3BO5A

Crystal structure of methyltransferase domain of human histone-lysine n-methyltransferase setmar
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
279
structure length
269
Chain Sequence
TEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFPGCICVKTPCLPGTCSCLRHGENYDDNSCLRDKYAEPVFECNVLCRCSDHCRNRVVQKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYIIAIREHVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFLPFDSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase SETMAR
publication title The Crystal Structure of Methyltransferase Domain of Human Histone-lysine N-methyltransferase SETMAR in Complex With AdoHcy.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 71
structure length 269
sequence length 279
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2007-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3bo5A00
4J7IA 3S7BA 3IHXA 4QEPA 3F9ZA 3S7FA 3S7DA 4Z4PA 3RAYA 1H3IA 4O30A 4IJDA 3MO2A 2O8JA 1XQHA 4J7FA 2R3AA 1ZKKA 3OXGA 5F59A 3EP0A 3M59A 2RFIA 3MO5A 4J8OA 3RQ4A 3PDNA 3N71A 2G46A 5JINA 5CCMA 4MI0A 4YNPA 1N3JA 5TH7A 3S7JA 3FPDA 3QWWA 5HI7A 4NJ5A 5JHNA 3QWVA 2W5ZA 5EX0A 5ARGA 5KJLA 3SWCA 3DALA 4YPUA 3CBPA 5EX3A 4NVQA 5CPRB 4YNDA 1PEGA 4FMUA 3F9YA 1MVXA 3OXFA 3CBOA 5HQ8A 3MO0A 5KJNA 1MVHA 5CCLA 1N6CA 2W5YA 2F69A 3KMAA 3QWPA 3VUZA 4C1QA 4I51A 5JJ0A 2QPWA 3F9XA 3M58A 3M54A 3KMTA 3RJWA 4IJ8A 4AU7A 4YNMA 4E47A 3M55A 2IGQA 2JV0A 5T0MA 3M5AA 4WUYA 5AYFA 5ARFA 3M53A 4LDGA 3M56A 3HNAA 5JIYA 5KJKA 4QEOA 4YPAA 1MUFA 4MI5A 3VV0A 3RU0A 3OOIA 3TG4A 3F9WA 3DB5A 3BO5A 4QENA 5F5EA 5T0KA 3OPEA 3KMJA 4RZ0A 1MT6A 3CBMA 4JDSA 5T5GA 3K5KA 1ML9A 3RIBA 3OXLA 5EG2A 3OS5A 4JLGA 3SW9A 5KJMA 5LSXA 4J83A 5F6KC 5F6LA 4YPEA 5TTFA 4BUPA 1N6AA 3S8PA 3TG5A 5TEGA 3MEKA 2BQZA 5LSZA 1O9SA 4O6FA 4H12A 3M57A
chains in the Genus database with same CATH superfamily
4J7IA 3S7BA 3IHXA 4QEPA 3F9ZA 3S7FA 3S7DA 4Z4PA 3RAYA 1H3IA 4O30A 4IJDA 3MO2A 2O8JA 1XQHA 4J7FA 2R3AA 1ZKKA 3OXGA 5F59A 3EP0A 3M59A 2RFIA 3MO5A 4J8OA 3RQ4A 3PDNA 3N71A 2G46A 5JINA 5CCMA 4MI0A 4YNPA 1N3JA 5TH7A 3S7JA 3FPDA 3QWWA 5HI7A 4NJ5A 5JHNA 3QWVA 2W5ZA 5EX0A 5ARGA 5KJLA 3SWCA 3DALA 4YPUA 3CBPA 5EX3A 4NVQA 5CPRB 4YNDA 1PEGA 4FMUA 3F9YA 1MVXA 3OXFA 3CBOA 5HQ8A 3MO0A 5KJNA 1MVHA 5CCLA 1N6CA 2W5YA 2F69A 3KMAA 3QWPA 3VUZA 4C1QA 4I51A 5JJ0A 2QPWA 3F9XA 3M58A 3M54A 3KMTA 3RJWA 4IJ8A 4AU7A 4YNMA 4E47A 3M55A 2IGQA 2JV0A 5T0MA 3M5AA 4WUYA 5AYFA 5ARFA 3M53A 4LDGA 3M56A 3HNAA 5JIYA 5KJKA 4QEOA 4YPAA 1MUFA 4MI5A 3VV0A 3RU0A 3OOIA 3TG4A 3F9WA 3DB5A 3BO5A 4QENA 5F5EA 5T0KA 3OPEA 3KMJA 4RZ0A 1MT6A 3CBMA 4JDSA 5T5GA 3K5KA 1ML9A 3RIBA 3OXLA 5EG2A 3OS5A 4JLGA 3SW9A 5KJMA 5LSXA 4J83A 5F6KC 5F6LA 4YPEA 5TTFA 4BUPA 1N6AA 3S8PA 3TG5A 5TEGA 3MEKA 2BQZA 5LSZA 1O9SA 4O6FA 4H12A 3M57A
