3KMJA

Crystal structure of vset under condition b
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISYGDDYWLSRPRLTQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords A612L protein
publication title Dimerization of a viral SET protein endows its function.
pubmed doi rcsb
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3kmjA01
1MT6A 3CBOA 4RZ0A 3BO5A 5T0MA 4C1QA 4IJ8A 1N3JA 5EG2A 3OS5A 4J8OA 3S7JA 3M58A 3VUZA 3OXFA 5JHNA 3F9WA 5F5EA 5KJLA 5F6KC 5KJNA 3S8PA 3VV0A 3QWVA 5T0KA 4J83A 3N71A 4WUYA 1N6AA 5AYFA 5F6LA 1O9SA 4YNDA 4YPAA 2G46A 3RJWA 3KMAA 3SWCA 3MO5A 2JV0A 4H12A 2W5YA 3M59A 3FPDA 4Z4PA 5KJMA 4QEPA 5JIYA 4JLGA 3KMJA 3OXGA 4I51A 3HNAA 5LSXA 3S7BA 3IHXA 4AU7A 2BQZA 4NVQA 4FMUA 2O8JA 4BUPA 5ARGA 3QWWA 4YNMA 3EP0A 3KMTA 1ZKKA 5T5GA 5TH7A 3TG5A 3SW9A 1MVHA 1MUFA 3MEKA 4YNPA 3DALA 3OXLA 1N6CA 5KJKA 5F59A 4J7FA 4YPUA 3RAYA 4E47A 3CBMA 2QPWA 4QENA 5CPRB 3DB5A 3MO2A 1H3IA 5CCMA 4IJDA 5CCLA 3TG4A 4MI5A 3OOIA 4YPEA 3F9XA 2IGQA 4J7IA 3F9ZA 5EX3A 3MO0A 5TTFA 3RU0A 3M53A 5JJ0A 3M55A 1XQHA 3M56A 3F9YA 5TEGA 3QWPA 4QEOA 3S7FA 5HQ8A 5JINA 1PEGA 3M5AA 4O6FA 3RIBA 4JDSA 3M57A 2R3AA 4O30A 3PDNA 5EX0A 3RQ4A 5HI7A 2RFIA 1ML9A 3CBPA 2W5ZA 5ARFA 2F69A 3M54A 4MI0A 3K5KA 4LDGA 3S7DA 1MVXA 5LSZA 3OPEA 4NJ5A
chains in the Genus database with same CATH superfamily
1MT6A 3CBOA 4RZ0A 3BO5A 5T0MA 4C1QA 4IJ8A 1N3JA 5EG2A 3OS5A 4J8OA 3S7JA 3M58A 3VUZA 3OXFA 5JHNA 3F9WA 5F5EA 5KJLA 5F6KC 5KJNA 3S8PA 3VV0A 3QWVA 5T0KA 4J83A 3N71A 4WUYA 1N6AA 5AYFA 5F6LA 1O9SA 4YNDA 4YPAA 2G46A 3RJWA 3KMAA 3SWCA 3MO5A 2JV0A 4H12A 2W5YA 3M59A 3FPDA 4Z4PA 5KJMA 4QEPA 5JIYA 4JLGA 3KMJA 3OXGA 4I51A 3HNAA 5LSXA 3S7BA 3IHXA 4AU7A 2BQZA 4NVQA 4FMUA 2O8JA 4BUPA 5ARGA 3QWWA 4YNMA 3EP0A 3KMTA 1ZKKA 5T5GA 5TH7A 3TG5A 3SW9A 1MVHA 1MUFA 3MEKA 4YNPA 3DALA 3OXLA 1N6CA 5KJKA 5F59A 4J7FA 4YPUA 3RAYA 4E47A 3CBMA 2QPWA 4QENA 5CPRB 3DB5A 3MO2A 1H3IA 5CCMA 4IJDA 5CCLA 3TG4A 4MI5A 3OOIA 4YPEA 3F9XA 2IGQA 4J7IA 3F9ZA 5EX3A 3MO0A 5TTFA 3RU0A 3M53A 5JJ0A 3M55A 1XQHA 3M56A 3F9YA 5TEGA 3QWPA 4QEOA 3S7FA 5HQ8A 5JINA 1PEGA 3M5AA 4O6FA 3RIBA 4JDSA 3M57A 2R3AA 4O30A 3PDNA 5EX0A 3RQ4A 5HI7A 2RFIA 1ML9A 3CBPA 2W5ZA 5ARFA 2F69A 3M54A 4MI0A 3K5KA 4LDGA 3S7DA 1MVXA 5LSZA 3OPEA 4NJ5A
chains in the Genus database with same CATH topology
