3BO5A

Crystal structure of methyltransferase domain of human histone-lysine n-methyltransferase setmar
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
279
structure length
269
Chain Sequence
TEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFPGCICVKTPCLPGTCSCLRHGENYDDNSCLRDKYAEPVFECNVLCRCSDHCRNRVVQKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYIIAIREHVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFLPFDSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SETMAR
publication title The Crystal Structure of Methyltransferase Domain of Human Histone-lysine N-methyltransferase SETMAR in Complex With AdoHcy.
rcsb
source organism Homo sapiens
total genus 71
structure length 269
sequence length 279
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2007-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3bo5A00
5F6KC 1ML9A 5TH7A 4YPUA 3M53A 5T0KA 3TG5A 3HNAA 5KJMA 3OS5A 2RFIA 5HI7A 3DB5A 5CPRB 3EP0A 5TEGA 3VUZA 3F9ZA 3M54A 4AU7A 4NVQA 2G46A 5ARFA 5EX3A 4JDSA 3RIBA 3QWPA 2W5ZA 3RU0A 3S7JA 3MO0A 4LDGA 3M58A 1N6CA 4J83A 1MT6A 1MVHA 3S7BA 1XQHA 3DALA 2IGQA 3CBMA 3KMAA 4YNDA 5EG2A 4J7FA 5ARGA 1MUFA 3FPDA 4JLGA 4O30A 4RZ0A 5F59A 3VV0A 3OPEA 1PEGA 4QEOA 4IJ8A 4O6FA 3F9WA 4YPAA 5JJ0A 5JIYA 5EX0A 3MO5A 3RJWA 5LSXA 5HQ8A 5JHNA 3K5KA 4IJDA 4E47A 3BO5A 3SW9A 3QWVA 5F6LA 4YNPA 2O8JA 3M5AA 3F9YA 5LSZA 3MEKA 3OXLA 4QENA 4QEPA 1H3IA 2F69A 3KMTA 3S7FA 3M59A 4MI0A 3N71A 3F9XA 3RAYA 3CBOA 3PDNA 4WUYA 5T0MA 2R3AA 5F5EA 4Z4PA 3KMJA 3TG4A 4C1QA 4YNMA 1MVXA 3QWWA 5CCMA 4J7IA 2W5YA 5T5GA 5TTFA 4J8OA 5KJLA 3M57A 5KJKA 1ZKKA 3S7DA 3M55A 3OOIA 2QPWA 4NJ5A 3IHXA 3OXFA 3S8PA 3SWCA 3RQ4A 2BQZA 3OXGA 4MI5A 4FMUA 5JINA 1N6AA 5CCLA 1O9SA 2JV0A 3CBPA 4H12A 5KJNA 4BUPA 5AYFA 3M56A 4YPEA 1N3JA 4I51A 3MO2A
chains in the Genus database with same CATH superfamily
5F6KC 1ML9A 5TH7A 4YPUA 3M53A 5T0KA 3TG5A 3HNAA 5KJMA 3OS5A 2RFIA 5HI7A 3DB5A 5CPRB 3EP0A 5TEGA 3VUZA 3F9ZA 3M54A 4AU7A 4NVQA 2G46A 5ARFA 5EX3A 4JDSA 3RIBA 3QWPA 2W5ZA 3RU0A 3S7JA 3MO0A 4LDGA 3M58A 1N6CA 4J83A 1MT6A 1MVHA 3S7BA 1XQHA 3DALA 2IGQA 3CBMA 3KMAA 4YNDA 5EG2A 4J7FA 5ARGA 1MUFA 3FPDA 4JLGA 4O30A 4RZ0A 5F59A 3VV0A 3OPEA 1PEGA 4QEOA 4IJ8A 4O6FA 3F9WA 4YPAA 5JJ0A 5JIYA 5EX0A 3MO5A 3RJWA 5LSXA 5HQ8A 5JHNA 3K5KA 4IJDA 4E47A 3BO5A 3SW9A 3QWVA 5F6LA 4YNPA 2O8JA 3M5AA 3F9YA 5LSZA 3MEKA 3OXLA 4QENA 4QEPA 1H3IA 2F69A 3KMTA 3S7FA 3M59A 4MI0A 3N71A 3F9XA 3RAYA 3CBOA 3PDNA 4WUYA 5T0MA 2R3AA 5F5EA 4Z4PA 3KMJA 3TG4A 4C1QA 4YNMA 1MVXA 3QWWA 5CCMA 4J7IA 2W5YA 5T5GA 5TTFA 4J8OA 5KJLA 3M57A 5KJKA 1ZKKA 3S7DA 3M55A 3OOIA 2QPWA 4NJ5A 3IHXA 3OXFA 3S8PA 3SWCA 3RQ4A 2BQZA 3OXGA 4MI5A 4FMUA 5JINA 1N6AA 5CCLA 1O9SA 2JV0A 3CBPA 4H12A 5KJNA 4BUPA 5AYFA 3M56A 4YPEA 1N3JA 4I51A 3MO2A
