3BO5A

Crystal structure of methyltransferase domain of human histone-lysine n-methyltransferase setmar
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
279
structure length
269
Chain Sequence
TEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFPGCICVKTPCLPGTCSCLRHGENYDDNSCLRDKYAEPVFECNVLCRCSDHCRNRVVQKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYIIAIREHVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFLPFDSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Methyltransferase Domain of Human Histone-lysine N-methyltransferase SETMAR in Complex With AdoHcy.
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SETMAR
total genus 71
structure length 269
sequence length 279
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2007-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3bo5A00
1ML9A 2W5YA 4IJ8A 1MVHA 5CPRB 5T5GA 3QWVA 2O8JA 3S7JA 5JINA 5TH7A 3CBPA 4BUPA 3IHXA 4H12A 2RFIA 1ZKKA 5KJMA 2JV0A 2R3AA 4MI5A 4YPAA 4JLGA 3FPDA 4C1QA 1N6CA 3KMAA 3MO2A 4QEOA 1XQHA 4RZ0A 3VV0A 4LDGA 4J7FA 5EG2A 3TG4A 3CBOA 3HNAA 3M5AA 5F6LA 3KMJA 1H3IA 3F9ZA 5F6KC 3OXGA 3OOIA 5F59A 4WUYA 1MVXA 3EP0A 3RQ4A 5KJLA 3MO5A 1MUFA 3F9XA 3S7FA 3SWCA 4FMUA 3N71A 3CBMA 5JHNA 5LSXA 3BO5A 3RIBA 1N3JA 5HQ8A 3M54A 4QENA 4O30A 3DB5A 3M53A 3K5KA 1O9SA 1N6AA 5EX0A 4AU7A 5F5EA 5EX3A 5JIYA 3OXLA 3RJWA 4O6FA 2W5ZA 3M59A 4J7IA 3F9YA 3QWPA 4YPEA 4I51A 3TG5A 3RU0A 5KJKA 4YNDA 5T0KA 4NVQA 3M56A 5CCLA 5KJNA 5TEGA 2BQZA 4JDSA 3OPEA 4IJDA 1PEGA 3MO0A 4QEPA 3M57A 3S7DA 4J83A 4Z4PA 5AYFA 5LSZA 1MT6A 3QWWA 5ARFA 3F9WA 3M55A 4YNMA 4MI0A 3OXFA 2QPWA 3DALA 3PDNA 5ARGA 5JJ0A 5CCMA 3RAYA 4YNPA 4YPUA 3OS5A 4J8OA 5HI7A 5TTFA 5T0MA 3M58A 2IGQA 2F69A 3VUZA 3S7BA 3KMTA 3MEKA 4NJ5A 3SW9A 4E47A 2G46A 3S8PA
chains in the Genus database with same CATH superfamily
1ML9A 2W5YA 4IJ8A 1MVHA 5CPRB 5T5GA 3QWVA 2O8JA 3S7JA 5JINA 5TH7A 3CBPA 4BUPA 3IHXA 4H12A 2RFIA 1ZKKA 5KJMA 2JV0A 2R3AA 4MI5A 4YPAA 4JLGA 3FPDA 4C1QA 1N6CA 3KMAA 3MO2A 4QEOA 1XQHA 4RZ0A 3VV0A 4LDGA 4J7FA 5EG2A 3TG4A 3CBOA 3HNAA 3M5AA 5F6LA 3KMJA 1H3IA 3F9ZA 5F6KC 3OXGA 3OOIA 5F59A 4WUYA 1MVXA 3EP0A 3RQ4A 5KJLA 3MO5A 1MUFA 3F9XA 3S7FA 3SWCA 4FMUA 3N71A 3CBMA 5JHNA 5LSXA 3BO5A 3RIBA 1N3JA 5HQ8A 3M54A 4QENA 4O30A 3DB5A 3M53A 3K5KA 1O9SA 1N6AA 5EX0A 4AU7A 5F5EA 5EX3A 5JIYA 3OXLA 3RJWA 4O6FA 2W5ZA 3M59A 4J7IA 3F9YA 3QWPA 4YPEA 4I51A 3TG5A 3RU0A 5KJKA 4YNDA 5T0KA 4NVQA 3M56A 5CCLA 5KJNA 5TEGA 2BQZA 4JDSA 3OPEA 4IJDA 1PEGA 3MO0A 4QEPA 3M57A 3S7DA 4J83A 4Z4PA 5AYFA 5LSZA 1MT6A 3QWWA 5ARFA 3F9WA 3M55A 4YNMA 4MI0A 3OXFA 2QPWA 3DALA 3PDNA 5ARGA 5JJ0A 5CCMA 3RAYA 4YNPA 4YPUA 3OS5A 4J8OA 5HI7A 5TTFA 5T0MA 3M58A 2IGQA 2F69A 3VUZA 3S7BA 3KMTA 3MEKA 4NJ5A 3SW9A 4E47A 2G46A 3S8PA
