5F59A

The crystal structure of mll3 set domain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
154
structure length
148
Chain Sequence
SKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSSRRIQKGEELCYDYKFDKIPCHCGAVNCRKWM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase 2C
publication title Structural basis for activity regulation of MLL family methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 38
structure length 148
sequence length 154
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5f59A00
5TH7A 1N6CA 3RIBA 3M57A 3MO5A 4J7FA 2W5YA 3FPDA 4MI5A 3OOIA 5JHNA 5KJLA 1O9SA 2IGQA 5JJ0A 4O6FA 4MI0A 2JV0A 3N71A 3F9XA 3SW9A 3CBPA 3TG5A 1MVHA 4WUYA 3OPEA 1H3IA 3MEKA 4LDGA 5F6KC 4JDSA 5EG2A 4Z4PA 3DALA 2W5ZA 3BO5A 3RAYA 4NVQA 5T0MA 3M59A 5AYFA 5HI7A 2R3AA 4C1QA 5EX3A 3M55A 4QEOA 4BUPA 4J8OA 4YPAA 3VUZA 3S7BA 3QWPA 3F9YA 5EX0A 3KMTA 3S7DA 3F9ZA 3S8PA 5TTFA 1XQHA 5KJMA 5KJNA 4YPUA 5CPRB 5TEGA 3QWWA 2RFIA 1N6AA 4AU7A 5HQ8A 3M54A 3OXGA 3TG4A 1MT6A 5F59A 4I51A 3RU0A 3KMJA 3M56A 1PEGA 5ARGA 3QWVA 1N3JA 3EP0A 4RZ0A 3RQ4A 4E47A 4NJ5A 5LSXA 4YNMA 3MO2A 5KJKA 5JINA 1MUFA 5ARFA 5LSZA 4YPEA 3MO0A 3M5AA 4JLGA 5F5EA 2BQZA 4J83A 3PDNA 5CCMA 2O8JA 3OS5A 3CBMA 4YNDA 3K5KA 5CCLA 5T5GA 3HNAA 3M53A 3M58A 1ML9A 3SWCA 5F6LA 3S7FA 3F9WA 4IJ8A 3OXFA 4FMUA 3RJWA 3S7JA 2F69A 2G46A 4H12A 4J7IA 5JIYA 3KMAA 4O30A 5T0KA 3CBOA 4QEPA 1ZKKA 4QENA 4IJDA 1MVXA 3OXLA 2QPWA 3IHXA 4YNPA 3VV0A 3DB5A
chains in the Genus database with same CATH superfamily
5TH7A 1N6CA 3RIBA 3M57A 3MO5A 4J7FA 2W5YA 3FPDA 4MI5A 3OOIA 5JHNA 5KJLA 1O9SA 2IGQA 5JJ0A 4O6FA 4MI0A 2JV0A 3N71A 3F9XA 3SW9A 3CBPA 3TG5A 1MVHA 4WUYA 3OPEA 1H3IA 3MEKA 4LDGA 5F6KC 4JDSA 5EG2A 4Z4PA 3DALA 2W5ZA 3BO5A 3RAYA 4NVQA 5T0MA 3M59A 5AYFA 5HI7A 2R3AA 4C1QA 5EX3A 3M55A 4QEOA 4BUPA 4J8OA 4YPAA 3VUZA 3S7BA 3QWPA 3F9YA 5EX0A 3KMTA 3S7DA 3F9ZA 3S8PA 5TTFA 1XQHA 5KJMA 5KJNA 4YPUA 5CPRB 5TEGA 3QWWA 2RFIA 1N6AA 4AU7A 5HQ8A 3M54A 3OXGA 3TG4A 1MT6A 5F59A 4I51A 3RU0A 3KMJA 3M56A 1PEGA 5ARGA 3QWVA 1N3JA 3EP0A 4RZ0A 3RQ4A 4E47A 4NJ5A 5LSXA 4YNMA 3MO2A 5KJKA 5JINA 1MUFA 5ARFA 5LSZA 4YPEA 3MO0A 3M5AA 4JLGA 5F5EA 2BQZA 4J83A 3PDNA 5CCMA 2O8JA 3OS5A 3CBMA 4YNDA 3K5KA 5CCLA 5T5GA 3HNAA 3M53A 3M58A 1ML9A 3SWCA 5F6LA 3S7FA 3F9WA 4IJ8A 3OXFA 4FMUA 3RJWA 3S7JA 2F69A 2G46A 4H12A 4J7IA 5JIYA 3KMAA 4O30A 5T0KA 3CBOA 4QEPA 1ZKKA 4QENA 4IJDA 1MVXA 3OXLA 2QPWA 3IHXA 4YNPA 3VV0A 3DB5A
chains in the Genus database with same CATH topology