chains in the Genus database with same CATH topology
5F6KC 1ML9A 5TH7A 4YPUA 3M53A 5T0KA 3TG5A 3HNAA 5KJMA 3OS5A 2RFIA 5HI7A 3DB5A 5CPRB 3EP0A 5TEGA 3VUZA 3F9ZA 3M54A 4AU7A 4NVQA 2G46A 5ARFA 5EX3A 4JDSA 3RIBA 3QWPA 2W5ZA 3RU0A 3S7JA 3MO0A 4LDGA 3M58A 1N6CA 4J83A 1MT6A 1MVHA 3S7BA 1XQHA 3DALA 2IGQA 3CBMA 3KMAA 4YNDA 5EG2A 4J7FA 5ARGA 1MUFA 3FPDA 4JLGA 4O30A 4RZ0A 5F59A 3VV0A 3OPEA 1PEGA 4QEOA 4IJ8A 4O6FA 3F9WA 4YPAA 5JJ0A 5JIYA 5EX0A 3MO5A 3RJWA 5LSXA 5HQ8A 5JHNA 3K5KA 4IJDA 4E47A 3BO5A 3SW9A 3QWVA 5F6LA 4YNPA 2O8JA 3M5AA 3F9YA 5LSZA 3MEKA 3OXLA 4QENA 4QEPA 1H3IA 2F69A 3KMTA 3S7FA 3M59A 4MI0A 3N71A 3F9XA 3RAYA 3CBOA 3PDNA 4WUYA 5T0MA 2R3AA 5F5EA 4Z4PA 3KMJA 3TG4A 4C1QA 4YNMA 1MVXA 3QWWA 5CCMA 4J7IA 2W5YA 5T5GA 5TTFA 4J8OA 5KJLA 3M57A 5KJKA 1ZKKA 3S7DA 3M55A 3OOIA 2QPWA 4NJ5A 3IHXA 3OXFA 3S8PA 3SWCA 3RQ4A 2BQZA 3OXGA 4MI5A 4FMUA 5JINA 1N6AA 5CCLA 1O9SA 2JV0A 3CBPA 4H12A 5KJNA 4BUPA 5AYFA 3M56A 4YPEA 1N3JA 4I51A 3MO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F6K C;  1ML9 A;  5TH7 A;  4YPU A;  3M53 A;  5T0K A;  3TG5 A;  3HNA A;  5KJM A;  3OS5 A;  2RFI A;  5HI7 A;  3DB5 A;  5CPR B;  3EP0 A;  5TEG A;  3VUZ A;  3F9Z A;  3M54 A;  4AU7 A;  4NVQ A;  2G46 A;  5ARF A;  5EX3 A;  4JDS A;  3RIB A;  3QWP A;  2W5Z A;  3RU0 A;  3S7J A;  3MO0 A;  4LDG A;  3M58 A;  1N6C A;  4J83 A;  1MT6 A;  1MVH A;  3S7B A;  1XQH A;  3DAL A;  2IGQ A;  3CBM A;  3KMA A;  4YND A;  5EG2 A;  4J7F A;  5ARG A;  1MUF A;  3FPD A;  4JLG A;  4O30 A;  4RZ0 A;  5F59 A;  3VV0 A;  3OPE A;  1PEG A;  4QEO A;  4IJ8 A;  4O6F A;  3F9W A;  4YPA A;  5JJ0 A;  5JIY A;  5EX0 A;  3MO5 A;  3RJW A;  5LSX A;  5HQ8 A;  5JHN A;  3K5K A;  4IJD A;  4E47 A;  3BO5 A;  3SW9 A;  3QWV A;  5F6L A;  4YNP A;  2O8J A;  3M5A A;  3F9Y A;  5LSZ A;  3MEK A;  3OXL A;  4QEN A;  4QEP A;  1H3I A;  2F69 A;  3KMT A;  3S7F A;  3M59 A;  4MI0 A;  3N71 A;  3F9X A;  3RAY A;  3CBO A;  3PDN A;  4WUY A;  5T0M A;  2R3A A;  5F5E A;  4Z4P A;  3KMJ A;  3TG4 A;  4C1Q A;  4YNM A;  1MVX A;  3QWW A;  5CCM A;  4J7I A;  2W5Y A;  5T5G A;  5TTF A;  4J8O A;  5KJL A;  3M57 A;  5KJK A;  1ZKK A;  3S7D A;  3M55 A;  3OOI A;  2QPW A;  4NJ5 A;  3IHX A;  3OXF A;  3S8P A;  3SWC A;  3RQ4 A;  2BQZ A;  3OXG A;  4MI5 A;  4FMU A;  5JIN A;  1N6A A;  5CCL A;  1O9S A;  2JV0 A;  3CBP A;  4H12 A;  5KJN A;  4BUP A;  5AYF A;  3M56 A;  4YPE A;  1N3J A;  4I51 A;  3MO2 A; 
#chains in the Genus database with same CATH topology