chains in the Genus database with same CATH topology
1ML9A 2W5YA 4IJ8A 1MVHA 5CPRB 5T5GA 3QWVA 2O8JA 3S7JA 5JINA 5TH7A 3CBPA 4BUPA 3IHXA 4H12A 2RFIA 1ZKKA 5KJMA 2JV0A 2R3AA 4MI5A 4YPAA 4JLGA 3FPDA 4C1QA 1N6CA 3KMAA 3MO2A 4QEOA 1XQHA 4RZ0A 3VV0A 4LDGA 4J7FA 5EG2A 3TG4A 3CBOA 3HNAA 3M5AA 5F6LA 3KMJA 1H3IA 3F9ZA 5F6KC 3OXGA 3OOIA 5F59A 4WUYA 1MVXA 3EP0A 3RQ4A 5KJLA 3MO5A 1MUFA 3F9XA 3S7FA 3SWCA 4FMUA 3N71A 3CBMA 5JHNA 5LSXA 3BO5A 3RIBA 1N3JA 5HQ8A 3M54A 4QENA 4O30A 3DB5A 3M53A 3K5KA 1O9SA 1N6AA 5EX0A 4AU7A 5F5EA 5EX3A 5JIYA 3OXLA 3RJWA 4O6FA 2W5ZA 3M59A 4J7IA 3F9YA 3QWPA 4YPEA 4I51A 3TG5A 3RU0A 5KJKA 4YNDA 5T0KA 4NVQA 3M56A 5CCLA 5KJNA 5TEGA 2BQZA 4JDSA 3OPEA 4IJDA 1PEGA 3MO0A 4QEPA 3M57A 3S7DA 4J83A 4Z4PA 5AYFA 5LSZA 1MT6A 3QWWA 5ARFA 3F9WA 3M55A 4YNMA 4MI0A 3OXFA 2QPWA 3DALA 3PDNA 5ARGA 5JJ0A 5CCMA 3RAYA 4YNPA 4YPUA 3OS5A 4J8OA 5HI7A 5TTFA 5T0MA 3M58A 2IGQA 2F69A 3VUZA 3S7BA 3KMTA 3MEKA 4NJ5A 3SW9A 4E47A 2G46A 3S8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ML9 A;  2W5Y A;  4IJ8 A;  1MVH A;  5CPR B;  5T5G A;  3QWV A;  2O8J A;  3S7J A;  5JIN A;  5TH7 A;  3CBP A;  4BUP A;  3IHX A;  4H12 A;  2RFI A;  1ZKK A;  5KJM A;  2JV0 A;  2R3A A;  4MI5 A;  4YPA A;  4JLG A;  3FPD A;  4C1Q A;  1N6C A;  3KMA A;  3MO2 A;  4QEO A;  1XQH A;  4RZ0 A;  3VV0 A;  4LDG A;  4J7F A;  5EG2 A;  3TG4 A;  3CBO A;  3HNA A;  3M5A A;  5F6L A;  3KMJ A;  1H3I A;  3F9Z A;  5F6K C;  3OXG A;  3OOI A;  5F59 A;  4WUY A;  1MVX A;  3EP0 A;  3RQ4 A;  5KJL A;  3MO5 A;  1MUF A;  3F9X A;  3S7F A;  3SWC A;  4FMU A;  3N71 A;  3CBM A;  5JHN A;  5LSX A;  3BO5 A;  3RIB A;  1N3J A;  5HQ8 A;  3M54 A;  4QEN A;  4O30 A;  3DB5 A;  3M53 A;  3K5K A;  1O9S A;  1N6A A;  5EX0 A;  4AU7 A;  5F5E A;  5EX3 A;  5JIY A;  3OXL A;  3RJW A;  4O6F A;  2W5Z A;  3M59 A;  4J7I A;  3F9Y A;  3QWP A;  4YPE A;  4I51 A;  3TG5 A;  3RU0 A;  5KJK A;  4YND A;  5T0K A;  4NVQ A;  3M56 A;  5CCL A;  5KJN A;  5TEG A;  2BQZ A;  4JDS A;  3OPE A;  4IJD A;  1PEG A;  3MO0 A;  4QEP A;  3M57 A;  3S7D A;  4J83 A;  4Z4P A;  5AYF A;  5LSZ A;  1MT6 A;  3QWW A;  5ARF A;  3F9W A;  3M55 A;  4YNM A;  4MI0 A;  3OXF A;  2QPW A;  3DAL A;  3PDN A;  5ARG A;  5JJ0 A;  5CCM A;  3RAY A;  4YNP A;  4YPU A;  3OS5 A;  4J8O A;  5HI7 A;  5TTF A;  5T0M A;  3M58 A;  2IGQ A;  2F69 A;  3VUZ A;  3S7B A;  3KMT A;  3MEK A;  4NJ5 A;  3SW9 A;  4E47 A;  2G46 A;  3S8P A; 
#chains in the Genus database with same CATH topology