5TH7A 1N6CA 3RIBA 3M57A 3MO5A 4J7FA 2W5YA 3FPDA 4MI5A 3OOIA 5JHNA 5KJLA 1O9SA 2IGQA 5JJ0A 4O6FA 4MI0A 2JV0A 3N71A 3F9XA 3SW9A 3CBPA 3TG5A 1MVHA 4WUYA 3OPEA 1H3IA 3MEKA 4LDGA 5F6KC 4JDSA 5EG2A 4Z4PA 3DALA 2W5ZA 3BO5A 3RAYA 4NVQA 5T0MA 3M59A 5AYFA 5HI7A 2R3AA 4C1QA 5EX3A 3M55A 4QEOA 4BUPA 4J8OA 4YPAA 3VUZA 3S7BA 3QWPA 3F9YA 5EX0A 3KMTA 3S7DA 3F9ZA 3S8PA 5TTFA 1XQHA 5KJMA 5KJNA 4YPUA 5CPRB 5TEGA 3QWWA 2RFIA 1N6AA 4AU7A 5HQ8A 3M54A 3OXGA 3TG4A 1MT6A 5F59A 4I51A 3RU0A 3KMJA 3M56A 1PEGA 5ARGA 3QWVA 1N3JA 3EP0A 4RZ0A 3RQ4A 4E47A 4NJ5A 5LSXA 4YNMA 3MO2A 5KJKA 5JINA 1MUFA 5ARFA 5LSZA 4YPEA 3MO0A 3M5AA 4JLGA 5F5EA 2BQZA 4J83A 3PDNA 5CCMA 2O8JA 3OS5A 3CBMA 4YNDA 3K5KA 5CCLA 5T5GA 3HNAA 3M53A 3M58A 1ML9A 3SWCA 5F6LA 3S7FA 3F9WA 4IJ8A 3OXFA 4FMUA 3RJWA 3S7JA 2F69A 2G46A 4H12A 4J7IA 5JIYA 3KMAA 4O30A 5T0KA 3CBOA 4QEPA 1ZKKA 4QENA 4IJDA 1MVXA 3OXLA 2QPWA 3IHXA 4YNPA 3VV0A 3DB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TH7 A;  1N6C A;  3RIB A;  3M57 A;  3MO5 A;  4J7F A;  2W5Y A;  3FPD A;  4MI5 A;  3OOI A;  5JHN A;  5KJL A;  1O9S A;  2IGQ A;  5JJ0 A;  4O6F A;  4MI0 A;  2JV0 A;  3N71 A;  3F9X A;  3SW9 A;  3CBP A;  3TG5 A;  1MVH A;  4WUY A;  3OPE A;  1H3I A;  3MEK A;  4LDG A;  5F6K C;  4JDS A;  5EG2 A;  4Z4P A;  3DAL A;  2W5Z A;  3BO5 A;  3RAY A;  4NVQ A;  5T0M A;  3M59 A;  5AYF A;  5HI7 A;  2R3A A;  4C1Q A;  5EX3 A;  3M55 A;  4QEO A;  4BUP A;  4J8O A;  4YPA A;  3VUZ A;  3S7B A;  3QWP A;  3F9Y A;  5EX0 A;  3KMT A;  3S7D A;  3F9Z A;  3S8P A;  5TTF A;  1XQH A;  5KJM A;  5KJN A;  4YPU A;  5CPR B;  5TEG A;  3QWW A;  2RFI A;  1N6A A;  4AU7 A;  5HQ8 A;  3M54 A;  3OXG A;  3TG4 A;  1MT6 A;  5F59 A;  4I51 A;  3RU0 A;  3KMJ A;  3M56 A;  1PEG A;  5ARG A;  3QWV A;  1N3J A;  3EP0 A;  4RZ0 A;  3RQ4 A;  4E47 A;  4NJ5 A;  5LSX A;  4YNM A;  3MO2 A;  5KJK A;  5JIN A;  1MUF A;  5ARF A;  5LSZ A;  4YPE A;  3MO0 A;  3M5A A;  4JLG A;  5F5E A;  2BQZ A;  4J83 A;  3PDN A;  5CCM A;  2O8J A;  3OS5 A;  3CBM A;  4YND A;  3K5K A;  5CCL A;  5T5G A;  3HNA A;  3M53 A;  3M58 A;  1ML9 A;  3SWC A;  5F6L A;  3S7F A;  3F9W A;  4IJ8 A;  3OXF A;  4FMU A;  3RJW A;  3S7J A;  2F69 A;  2G46 A;  4H12 A;  4J7I A;  5JIY A;  3KMA A;  4O30 A;  5T0K A;  3CBO A;  4QEP A;  1ZKK A;  4QEN A;  4IJD A;  1MVX A;  3OXL A;  2QPW A;  3IHX A;  4YNP A;  3VV0 A;  3DB5 A; 
#chains in the Genus database with same CATH topology