chains in the Genus database with same CATH topology
4J7IA 3S7BA 3IHXA 4QEPA 3F9ZA 3S7FA 3S7DA 4Z4PA 3RAYA 1H3IA 4O30A 4IJDA 3MO2A 2O8JA 1XQHA 4J7FA 2R3AA 1ZKKA 3OXGA 5F59A 3EP0A 3M59A 2RFIA 3MO5A 4J8OA 3RQ4A 3PDNA 3N71A 2G46A 5JINA 5CCMA 4MI0A 4YNPA 1N3JA 5TH7A 3S7JA 3FPDA 3QWWA 5HI7A 4NJ5A 5JHNA 3QWVA 2W5ZA 5EX0A 5ARGA 5KJLA 3SWCA 3DALA 4YPUA 3CBPA 5EX3A 4NVQA 5CPRB 4YNDA 1PEGA 4FMUA 3F9YA 1MVXA 3OXFA 3CBOA 5HQ8A 3MO0A 5KJNA 1MVHA 5CCLA 1N6CA 2W5YA 2F69A 3KMAA 3QWPA 3VUZA 4C1QA 4I51A 5JJ0A 2QPWA 3F9XA 3M58A 3M54A 3KMTA 3RJWA 4IJ8A 4AU7A 4YNMA 4E47A 3M55A 2IGQA 2JV0A 5T0MA 3M5AA 4WUYA 5AYFA 5ARFA 3M53A 4LDGA 3M56A 3HNAA 5JIYA 5KJKA 4QEOA 4YPAA 1MUFA 4MI5A 3VV0A 3RU0A 3OOIA 3TG4A 3F9WA 3DB5A 3BO5A 4QENA 5F5EA 5T0KA 3OPEA 3KMJA 4RZ0A 1MT6A 3CBMA 4JDSA 5T5GA 3K5KA 1ML9A 3RIBA 3OXLA 5EG2A 3OS5A 4JLGA 3SW9A 5KJMA 5LSXA 4J83A 5F6KC 5F6LA 4YPEA 5TTFA 4BUPA 1N6AA 3S8PA 3TG5A 5TEGA 3MEKA 2BQZA 5LSZA 1O9SA 4O6FA 4H12A 3M57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7I A;  3S7B A;  3IHX A;  4QEP A;  3F9Z A;  3S7F A;  3S7D A;  4Z4P A;  3RAY A;  1H3I A;  4O30 A;  4IJD A;  3MO2 A;  2O8J A;  1XQH A;  4J7F A;  2R3A A;  1ZKK A;  3OXG A;  5F59 A;  3EP0 A;  3M59 A;  2RFI A;  3MO5 A;  4J8O A;  3RQ4 A;  3PDN A;  3N71 A;  2G46 A;  5JIN A;  5CCM A;  4MI0 A;  4YNP A;  1N3J A;  5TH7 A;  3S7J A;  3FPD A;  3QWW A;  5HI7 A;  4NJ5 A;  5JHN A;  3QWV A;  2W5Z A;  5EX0 A;  5ARG A;  5KJL A;  3SWC A;  3DAL A;  4YPU A;  3CBP A;  5EX3 A;  4NVQ A;  5CPR B;  4YND A;  1PEG A;  4FMU A;  3F9Y A;  1MVX A;  3OXF A;  3CBO A;  5HQ8 A;  3MO0 A;  5KJN A;  1MVH A;  5CCL A;  1N6C A;  2W5Y A;  2F69 A;  3KMA A;  3QWP A;  3VUZ A;  4C1Q A;  4I51 A;  5JJ0 A;  2QPW A;  3F9X A;  3M58 A;  3M54 A;  3KMT A;  3RJW A;  4IJ8 A;  4AU7 A;  4YNM A;  4E47 A;  3M55 A;  2IGQ A;  2JV0 A;  5T0M A;  3M5A A;  4WUY A;  5AYF A;  5ARF A;  3M53 A;  4LDG A;  3M56 A;  3HNA A;  5JIY A;  5KJK A;  4QEO A;  4YPA A;  1MUF A;  4MI5 A;  3VV0 A;  3RU0 A;  3OOI A;  3TG4 A;  3F9W A;  3DB5 A;  3BO5 A;  4QEN A;  5F5E A;  5T0K A;  3OPE A;  3KMJ A;  4RZ0 A;  1MT6 A;  3CBM A;  4JDS A;  5T5G A;  3K5K A;  1ML9 A;  3RIB A;  3OXL A;  5EG2 A;  3OS5 A;  4JLG A;  3SW9 A;  5KJM A;  5LSX A;  4J83 A;  5F6K C;  5F6L A;  4YPE A;  5TTF A;  4BUP A;  1N6A A;  3S8P A;  3TG5 A;  5TEG A;  3MEK A;  2BQZ A;  5LSZ A;  1O9S A;  4O6F A;  4H12 A;  3M57 A; 
#chains in the Genus database with same CATH topology
