3BO5A

Crystal structure of methyltransferase domain of human histone-lysine n-methyltransferase setmar
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
279
structure length
269
Chain Sequence
TEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFPGCICVKTPCLPGTCSCLRHGENYDDNSCLRDKYAEPVFECNVLCRCSDHCRNRVVQKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYIIAIREHVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFLPFDSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Methyltransferase Domain of Human Histone-lysine N-methyltransferase SETMAR in Complex With AdoHcy.
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SETMAR
total genus 71
structure length 269
sequence length 279
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2007-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3bo5A00
3IHXA 5KJMA 1ML9A 1MVXA 4O30A 2RFIA 3N71A 4J7FA 3OPEA 1H3IA 5TTFA 5F6KC 4J83A 4I51A 5EX0A 1MUFA 4RZ0A 2R3AA 4YNPA 5AYFA 3RU0A 3EP0A 3MO2A 5T5GA 4BUPA 3DALA 3TG4A 3VV0A 2IGQA 3BO5A 5F6LA 2O8JA 2W5ZA 1O9SA 3F9WA 1ZKKA 3OXFA 2G46A 4YNMA 3S7FA 4YPAA 3DB5A 3F9ZA 3M5AA 5TEGA 3M59A 2BQZA 4J8OA 1PEGA 4FMUA 5HQ8A 5ARFA 5JHNA 3S7DA 2W5YA 3TG5A 1N6AA 5F59A 5HI7A 4WUYA 4NJ5A 3SW9A 4QEPA 4YNDA 1N3JA 4AU7A 4JDSA 1MT6A 3OS5A 1MVHA 4MI0A 4Z4PA 5KJLA 4C1QA 3S8PA 3KMJA 1N6CA 2QPWA 3M55A 3SWCA 4JLGA 3RQ4A 3HNAA 5LSZA 2JV0A 3F9YA 5T0MA 5KJNA 3M53A 5ARGA 3F9XA 5LSXA 4LDGA 4O6FA 5JJ0A 3VUZA 3M56A 3MO0A 4IJDA 5CCLA 3K5KA 3PDNA 5EG2A 4MI5A 4QEOA 5TH7A 5EX3A 2F69A 3KMAA 3KMTA 4H12A 4YPUA 5CCMA 3RIBA 4YPEA 3MO5A 4NVQA 3MEKA 3FPDA 3S7JA 4IJ8A 1XQHA 3QWPA 5F5EA 3OXLA 4J7IA 3M58A 3RJWA 3QWWA 3S7BA 3M54A 4QENA 3CBPA 5CPRB 3M57A 3OXGA 3CBOA 3OOIA 3QWVA 5T0KA 3CBMA 3RAYA 5KJKA 5JIYA 5JINA 4E47A
chains in the Genus database with same CATH superfamily
3IHXA 5KJMA 1ML9A 1MVXA 4O30A 2RFIA 3N71A 4J7FA 3OPEA 1H3IA 5TTFA 5F6KC 4J83A 4I51A 5EX0A 1MUFA 4RZ0A 2R3AA 4YNPA 5AYFA 3RU0A 3EP0A 3MO2A 5T5GA 4BUPA 3DALA 3TG4A 3VV0A 2IGQA 3BO5A 5F6LA 2O8JA 2W5ZA 1O9SA 3F9WA 1ZKKA 3OXFA 2G46A 4YNMA 3S7FA 4YPAA 3DB5A 3F9ZA 3M5AA 5TEGA 3M59A 2BQZA 4J8OA 1PEGA 4FMUA 5HQ8A 5ARFA 5JHNA 3S7DA 2W5YA 3TG5A 1N6AA 5F59A 5HI7A 4WUYA 4NJ5A 3SW9A 4QEPA 4YNDA 1N3JA 4AU7A 4JDSA 1MT6A 3OS5A 1MVHA 4MI0A 4Z4PA 5KJLA 4C1QA 3S8PA 3KMJA 1N6CA 2QPWA 3M55A 3SWCA 4JLGA 3RQ4A 3HNAA 5LSZA 2JV0A 3F9YA 5T0MA 5KJNA 3M53A 5ARGA 3F9XA 5LSXA 4LDGA 4O6FA 5JJ0A 3VUZA 3M56A 3MO0A 4IJDA 5CCLA 3K5KA 3PDNA 5EG2A 4MI5A 4QEOA 5TH7A 5EX3A 2F69A 3KMAA 3KMTA 4H12A 4YPUA 5CCMA 3RIBA 4YPEA 3MO5A 4NVQA 3MEKA 3FPDA 3S7JA 4IJ8A 1XQHA 3QWPA 5F5EA 3OXLA 4J7IA 3M58A 3RJWA 3QWWA 3S7BA 3M54A 4QENA 3CBPA 5CPRB 3M57A 3OXGA 3CBOA 3OOIA 3QWVA 5T0KA 3CBMA 3RAYA 5KJKA 5JIYA 5JINA 4E47A