 5TH7 A;  1N6C A;  3RIB A;  3M57 A;  3MO5 A;  4J7F A;  2W5Y A;  3FPD A;  4MI5 A;  3OOI A;  5JHN A;  5KJL A;  1O9S A;  2IGQ A;  5JJ0 A;  4O6F A;  4MI0 A;  2JV0 A;  3N71 A;  3F9X A;  3SW9 A;  3CBP A;  3TG5 A;  1MVH A;  4WUY A;  3OPE A;  1H3I A;  3MEK A;  4LDG A;  5F6K C;  4JDS A;  5EG2 A;  4Z4P A;  3DAL A;  2W5Z A;  3BO5 A;  3RAY A;  4NVQ A;  5T0M A;  3M59 A;  5AYF A;  5HI7 A;  2R3A A;  4C1Q A;  5EX3 A;  3M55 A;  4QEO A;  4BUP A;  4J8O A;  4YPA A;  3VUZ A;  3S7B A;  3QWP A;  3F9Y A;  5EX0 A;  3KMT A;  3S7D A;  3F9Z A;  3S8P A;  5TTF A;  1XQH A;  5KJM A;  5KJN A;  4YPU A;  5CPR B;  5TEG A;  3QWW A;  2RFI A;  1N6A A;  4AU7 A;  5HQ8 A;  3M54 A;  3OXG A;  3TG4 A;  1MT6 A;  5F59 A;  4I51 A;  3RU0 A;  3KMJ A;  3M56 A;  1PEG A;  5ARG A;  3QWV A;  1N3J A;  3EP0 A;  4RZ0 A;  3RQ4 A;  4E47 A;  4NJ5 A;  5LSX A;  4YNM A;  3MO2 A;  5KJK A;  5JIN A;  1MUF A;  5ARF A;  5LSZ A;  4YPE A;  3MO0 A;  3M5A A;  4JLG A;  5F5E A;  2BQZ A;  4J83 A;  3PDN A;  5CCM A;  2O8J A;  3OS5 A;  3CBM A;  4YND A;  3K5K A;  5CCL A;  5T5G A;  3HNA A;  3M53 A;  3M58 A;  1ML9 A;  3SWC A;  5F6L A;  3S7F A;  3F9W A;  4IJ8 A;  3OXF A;  4FMU A;  3RJW A;  3S7J A;  2F69 A;  2G46 A;  4H12 A;  4J7I A;  5JIY A;  3KMA A;  4O30 A;  5T0K A;  3CBO A;  4QEP A;  1ZKK A;  4QEN A;  4IJD A;  1MVX A;  3OXL A;  2QPW A;  3IHX A;  4YNP A;  3VV0 A;  3DB5 A; 
#chains in the Genus database with same CATH homology
 5TH7 A;  1N6C A;  3RIB A;  3M57 A;  3MO5 A;  4J7F A;  2W5Y A;  3FPD A;  4MI5 A;  3OOI A;  5JHN A;  5KJL A;  1O9S A;  2IGQ A;  5JJ0 A;  4O6F A;  4MI0 A;  2JV0 A;  3N71 A;  3F9X A;  3SW9 A;  3CBP A;  3TG5 A;  1MVH A;  4WUY A;  3OPE A;  1H3I A;  3MEK A;  4LDG A;  5F6K C;  4JDS A;  5EG2 A;  4Z4P A;  3DAL A;  2W5Z A;  3BO5 A;  3RAY A;  4NVQ A;  5T0M A;  3M59 A;  5AYF A;  5HI7 A;  2R3A A;  4C1Q A;  5EX3 A;  3M55 A;  4QEO A;  4BUP A;  4J8O A;  4YPA A;  3VUZ A;  3S7B A;  3QWP A;  3F9Y A;  5EX0 A;  3KMT A;  3S7D A;  3F9Z A;  3S8P A;  5TTF A;  1XQH A;  5KJM A;  5KJN A;  4YPU A;  5CPR B;  5TEG A;  3QWW A;  2RFI A;  1N6A A;  4AU7 A;  5HQ8 A;  3M54 A;  3OXG A;  3TG4 A;  1MT6 A;  5F59 A;  4I51 A;  3RU0 A;  3KMJ A;  3M56 A;  1PEG A;  5ARG A;  3QWV A;  1N3J A;  3EP0 A;  4RZ0 A;  3RQ4 A;  4E47 A;  4NJ5 A;  5LSX A;  4YNM A;  3MO2 A;  5KJK A;  5JIN A;  1MUF A;  5ARF A;  5LSZ A;  4YPE A;  3MO0 A;  3M5A A;  4JLG A;  5F5E A;  2BQZ A;  4J83 A;  3PDN A;  5CCM A;  2O8J A;  3OS5 A;  3CBM A;  4YND A;  3K5K A;  5CCL A;  5T5G A;  3HNA A;  3M53 A;  3M58 A;  1ML9 A;  3SWC A;  5F6L A;  3S7F A;  3F9W A;  4IJ8 A;  3OXF A;  4FMU A;  3RJW A;  3S7J A;  2F69 A;  2G46 A;  4H12 A;  4J7I A;  5JIY A;  3KMA A;  4O30 A;  5T0K A;  3CBO A;  4QEP A;  1ZKK A;  4QEN A;  4IJD A;  1MVX A;  3OXL A;  2QPW A;  3IHX A;  4YNP A;  3VV0 A;  3DB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...