 5F6K C;  1ML9 A;  5TH7 A;  4YPU A;  3M53 A;  5T0K A;  3TG5 A;  3HNA A;  5KJM A;  3OS5 A;  2RFI A;  5HI7 A;  3DB5 A;  5CPR B;  3EP0 A;  5TEG A;  3VUZ A;  3F9Z A;  3M54 A;  4AU7 A;  4NVQ A;  2G46 A;  5ARF A;  5EX3 A;  4JDS A;  3RIB A;  3QWP A;  2W5Z A;  3RU0 A;  3S7J A;  3MO0 A;  4LDG A;  3M58 A;  1N6C A;  4J83 A;  1MT6 A;  1MVH A;  3S7B A;  1XQH A;  3DAL A;  2IGQ A;  3CBM A;  3KMA A;  4YND A;  5EG2 A;  4J7F A;  5ARG A;  1MUF A;  3FPD A;  4JLG A;  4O30 A;  4RZ0 A;  5F59 A;  3VV0 A;  3OPE A;  1PEG A;  4QEO A;  4IJ8 A;  4O6F A;  3F9W A;  4YPA A;  5JJ0 A;  5JIY A;  5EX0 A;  3MO5 A;  3RJW A;  5LSX A;  5HQ8 A;  5JHN A;  3K5K A;  4IJD A;  4E47 A;  3BO5 A;  3SW9 A;  3QWV A;  5F6L A;  4YNP A;  2O8J A;  3M5A A;  3F9Y A;  5LSZ A;  3MEK A;  3OXL A;  4QEN A;  4QEP A;  1H3I A;  2F69 A;  3KMT A;  3S7F A;  3M59 A;  4MI0 A;  3N71 A;  3F9X A;  3RAY A;  3CBO A;  3PDN A;  4WUY A;  5T0M A;  2R3A A;  5F5E A;  4Z4P A;  3KMJ A;  3TG4 A;  4C1Q A;  4YNM A;  1MVX A;  3QWW A;  5CCM A;  4J7I A;  2W5Y A;  5T5G A;  5TTF A;  4J8O A;  5KJL A;  3M57 A;  5KJK A;  1ZKK A;  3S7D A;  3M55 A;  3OOI A;  2QPW A;  4NJ5 A;  3IHX A;  3OXF A;  3S8P A;  3SWC A;  3RQ4 A;  2BQZ A;  3OXG A;  4MI5 A;  4FMU A;  5JIN A;  1N6A A;  5CCL A;  1O9S A;  2JV0 A;  3CBP A;  4H12 A;  5KJN A;  4BUP A;  5AYF A;  3M56 A;  4YPE A;  1N3J A;  4I51 A;  3MO2 A; 
#chains in the Genus database with same CATH homology
 5F6K C;  1ML9 A;  5TH7 A;  4YPU A;  3M53 A;  5T0K A;  3TG5 A;  3HNA A;  5KJM A;  3OS5 A;  2RFI A;  5HI7 A;  3DB5 A;  5CPR B;  3EP0 A;  5TEG A;  3VUZ A;  3F9Z A;  3M54 A;  4AU7 A;  4NVQ A;  2G46 A;  5ARF A;  5EX3 A;  4JDS A;  3RIB A;  3QWP A;  2W5Z A;  3RU0 A;  3S7J A;  3MO0 A;  4LDG A;  3M58 A;  1N6C A;  4J83 A;  1MT6 A;  1MVH A;  3S7B A;  1XQH A;  3DAL A;  2IGQ A;  3CBM A;  3KMA A;  4YND A;  5EG2 A;  4J7F A;  5ARG A;  1MUF A;  3FPD A;  4JLG A;  4O30 A;  4RZ0 A;  5F59 A;  3VV0 A;  3OPE A;  1PEG A;  4QEO A;  4IJ8 A;  4O6F A;  3F9W A;  4YPA A;  5JJ0 A;  5JIY A;  5EX0 A;  3MO5 A;  3RJW A;  5LSX A;  5HQ8 A;  5JHN A;  3K5K A;  4IJD A;  4E47 A;  3BO5 A;  3SW9 A;  3QWV A;  5F6L A;  4YNP A;  2O8J A;  3M5A A;  3F9Y A;  5LSZ A;  3MEK A;  3OXL A;  4QEN A;  4QEP A;  1H3I A;  2F69 A;  3KMT A;  3S7F A;  3M59 A;  4MI0 A;  3N71 A;  3F9X A;  3RAY A;  3CBO A;  3PDN A;  4WUY A;  5T0M A;  2R3A A;  5F5E A;  4Z4P A;  3KMJ A;  3TG4 A;  4C1Q A;  4YNM A;  1MVX A;  3QWW A;  5CCM A;  4J7I A;  2W5Y A;  5T5G A;  5TTF A;  4J8O A;  5KJL A;  3M57 A;  5KJK A;  1ZKK A;  3S7D A;  3M55 A;  3OOI A;  2QPW A;  4NJ5 A;  3IHX A;  3OXF A;  3S8P A;  3SWC A;  3RQ4 A;  2BQZ A;  3OXG A;  4MI5 A;  4FMU A;  5JIN A;  1N6A A;  5CCL A;  1O9S A;  2JV0 A;  3CBP A;  4H12 A;  5KJN A;  4BUP A;  5AYF A;  3M56 A;  4YPE A;  1N3J A;  4I51 A;  3MO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...