3BO5A

Crystal structure of methyltransferase domain of human histone-lysine n-methyltransferase setmar
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
279
structure length
269
Chain Sequence
TEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFPGCICVKTPCLPGTCSCLRHGENYDDNSCLRDKYAEPVFECNVLCRCSDHCRNRVVQKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYIIAIREHVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFLPFDSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase SETMAR
publication title The Crystal Structure of Methyltransferase Domain of Human Histone-lysine N-methyltransferase SETMAR in Complex With AdoHcy.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 71
structure length 269
sequence length 279
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2007-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3bo5A00
4J83A 3RAYA 3K5KA 5CCLA 1XQHA 3TG4A 4E47A 3TG5A 5EX3A 5F5EA 3CBOA 3F9XA 2IGQA 4IJDA 4FMUA 3S7FA 3KMAA 4YPAA 1MUFA 4IJ8A 3MO2A 4QEOA 3BO5A 3F9WA 4LDGA 3HNAA 2W5YA 3M58A 4C1QA 3VV0A 4RZ0A 5F59A 3QWPA 2BQZA 2W5ZA 3DALA 3M53A 2QPWA 2O8JA 5ARFA 5AYFA 1N6AA 3QWWA 5TEGA 3MEKA 3S8PA 5KJLA 5KJMA 2F69A 4BUPA 2RFIA 5HQ8A 3S7BA 5KJKA 1MT6A 1N6CA 3MO0A 4NJ5A 3RIBA 3KMJA 4YPUA 4YPEA 3M55A 4J7IA 3MO5A 4O30A 3M54A 3OXGA 3CBMA 5LSXA 3OXFA 3SWCA 1ZKKA 4AU7A 5LSZA 4WUYA 4Z4PA 1MVXA 3S7DA 3N71A 3RU0A 4MI0A 1MVHA 3RJWA 3CBPA 3M56A 4QEPA 3OS5A 3OPEA 1H3IA 5CPRB 3VUZA 3QWVA 5HI7A 3PDNA 5F6LA 3OXLA 5KJNA 3OOIA 4MI5A 3FPDA 3KMTA 3M5AA 4J7FA 5JINA 3RQ4A 4YNPA 1ML9A 3SW9A 5T0KA 5T5GA 3F9YA 5JHNA 3S7JA 4O6FA 5EG2A 5ARGA 3M59A 1N3JA 5T0MA 2JV0A 5JJ0A 3EP0A 4QENA 2R3AA 4JDSA 4JLGA 5F6KC 4NVQA 5CCMA 4J8OA 3F9ZA 5TH7A 4YNMA 2G46A 5TTFA 3DB5A 3M57A 1O9SA 3IHXA 4I51A 5JIYA 4H12A 5EX0A 4YNDA 1PEGA
chains in the Genus database with same CATH superfamily
4J83A 3RAYA 3K5KA 5CCLA 1XQHA 3TG4A 4E47A 3TG5A 5EX3A 5F5EA 3CBOA 3F9XA 2IGQA 4IJDA 4FMUA 3S7FA 3KMAA 4YPAA 1MUFA 4IJ8A 3MO2A 4QEOA 3BO5A 3F9WA 4LDGA 3HNAA 2W5YA 3M58A 4C1QA 3VV0A 4RZ0A 5F59A 3QWPA 2BQZA 2W5ZA 3DALA 3M53A 2QPWA 2O8JA 5ARFA 5AYFA 1N6AA 3QWWA 5TEGA 3MEKA 3S8PA 5KJLA 5KJMA 2F69A 4BUPA 2RFIA 5HQ8A 3S7BA 5KJKA 1MT6A 1N6CA 3MO0A 4NJ5A 3RIBA 3KMJA 4YPUA 4YPEA 3M55A 4J7IA 3MO5A 4O30A 3M54A 3OXGA 3CBMA 5LSXA 3OXFA 3SWCA 1ZKKA 4AU7A 5LSZA 4WUYA 4Z4PA 1MVXA 3S7DA 3N71A 3RU0A 4MI0A 1MVHA 3RJWA 3CBPA 3M56A 4QEPA 3OS5A 3OPEA 1H3IA 5CPRB 3VUZA 3QWVA 5HI7A 3PDNA 5F6LA 3OXLA 5KJNA 3OOIA 4MI5A 3FPDA 3KMTA 3M5AA 4J7FA 5JINA 3RQ4A 4YNPA 1ML9A 3SW9A 5T0KA 5T5GA 3F9YA 5JHNA 3S7JA 4O6FA 5EG2A 5ARGA 3M59A 1N3JA 5T0MA 2JV0A 5JJ0A 3EP0A 4QENA 2R3AA 4JDSA 4JLGA 5F6KC 4NVQA 5CCMA 4J8OA 3F9ZA 5TH7A 4YNMA 2G46A 5TTFA 3DB5A 3M57A 1O9SA 3IHXA 4I51A 5JIYA 4H12A 5EX0A 4YNDA 1PEGA