 1ML9 A;  2W5Y A;  4IJ8 A;  1MVH A;  5CPR B;  5T5G A;  3QWV A;  2O8J A;  3S7J A;  5JIN A;  5TH7 A;  3CBP A;  4BUP A;  3IHX A;  4H12 A;  2RFI A;  1ZKK A;  5KJM A;  2JV0 A;  2R3A A;  4MI5 A;  4YPA A;  4JLG A;  3FPD A;  4C1Q A;  1N6C A;  3KMA A;  3MO2 A;  4QEO A;  1XQH A;  4RZ0 A;  3VV0 A;  4LDG A;  4J7F A;  5EG2 A;  3TG4 A;  3CBO A;  3HNA A;  3M5A A;  5F6L A;  3KMJ A;  1H3I A;  3F9Z A;  5F6K C;  3OXG A;  3OOI A;  5F59 A;  4WUY A;  1MVX A;  3EP0 A;  3RQ4 A;  5KJL A;  3MO5 A;  1MUF A;  3F9X A;  3S7F A;  3SWC A;  4FMU A;  3N71 A;  3CBM A;  5JHN A;  5LSX A;  3BO5 A;  3RIB A;  1N3J A;  5HQ8 A;  3M54 A;  4QEN A;  4O30 A;  3DB5 A;  3M53 A;  3K5K A;  1O9S A;  1N6A A;  5EX0 A;  4AU7 A;  5F5E A;  5EX3 A;  5JIY A;  3OXL A;  3RJW A;  4O6F A;  2W5Z A;  3M59 A;  4J7I A;  3F9Y A;  3QWP A;  4YPE A;  4I51 A;  3TG5 A;  3RU0 A;  5KJK A;  4YND A;  5T0K A;  4NVQ A;  3M56 A;  5CCL A;  5KJN A;  5TEG A;  2BQZ A;  4JDS A;  3OPE A;  4IJD A;  1PEG A;  3MO0 A;  4QEP A;  3M57 A;  3S7D A;  4J83 A;  4Z4P A;  5AYF A;  5LSZ A;  1MT6 A;  3QWW A;  5ARF A;  3F9W A;  3M55 A;  4YNM A;  4MI0 A;  3OXF A;  2QPW A;  3DAL A;  3PDN A;  5ARG A;  5JJ0 A;  5CCM A;  3RAY A;  4YNP A;  4YPU A;  3OS5 A;  4J8O A;  5HI7 A;  5TTF A;  5T0M A;  3M58 A;  2IGQ A;  2F69 A;  3VUZ A;  3S7B A;  3KMT A;  3MEK A;  4NJ5 A;  3SW9 A;  4E47 A;  2G46 A;  3S8P A; 
#chains in the Genus database with same CATH homology
 1ML9 A;  2W5Y A;  4IJ8 A;  1MVH A;  5CPR B;  5T5G A;  3QWV A;  2O8J A;  3S7J A;  5JIN A;  5TH7 A;  3CBP A;  4BUP A;  3IHX A;  4H12 A;  2RFI A;  1ZKK A;  5KJM A;  2JV0 A;  2R3A A;  4MI5 A;  4YPA A;  4JLG A;  3FPD A;  4C1Q A;  1N6C A;  3KMA A;  3MO2 A;  4QEO A;  1XQH A;  4RZ0 A;  3VV0 A;  4LDG A;  4J7F A;  5EG2 A;  3TG4 A;  3CBO A;  3HNA A;  3M5A A;  5F6L A;  3KMJ A;  1H3I A;  3F9Z A;  5F6K C;  3OXG A;  3OOI A;  5F59 A;  4WUY A;  1MVX A;  3EP0 A;  3RQ4 A;  5KJL A;  3MO5 A;  1MUF A;  3F9X A;  3S7F A;  3SWC A;  4FMU A;  3N71 A;  3CBM A;  5JHN A;  5LSX A;  3BO5 A;  3RIB A;  1N3J A;  5HQ8 A;  3M54 A;  4QEN A;  4O30 A;  3DB5 A;  3M53 A;  3K5K A;  1O9S A;  1N6A A;  5EX0 A;  4AU7 A;  5F5E A;  5EX3 A;  5JIY A;  3OXL A;  3RJW A;  4O6F A;  2W5Z A;  3M59 A;  4J7I A;  3F9Y A;  3QWP A;  4YPE A;  4I51 A;  3TG5 A;  3RU0 A;  5KJK A;  4YND A;  5T0K A;  4NVQ A;  3M56 A;  5CCL A;  5KJN A;  5TEG A;  2BQZ A;  4JDS A;  3OPE A;  4IJD A;  1PEG A;  3MO0 A;  4QEP A;  3M57 A;  3S7D A;  4J83 A;  4Z4P A;  5AYF A;  5LSZ A;  1MT6 A;  3QWW A;  5ARF A;  3F9W A;  3M55 A;  4YNM A;  4MI0 A;  3OXF A;  2QPW A;  3DAL A;  3PDN A;  5ARG A;  5JJ0 A;  5CCM A;  3RAY A;  4YNP A;  4YPU A;  3OS5 A;  4J8O A;  5HI7 A;  5TTF A;  5T0M A;  3M58 A;  2IGQ A;  2F69 A;  3VUZ A;  3S7B A;  3KMT A;  3MEK A;  4NJ5 A;  3SW9 A;  4E47 A;  2G46 A;  3S8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...