chains in the Genus database with same CATH topology
3IHXA 5KJMA 1ML9A 1MVXA 4O30A 2RFIA 3N71A 4J7FA 3OPEA 1H3IA 5TTFA 5F6KC 4J83A 4I51A 5EX0A 1MUFA 4RZ0A 2R3AA 4YNPA 5AYFA 3RU0A 3EP0A 3MO2A 5T5GA 4BUPA 3DALA 3TG4A 3VV0A 2IGQA 3BO5A 5F6LA 2O8JA 2W5ZA 1O9SA 3F9WA 1ZKKA 3OXFA 2G46A 4YNMA 3S7FA 4YPAA 3DB5A 3F9ZA 3M5AA 5TEGA 3M59A 2BQZA 4J8OA 1PEGA 4FMUA 5HQ8A 5ARFA 5JHNA 3S7DA 2W5YA 3TG5A 1N6AA 5F59A 5HI7A 4WUYA 4NJ5A 3SW9A 4QEPA 4YNDA 1N3JA 4AU7A 4JDSA 1MT6A 3OS5A 1MVHA 4MI0A 4Z4PA 5KJLA 4C1QA 3S8PA 3KMJA 1N6CA 2QPWA 3M55A 3SWCA 4JLGA 3RQ4A 3HNAA 5LSZA 2JV0A 3F9YA 5T0MA 5KJNA 3M53A 5ARGA 3F9XA 5LSXA 4LDGA 4O6FA 5JJ0A 3VUZA 3M56A 3MO0A 4IJDA 5CCLA 3K5KA 3PDNA 5EG2A 4MI5A 4QEOA 5TH7A 5EX3A 2F69A 3KMAA 3KMTA 4H12A 4YPUA 5CCMA 3RIBA 4YPEA 3MO5A 4NVQA 3MEKA 3FPDA 3S7JA 4IJ8A 1XQHA 3QWPA 5F5EA 3OXLA 4J7IA 3M58A 3RJWA 3QWWA 3S7BA 3M54A 4QENA 3CBPA 5CPRB 3M57A 3OXGA 3CBOA 3OOIA 3QWVA 5T0KA 3CBMA 3RAYA 5KJKA 5JIYA 5JINA 4E47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IHX A;  5KJM A;  1ML9 A;  1MVX A;  4O30 A;  2RFI A;  3N71 A;  4J7F A;  3OPE A;  1H3I A;  5TTF A;  5F6K C;  4J83 A;  4I51 A;  5EX0 A;  1MUF A;  4RZ0 A;  2R3A A;  4YNP A;  5AYF A;  3RU0 A;  3EP0 A;  3MO2 A;  5T5G A;  4BUP A;  3DAL A;  3TG4 A;  3VV0 A;  2IGQ A;  3BO5 A;  5F6L A;  2O8J A;  2W5Z A;  1O9S A;  3F9W A;  1ZKK A;  3OXF A;  2G46 A;  4YNM A;  3S7F A;  4YPA A;  3DB5 A;  3F9Z A;  3M5A A;  5TEG A;  3M59 A;  2BQZ A;  4J8O A;  1PEG A;  4FMU A;  5HQ8 A;  5ARF A;  5JHN A;  3S7D A;  2W5Y A;  3TG5 A;  1N6A A;  5F59 A;  5HI7 A;  4WUY A;  4NJ5 A;  3SW9 A;  4QEP A;  4YND A;  1N3J A;  4AU7 A;  4JDS A;  1MT6 A;  3OS5 A;  1MVH A;  4MI0 A;  4Z4P A;  5KJL A;  4C1Q A;  3S8P A;  3KMJ A;  1N6C A;  2QPW A;  3M55 A;  3SWC A;  4JLG A;  3RQ4 A;  3HNA A;  5LSZ A;  2JV0 A;  3F9Y A;  5T0M A;  5KJN A;  3M53 A;  5ARG A;  3F9X A;  5LSX A;  4LDG A;  4O6F A;  5JJ0 A;  3VUZ A;  3M56 A;  3MO0 A;  4IJD A;  5CCL A;  3K5K A;  3PDN A;  5EG2 A;  4MI5 A;  4QEO A;  5TH7 A;  5EX3 A;  2F69 A;  3KMA A;  3KMT A;  4H12 A;  4YPU A;  5CCM A;  3RIB A;  4YPE A;  3MO5 A;  4NVQ A;  3MEK A;  3FPD A;  3S7J A;  4IJ8 A;  1XQH A;  3QWP A;  5F5E A;  3OXL A;  4J7I A;  3M58 A;  3RJW A;  3QWW A;  3S7B A;  3M54 A;  4QEN A;  3CBP A;  5CPR B;  3M57 A;  3OXG A;  3CBO A;  3OOI A;  3QWV A;  5T0K A;  3CBM A;  3RAY A;  5KJK A;  5JIY A;  5JIN A;  4E47 A; 
#chains in the Genus database with same CATH topology
