN A;  4J8O A;  5CCL A;  1ML9 A;  3M53 A;  5JIN A;  4JLG A;  4YPE A;  5TEG A;  3M56 A;  1N6A A;  1MUF A;  4O6F A;  4YND A;  3HNA A;  4J7I A;  5LSX A;  5T0M A;  4J7F A;  4NVQ A;  5LSZ A;  3M55 A;  3M54 A;  4Z4P A;  4LDG A;  3MO0 A;  3KMA A;  3OXG A;  3S7B A;  4O30 A;  2R3A A;  5EX3 A;  4YPA A;  3OS5 A;  3M58 A;  3QWP A;  4MI0 A;  3S7J A;  3OXF A;  5F6K C;  3QWV A;  1MT6 A;  5CCM A;  3VUZ A;  3QWW A;  3CBO A;  5T0K A;  4RZ0 A;  4IJD A;  2IGQ A;  5KJK A;  4J83 A;  4E47 A;  3IHX A;  5F5E A;  4WUY A;  4BUP A;  4YNM A;  5EX0 A;  1ZKK A;  5TH7 A;  2F69 A;  5EG2 A;  5KJM A;  4QEP A;  2O8J A;  3F9X A;  3S7F A;  4MI5 A;  5F6L A;  3MO5 A;  4YPU A;  3FPD A;  2W5Z A;  3M59 A;  2W5Y A;  5TTF A;  3N71 A;  1N6C A;  4NJ5 A;  3CBM A;  3KMT A;  5F59 A;  3F9W A;  5ARG A;  3S7D A;  2BQZ A;  2G46 A;  1PEG A;  5HI7 A;  4QEN A;  3CBP A;  3EP0 A;  3KMJ A;  1MVH A;  4C1Q A;  3SW9 A;  3M5A A;  3RIB A;  4YNP A;  1XQH A;  1MVX A;  3M57 A;  5CPR B;  5JHN A;  3F9Y A;  3VV0 A;  3OXL A;  2RFI A;  1O9S A;  3RJW A;  3MEK A;  3TG4 A;  4H12 A;  5AYF A;  3RQ4 A;  4QEO A;  3K5K A;  4JDS A;  4I51 A;  1N3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...