 4J7I A;  3S7B A;  3IHX A;  4QEP A;  3F9Z A;  3S7F A;  3S7D A;  4Z4P A;  3RAY A;  1H3I A;  4O30 A;  4IJD A;  3MO2 A;  2O8J A;  1XQH A;  4J7F A;  2R3A A;  1ZKK A;  3OXG A;  5F59 A;  3EP0 A;  3M59 A;  2RFI A;  3MO5 A;  4J8O A;  3RQ4 A;  3PDN A;  3N71 A;  2G46 A;  5JIN A;  5CCM A;  4MI0 A;  4YNP A;  1N3J A;  5TH7 A;  3S7J A;  3FPD A;  3QWW A;  5HI7 A;  4NJ5 A;  5JHN A;  3QWV A;  2W5Z A;  5EX0 A;  5ARG A;  5KJL A;  3SWC A;  3DAL A;  4YPU A;  3CBP A;  5EX3 A;  4NVQ A;  5CPR B;  4YND A;  1PEG A;  4FMU A;  3F9Y A;  1MVX A;  3OXF A;  3CBO A;  5HQ8 A;  3MO0 A;  5KJN A;  1MVH A;  5CCL A;  1N6C A;  2W5Y A;  2F69 A;  3KMA A;  3QWP A;  3VUZ A;  4C1Q A;  4I51 A;  5JJ0 A;  2QPW A;  3F9X A;  3M58 A;  3M54 A;  3KMT A;  3RJW A;  4IJ8 A;  4AU7 A;  4YNM A;  4E47 A;  3M55 A;  2IGQ A;  2JV0 A;  5T0M A;  3M5A A;  4WUY A;  5AYF A;  5ARF A;  3M53 A;  4LDG A;  3M56 A;  3HNA A;  5JIY A;  5KJK A;  4QEO A;  4YPA A;  1MUF A;  4MI5 A;  3VV0 A;  3RU0 A;  3OOI A;  3TG4 A;  3F9W A;  3DB5 A;  3BO5 A;  4QEN A;  5F5E A;  5T0K A;  3OPE A;  3KMJ A;  4RZ0 A;  1MT6 A;  3CBM A;  4JDS A;  5T5G A;  3K5K A;  1ML9 A;  3RIB A;  3OXL A;  5EG2 A;  3OS5 A;  4JLG A;  3SW9 A;  5KJM A;  5LSX A;  4J83 A;  5F6K C;  5F6L A;  4YPE A;  5TTF A;  4BUP A;  1N6A A;  3S8P A;  3TG5 A;  5TEG A;  3MEK A;  2BQZ A;  5LSZ A;  1O9S A;  4O6F A;  4H12 A;  3M57 A; 
#chains in the Genus database with same CATH homology
 4J7I A;  3S7B A;  3IHX A;  4QEP A;  3F9Z A;  3S7F A;  3S7D A;  4Z4P A;  3RAY A;  1H3I A;  4O30 A;  4IJD A;  3MO2 A;  2O8J A;  1XQH A;  4J7F A;  2R3A A;  1ZKK A;  3OXG A;  5F59 A;  3EP0 A;  3M59 A;  2RFI A;  3MO5 A;  4J8O A;  3RQ4 A;  3PDN A;  3N71 A;  2G46 A;  5JIN A;  5CCM A;  4MI0 A;  4YNP A;  1N3J A;  5TH7 A;  3S7J A;  3FPD A;  3QWW A;  5HI7 A;  4NJ5 A;  5JHN A;  3QWV A;  2W5Z A;  5EX0 A;  5ARG A;  5KJL A;  3SWC A;  3DAL A;  4YPU A;  3CBP A;  5EX3 A;  4NVQ A;  5CPR B;  4YND A;  1PEG A;  4FMU A;  3F9Y A;  1MVX A;  3OXF A;  3CBO A;  5HQ8 A;  3MO0 A;  5KJN A;  1MVH A;  5CCL A;  1N6C A;  2W5Y A;  2F69 A;  3KMA A;  3QWP A;  3VUZ A;  4C1Q A;  4I51 A;  5JJ0 A;  2QPW A;  3F9X A;  3M58 A;  3M54 A;  3KMT A;  3RJW A;  4IJ8 A;  4AU7 A;  4YNM A;  4E47 A;  3M55 A;  2IGQ A;  2JV0 A;  5T0M A;  3M5A A;  4WUY A;  5AYF A;  5ARF A;  3M53 A;  4LDG A;  3M56 A;  3HNA A;  5JIY A;  5KJK A;  4QEO A;  4YPA A;  1MUF A;  4MI5 A;  3VV0 A;  3RU0 A;  3OOI A;  3TG4 A;  3F9W A;  3DB5 A;  3BO5 A;  4QEN A;  5F5E A;  5T0K A;  3OPE A;  3KMJ A;  4RZ0 A;  1MT6 A;  3CBM A;  4JDS A;  5T5G A;  3K5K A;  1ML9 A;  3RIB A;  3OXL A;  5EG2 A;  3OS5 A;  4JLG A;  3SW9 A;  5KJM A;  5LSX A;  4J83 A;  5F6K C;  5F6L A;  4YPE A;  5TTF A;  4BUP A;  1N6A A;  3S8P A;  3TG5 A;  5TEG A;  3MEK A;  2BQZ A;  5LSZ A;  1O9S A;  4O6F A;  4H12 A;  3M57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...