chains in the Genus database with same CATH topology
4J83A 3RAYA 3K5KA 5CCLA 1XQHA 3TG4A 4E47A 3TG5A 5EX3A 5F5EA 3CBOA 3F9XA 2IGQA 4IJDA 4FMUA 3S7FA 3KMAA 4YPAA 1MUFA 4IJ8A 3MO2A 4QEOA 3BO5A 3F9WA 4LDGA 3HNAA 2W5YA 3M58A 4C1QA 3VV0A 4RZ0A 5F59A 3QWPA 2BQZA 2W5ZA 3DALA 3M53A 2QPWA 2O8JA 5ARFA 5AYFA 1N6AA 3QWWA 5TEGA 3MEKA 3S8PA 5KJLA 5KJMA 2F69A 4BUPA 2RFIA 5HQ8A 3S7BA 5KJKA 1MT6A 1N6CA 3MO0A 4NJ5A 3RIBA 3KMJA 4YPUA 4YPEA 3M55A 4J7IA 3MO5A 4O30A 3M54A 3OXGA 3CBMA 5LSXA 3OXFA 3SWCA 1ZKKA 4AU7A 5LSZA 4WUYA 4Z4PA 1MVXA 3S7DA 3N71A 3RU0A 4MI0A 1MVHA 3RJWA 3CBPA 3M56A 4QEPA 3OS5A 3OPEA 1H3IA 5CPRB 3VUZA 3QWVA 5HI7A 3PDNA 5F6LA 3OXLA 5KJNA 3OOIA 4MI5A 3FPDA 3KMTA 3M5AA 4J7FA 5JINA 3RQ4A 4YNPA 1ML9A 3SW9A 5T0KA 5T5GA 3F9YA 5JHNA 3S7JA 4O6FA 5EG2A 5ARGA 3M59A 1N3JA 5T0MA 2JV0A 5JJ0A 3EP0A 4QENA 2R3AA 4JDSA 4JLGA 5F6KC 4NVQA 5CCMA 4J8OA 3F9ZA 5TH7A 4YNMA 2G46A 5TTFA 3DB5A 3M57A 1O9SA 3IHXA 4I51A 5JIYA 4H12A 5EX0A 4YNDA 1PEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J83 A;  3RAY A;  3K5K A;  5CCL A;  1XQH A;  3TG4 A;  4E47 A;  3TG5 A;  5EX3 A;  5F5E A;  3CBO A;  3F9X A;  2IGQ A;  4IJD A;  4FMU A;  3S7F A;  3KMA A;  4YPA A;  1MUF A;  4IJ8 A;  3MO2 A;  4QEO A;  3BO5 A;  3F9W A;  4LDG A;  3HNA A;  2W5Y A;  3M58 A;  4C1Q A;  3VV0 A;  4RZ0 A;  5F59 A;  3QWP A;  2BQZ A;  2W5Z A;  3DAL A;  3M53 A;  2QPW A;  2O8J A;  5ARF A;  5AYF A;  1N6A A;  3QWW A;  5TEG A;  3MEK A;  3S8P A;  5KJL A;  5KJM A;  2F69 A;  4BUP A;  2RFI A;  5HQ8 A;  3S7B A;  5KJK A;  1MT6 A;  1N6C A;  3MO0 A;  4NJ5 A;  3RIB A;  3KMJ A;  4YPU A;  4YPE A;  3M55 A;  4J7I A;  3MO5 A;  4O30 A;  3M54 A;  3OXG A;  3CBM A;  5LSX A;  3OXF A;  3SWC A;  1ZKK A;  4AU7 A;  5LSZ A;  4WUY A;  4Z4P A;  1MVX A;  3S7D A;  3N71 A;  3RU0 A;  4MI0 A;  1MVH A;  3RJW A;  3CBP A;  3M56 A;  4QEP A;  3OS5 A;  3OPE A;  1H3I A;  5CPR B;  3VUZ A;  3QWV A;  5HI7 A;  3PDN A;  5F6L A;  3OXL A;  5KJN A;  3OOI A;  4MI5 A;  3FPD A;  3KMT A;  3M5A A;  4J7F A;  5JIN A;  3RQ4 A;  4YNP A;  1ML9 A;  3SW9 A;  5T0K A;  5T5G A;  3F9Y A;  5JHN A;  3S7J A;  4O6F A;  5EG2 A;  5ARG A;  3M59 A;  1N3J A;  5T0M A;  2JV0 A;  5JJ0 A;  3EP0 A;  4QEN A;  2R3A A;  4JDS A;  4JLG A;  5F6K C;  4NVQ A;  5CCM A;  4J8O A;  3F9Z A;  5TH7 A;  4YNM A;  2G46 A;  5TTF A;  3DB5 A;  3M57 A;  1O9S A;  3IHX A;  4I51 A;  5JIY A;  4H12 A;  5EX0 A;  4YND A;  1PEG A; 
#chains in the Genus database with same CATH topology