1MT6A 3CBOA 4RZ0A 3BO5A 5T0MA 4C1QA 4IJ8A 1N3JA 5EG2A 3OS5A 4J8OA 3S7JA 3M58A 3VUZA 3OXFA 5JHNA 3F9WA 5F5EA 5KJLA 5F6KC 5KJNA 3S8PA 3VV0A 3QWVA 5T0KA 4J83A 3N71A 4WUYA 1N6AA 5AYFA 5F6LA 1O9SA 4YNDA 4YPAA 2G46A 3RJWA 3KMAA 3SWCA 3MO5A 2JV0A 4H12A 2W5YA 3M59A 3FPDA 4Z4PA 5KJMA 4QEPA 5JIYA 4JLGA 3KMJA 3OXGA 4I51A 3HNAA 5LSXA 3S7BA 3IHXA 4AU7A 2BQZA 4NVQA 4FMUA 2O8JA 4BUPA 5ARGA 3QWWA 4YNMA 3EP0A 3KMTA 1ZKKA 5T5GA 5TH7A 3TG5A 3SW9A 1MVHA 1MUFA 3MEKA 4YNPA 3DALA 3OXLA 1N6CA 5KJKA 5F59A 4J7FA 4YPUA 3RAYA 4E47A 3CBMA 2QPWA 4QENA 5CPRB 3DB5A 3MO2A 1H3IA 5CCMA 4IJDA 5CCLA 3TG4A 4MI5A 3OOIA 4YPEA 3F9XA 2IGQA 4J7IA 3F9ZA 5EX3A 3MO0A 5TTFA 3RU0A 3M53A 5JJ0A 3M55A 1XQHA 3M56A 3F9YA 5TEGA 3QWPA 4QEOA 3S7FA 5HQ8A 5JINA 1PEGA 3M5AA 4O6FA 3RIBA 4JDSA 3M57A 2R3AA 4O30A 3PDNA 5EX0A 3RQ4A 5HI7A 2RFIA 1ML9A 3CBPA 2W5ZA 5ARFA 2F69A 3M54A 4MI0A 3K5KA 4LDGA 3S7DA 1MVXA 5LSZA 3OPEA 4NJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MT6 A;  3CBO A;  4RZ0 A;  3BO5 A;  5T0M A;  4C1Q A;  4IJ8 A;  1N3J A;  5EG2 A;  3OS5 A;  4J8O A;  3S7J A;  3M58 A;  3VUZ A;  3OXF A;  5JHN A;  3F9W A;  5F5E A;  5KJL A;  5F6K C;  5KJN A;  3S8P A;  3VV0 A;  3QWV A;  5T0K A;  4J83 A;  3N71 A;  4WUY A;  1N6A A;  5AYF A;  5F6L A;  1O9S A;  4YND A;  4YPA A;  2G46 A;  3RJW A;  3KMA A;  3SWC A;  3MO5 A;  2JV0 A;  4H12 A;  2W5Y A;  3M59 A;  3FPD A;  4Z4P A;  5KJM A;  4QEP A;  5JIY A;  4JLG A;  3KMJ A;  3OXG A;  4I51 A;  3HNA A;  5LSX A;  3S7B A;  3IHX A;  4AU7 A;  2BQZ A;  4NVQ A;  4FMU A;  2O8J A;  4BUP A;  5ARG A;  3QWW A;  4YNM A;  3EP0 A;  3KMT A;  1ZKK A;  5T5G A;  5TH7 A;  3TG5 A;  3SW9 A;  1MVH A;  1MUF A;  3MEK A;  4YNP A;  3DAL A;  3OXL A;  1N6C A;  5KJK A;  5F59 A;  4J7F A;  4YPU A;  3RAY A;  4E47 A;  3CBM A;  2QPW A;  4QEN A;  5CPR B;  3DB5 A;  3MO2 A;  1H3I A;  5CCM A;  4IJD A;  5CCL A;  3TG4 A;  4MI5 A;  3OOI A;  4YPE A;  3F9X A;  2IGQ A;  4J7I A;  3F9Z A;  5EX3 A;  3MO0 A;  5TTF A;  3RU0 A;  3M53 A;  5JJ0 A;  3M55 A;  1XQH A;  3M56 A;  3F9Y A;  5TEG A;  3QWP A;  4QEO A;  3S7F A;  5HQ8 A;  5JIN A;  1PEG A;  3M5A A;  4O6F A;  3RIB A;  4JDS A;  3M57 A;  2R3A A;  4O30 A;  3PDN A;  5EX0 A;  3RQ4 A;  5HI7 A;  2RFI A;  1ML9 A;  3CBP A;  2W5Z A;  5ARF A;  2F69 A;  3M54 A;  4MI0 A;  3K5K A;  4LDG A;  3S7D A;  1MVX A;  5LSZ A;  3OPE A;  4NJ5 A; 
#chains in the Genus database with same CATH topology