 3IHX A;  5KJM A;  1ML9 A;  1MVX A;  4O30 A;  2RFI A;  3N71 A;  4J7F A;  3OPE A;  1H3I A;  5TTF A;  5F6K C;  4J83 A;  4I51 A;  5EX0 A;  1MUF A;  4RZ0 A;  2R3A A;  4YNP A;  5AYF A;  3RU0 A;  3EP0 A;  3MO2 A;  5T5G A;  4BUP A;  3DAL A;  3TG4 A;  3VV0 A;  2IGQ A;  3BO5 A;  5F6L A;  2O8J A;  2W5Z A;  1O9S A;  3F9W A;  1ZKK A;  3OXF A;  2G46 A;  4YNM A;  3S7F A;  4YPA A;  3DB5 A;  3F9Z A;  3M5A A;  5TEG A;  3M59 A;  2BQZ A;  4J8O A;  1PEG A;  4FMU A;  5HQ8 A;  5ARF A;  5JHN A;  3S7D A;  2W5Y A;  3TG5 A;  1N6A A;  5F59 A;  5HI7 A;  4WUY A;  4NJ5 A;  3SW9 A;  4QEP A;  4YND A;  1N3J A;  4AU7 A;  4JDS A;  1MT6 A;  3OS5 A;  1MVH A;  4MI0 A;  4Z4P A;  5KJL A;  4C1Q A;  3S8P A;  3KMJ A;  1N6C A;  2QPW A;  3M55 A;  3SWC A;  4JLG A;  3RQ4 A;  3HNA A;  5LSZ A;  2JV0 A;  3F9Y A;  5T0M A;  5KJN A;  3M53 A;  5ARG A;  3F9X A;  5LSX A;  4LDG A;  4O6F A;  5JJ0 A;  3VUZ A;  3M56 A;  3MO0 A;  4IJD A;  5CCL A;  3K5K A;  3PDN A;  5EG2 A;  4MI5 A;  4QEO A;  5TH7 A;  5EX3 A;  2F69 A;  3KMA A;  3KMT A;  4H12 A;  4YPU A;  5CCM A;  3RIB A;  4YPE A;  3MO5 A;  4NVQ A;  3MEK A;  3FPD A;  3S7J A;  4IJ8 A;  1XQH A;  3QWP A;  5F5E A;  3OXL A;  4J7I A;  3M58 A;  3RJW A;  3QWW A;  3S7B A;  3M54 A;  4QEN A;  3CBP A;  5CPR B;  3M57 A;  3OXG A;  3CBO A;  3OOI A;  3QWV A;  5T0K A;  3CBM A;  3RAY A;  5KJK A;  5JIY A;  5JIN A;  4E47 A; 
#chains in the Genus database with same CATH homology
 3IHX A;  5KJM A;  1ML9 A;  1MVX A;  4O30 A;  2RFI A;  3N71 A;  4J7F A;  3OPE A;  1H3I A;  5TTF A;  5F6K C;  4J83 A;  4I51 A;  5EX0 A;  1MUF A;  4RZ0 A;  2R3A A;  4YNP A;  5AYF A;  3RU0 A;  3EP0 A;  3MO2 A;  5T5G A;  4BUP A;  3DAL A;  3TG4 A;  3VV0 A;  2IGQ A;  3BO5 A;  5F6L A;  2O8J A;  2W5Z A;  1O9S A;  3F9W A;  1ZKK A;  3OXF A;  2G46 A;  4YNM A;  3S7F A;  4YPA A;  3DB5 A;  3F9Z A;  3M5A A;  5TEG A;  3M59 A;  2BQZ A;  4J8O A;  1PEG A;  4FMU A;  5HQ8 A;  5ARF A;  5JHN A;  3S7D A;  2W5Y A;  3TG5 A;  1N6A A;  5F59 A;  5HI7 A;  4WUY A;  4NJ5 A;  3SW9 A;  4QEP A;  4YND A;  1N3J A;  4AU7 A;  4JDS A;  1MT6 A;  3OS5 A;  1MVH A;  4MI0 A;  4Z4P A;  5KJL A;  4C1Q A;  3S8P A;  3KMJ A;  1N6C A;  2QPW A;  3M55 A;  3SWC A;  4JLG A;  3RQ4 A;  3HNA A;  5LSZ A;  2JV0 A;  3F9Y A;  5T0M A;  5KJN A;  3M53 A;  5ARG A;  3F9X A;  5LSX A;  4LDG A;  4O6F A;  5JJ0 A;  3VUZ A;  3M56 A;  3MO0 A;  4IJD A;  5CCL A;  3K5K A;  3PDN A;  5EG2 A;  4MI5 A;  4QEO A;  5TH7 A;  5EX3 A;  2F69 A;  3KMA A;  3KMT A;  4H12 A;  4YPU A;  5CCM A;  3RIB A;  4YPE A;  3MO5 A;  4NVQ A;  3MEK A;  3FPD A;  3S7J A;  4IJ8 A;  1XQH A;  3QWP A;  5F5E A;  3OXL A;  4J7I A;  3M58 A;  3RJW A;  3QWW A;  3S7B A;  3M54 A;  4QEN A;  3CBP A;  5CPR B;  3M57 A;  3OXG A;  3CBO A;  3OOI A;  3QWV A;  5T0K A;  3CBM A;  3RAY A;  5KJK A;  5JIY A;  5JIN A;  4E47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...