 4J83 A;  3RAY A;  3K5K A;  5CCL A;  1XQH A;  3TG4 A;  4E47 A;  3TG5 A;  5EX3 A;  5F5E A;  3CBO A;  3F9X A;  2IGQ A;  4IJD A;  4FMU A;  3S7F A;  3KMA A;  4YPA A;  1MUF A;  4IJ8 A;  3MO2 A;  4QEO A;  3BO5 A;  3F9W A;  4LDG A;  3HNA A;  2W5Y A;  3M58 A;  4C1Q A;  3VV0 A;  4RZ0 A;  5F59 A;  3QWP A;  2BQZ A;  2W5Z A;  3DAL A;  3M53 A;  2QPW A;  2O8J A;  5ARF A;  5AYF A;  1N6A A;  3QWW A;  5TEG A;  3MEK A;  3S8P A;  5KJL A;  5KJM A;  2F69 A;  4BUP A;  2RFI A;  5HQ8 A;  3S7B A;  5KJK A;  1MT6 A;  1N6C A;  3MO0 A;  4NJ5 A;  3RIB A;  3KMJ A;  4YPU A;  4YPE A;  3M55 A;  4J7I A;  3MO5 A;  4O30 A;  3M54 A;  3OXG A;  3CBM A;  5LSX A;  3OXF A;  3SWC A;  1ZKK A;  4AU7 A;  5LSZ A;  4WUY A;  4Z4P A;  1MVX A;  3S7D A;  3N71 A;  3RU0 A;  4MI0 A;  1MVH A;  3RJW A;  3CBP A;  3M56 A;  4QEP A;  3OS5 A;  3OPE A;  1H3I A;  5CPR B;  3VUZ A;  3QWV A;  5HI7 A;  3PDN A;  5F6L A;  3OXL A;  5KJN A;  3OOI A;  4MI5 A;  3FPD A;  3KMT A;  3M5A A;  4J7F A;  5JIN A;  3RQ4 A;  4YNP A;  1ML9 A;  3SW9 A;  5T0K A;  5T5G A;  3F9Y A;  5JHN A;  3S7J A;  4O6F A;  5EG2 A;  5ARG A;  3M59 A;  1N3J A;  5T0M A;  2JV0 A;  5JJ0 A;  3EP0 A;  4QEN A;  2R3A A;  4JDS A;  4JLG A;  5F6K C;  4NVQ A;  5CCM A;  4J8O A;  3F9Z A;  5TH7 A;  4YNM A;  2G46 A;  5TTF A;  3DB5 A;  3M57 A;  1O9S A;  3IHX A;  4I51 A;  5JIY A;  4H12 A;  5EX0 A;  4YND A;  1PEG A; 
#chains in the Genus database with same CATH homology
 4J83 A;  3RAY A;  3K5K A;  5CCL A;  1XQH A;  3TG4 A;  4E47 A;  3TG5 A;  5EX3 A;  5F5E A;  3CBO A;  3F9X A;  2IGQ A;  4IJD A;  4FMU A;  3S7F A;  3KMA A;  4YPA A;  1MUF A;  4IJ8 A;  3MO2 A;  4QEO A;  3BO5 A;  3F9W A;  4LDG A;  3HNA A;  2W5Y A;  3M58 A;  4C1Q A;  3VV0 A;  4RZ0 A;  5F59 A;  3QWP A;  2BQZ A;  2W5Z A;  3DAL A;  3M53 A;  2QPW A;  2O8J A;  5ARF A;  5AYF A;  1N6A A;  3QWW A;  5TEG A;  3MEK A;  3S8P A;  5KJL A;  5KJM A;  2F69 A;  4BUP A;  2RFI A;  5HQ8 A;  3S7B A;  5KJK A;  1MT6 A;  1N6C A;  3MO0 A;  4NJ5 A;  3RIB A;  3KMJ A;  4YPU A;  4YPE A;  3M55 A;  4J7I A;  3MO5 A;  4O30 A;  3M54 A;  3OXG A;  3CBM A;  5LSX A;  3OXF A;  3SWC A;  1ZKK A;  4AU7 A;  5LSZ A;  4WUY A;  4Z4P A;  1MVX A;  3S7D A;  3N71 A;  3RU0 A;  4MI0 A;  1MVH A;  3RJW A;  3CBP A;  3M56 A;  4QEP A;  3OS5 A;  3OPE A;  1H3I A;  5CPR B;  3VUZ A;  3QWV A;  5HI7 A;  3PDN A;  5F6L A;  3OXL A;  5KJN A;  3OOI A;  4MI5 A;  3FPD A;  3KMT A;  3M5A A;  4J7F A;  5JIN A;  3RQ4 A;  4YNP A;  1ML9 A;  3SW9 A;  5T0K A;  5T5G A;  3F9Y A;  5JHN A;  3S7J A;  4O6F A;  5EG2 A;  5ARG A;  3M59 A;  1N3J A;  5T0M A;  2JV0 A;  5JJ0 A;  3EP0 A;  4QEN A;  2R3A A;  4JDS A;  4JLG A;  5F6K C;  4NVQ A;  5CCM A;  4J8O A;  3F9Z A;  5TH7 A;  4YNM A;  2G46 A;  5TTF A;  3DB5 A;  3M57 A;  1O9S A;  3IHX A;  4I51 A;  5JIY A;  4H12 A;  5EX0 A;  4YND A;  1PEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...