 1MT6 A;  3CBO A;  4RZ0 A;  3BO5 A;  5T0M A;  4C1Q A;  4IJ8 A;  1N3J A;  5EG2 A;  3OS5 A;  4J8O A;  3S7J A;  3M58 A;  3VUZ A;  3OXF A;  5JHN A;  3F9W A;  5F5E A;  5KJL A;  5F6K C;  5KJN A;  3S8P A;  3VV0 A;  3QWV A;  5T0K A;  4J83 A;  3N71 A;  4WUY A;  1N6A A;  5AYF A;  5F6L A;  1O9S A;  4YND A;  4YPA A;  2G46 A;  3RJW A;  3KMA A;  3SWC A;  3MO5 A;  2JV0 A;  4H12 A;  2W5Y A;  3M59 A;  3FPD A;  4Z4P A;  5KJM A;  4QEP A;  5JIY A;  4JLG A;  3KMJ A;  3OXG A;  4I51 A;  3HNA A;  5LSX A;  3S7B A;  3IHX A;  4AU7 A;  2BQZ A;  4NVQ A;  4FMU A;  2O8J A;  4BUP A;  5ARG A;  3QWW A;  4YNM A;  3EP0 A;  3KMT A;  1ZKK A;  5T5G A;  5TH7 A;  3TG5 A;  3SW9 A;  1MVH A;  1MUF A;  3MEK A;  4YNP A;  3DAL A;  3OXL A;  1N6C A;  5KJK A;  5F59 A;  4J7F A;  4YPU A;  3RAY A;  4E47 A;  3CBM A;  2QPW A;  4QEN A;  5CPR B;  3DB5 A;  3MO2 A;  1H3I A;  5CCM A;  4IJD A;  5CCL A;  3TG4 A;  4MI5 A;  3OOI A;  4YPE A;  3F9X A;  2IGQ A;  4J7I A;  3F9Z A;  5EX3 A;  3MO0 A;  5TTF A;  3RU0 A;  3M53 A;  5JJ0 A;  3M55 A;  1XQH A;  3M56 A;  3F9Y A;  5TEG A;  3QWP A;  4QEO A;  3S7F A;  5HQ8 A;  5JIN A;  1PEG A;  3M5A A;  4O6F A;  3RIB A;  4JDS A;  3M57 A;  2R3A A;  4O30 A;  3PDN A;  5EX0 A;  3RQ4 A;  5HI7 A;  2RFI A;  1ML9 A;  3CBP A;  2W5Z A;  5ARF A;  2F69 A;  3M54 A;  4MI0 A;  3K5K A;  4LDG A;  3S7D A;  1MVX A;  5LSZ A;  3OPE A;  4NJ5 A; 
#chains in the Genus database with same CATH homology
 1MT6 A;  3CBO A;  4RZ0 A;  3BO5 A;  5T0M A;  4C1Q A;  4IJ8 A;  1N3J A;  5EG2 A;  3OS5 A;  4J8O A;  3S7J A;  3M58 A;  3VUZ A;  3OXF A;  5JHN A;  3F9W A;  5F5E A;  5KJL A;  5F6K C;  5KJN A;  3S8P A;  3VV0 A;  3QWV A;  5T0K A;  4J83 A;  3N71 A;  4WUY A;  1N6A A;  5AYF A;  5F6L A;  1O9S A;  4YND A;  4YPA A;  2G46 A;  3RJW A;  3KMA A;  3SWC A;  3MO5 A;  2JV0 A;  4H12 A;  2W5Y A;  3M59 A;  3FPD A;  4Z4P A;  5KJM A;  4QEP A;  5JIY A;  4JLG A;  3KMJ A;  3OXG A;  4I51 A;  3HNA A;  5LSX A;  3S7B A;  3IHX A;  4AU7 A;  2BQZ A;  4NVQ A;  4FMU A;  2O8J A;  4BUP A;  5ARG A;  3QWW A;  4YNM A;  3EP0 A;  3KMT A;  1ZKK A;  5T5G A;  5TH7 A;  3TG5 A;  3SW9 A;  1MVH A;  1MUF A;  3MEK A;  4YNP A;  3DAL A;  3OXL A;  1N6C A;  5KJK A;  5F59 A;  4J7F A;  4YPU A;  3RAY A;  4E47 A;  3CBM A;  2QPW A;  4QEN A;  5CPR B;  3DB5 A;  3MO2 A;  1H3I A;  5CCM A;  4IJD A;  5CCL A;  3TG4 A;  4MI5 A;  3OOI A;  4YPE A;  3F9X A;  2IGQ A;  4J7I A;  3F9Z A;  5EX3 A;  3MO0 A;  5TTF A;  3RU0 A;  3M53 A;  5JJ0 A;  3M55 A;  1XQH A;  3M56 A;  3F9Y A;  5TEG A;  3QWP A;  4QEO A;  3S7F A;  5HQ8 A;  5JIN A;  1PEG A;  3M5A A;  4O6F A;  3RIB A;  4JDS A;  3M57 A;  2R3A A;  4O30 A;  3PDN A;  5EX0 A;  3RQ4 A;  5HI7 A;  2RFI A;  1ML9 A;  3CBP A;  2W5Z A;  5ARF A;  2F69 A;  3M54 A;  4MI0 A;  3K5K A;  4LDG A;  3S7D A;  1MVX A;  5LSZ A;  3OPE A;  4NJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...