5F59A

The crystal structure of mll3 set domain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
154
structure length
148
Chain Sequence
SKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSSRRIQKGEELCYDYKFDKIPCHCGAVNCRKWM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase 2C
publication title Structural basis for activity regulation of MLL family methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 148
sequence length 154
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5f59A00
3M57A 5ARFA 2W5YA 5ARGA 3M59A 2QPWA 3S7JA 3MO5A 1N6CA 4H12A 3SWCA 2O8JA 3TG5A 3S7FA 4YNMA 3OXFA 3M53A 4J8OA 5LSZA 4JLGA 3OXGA 5TEGA 3MO0A 3QWPA 4YNPA 3VV0A 4YPEA 4JDSA 4NJ5A 3RU0A 2JV0A 3RJWA 5KJMA 3SW9A 3M56A 3VUZA 5KJKA 5CPRB 4C1QA 4YNDA 3OXLA 4J7IA 3DALA 3OPEA 4RZ0A 5KJLA 4QEOA 1MVHA 3OOIA 4QEPA 2IGQA 1N3JA 3FPDA 3IHXA 3MEKA 3S7BA 1PEGA 2R3AA 5T0KA 4J7FA 1ML9A 4WUYA 3BO5A 5TH7A 3F9WA 3M55A 4IJDA 4IJ8A 1N6AA 5JHNA 4YPUA 2BQZA 3M54A 1H3IA 3F9ZA 4O30A 3DB5A 3TG4A 5JJ0A 5KJNA 1MT6A 4BUPA 4MI0A 3S7DA 5HQ8A 4NVQA 3KMJA 4O6FA 4FMUA 2RFIA 3EP0A 3N71A 5EX0A 4AU7A 1MUFA 4E47A 5EG2A 3F9YA 4YPAA 3CBOA 5HI7A 2G46A 5CCLA 5JINA 3KMTA 5T5GA 3QWWA 3S8PA 5JIYA 4I51A 1MVXA 5AYFA 5LSXA 2W5ZA 3PDNA 5T0MA 3RAYA 3RIBA 4QENA 3CBPA 5F5EA 3F9XA 3OS5A 5CCMA 1ZKKA 5F59A 4J83A 5EX3A 5TTFA 5F6KC 3QWVA 4MI5A 3KMAA 1O9SA 5F6LA 2F69A 1XQHA 3M5AA 3HNAA 3CBMA 3M58A 3MO2A 4Z4PA 3K5KA 3RQ4A 4LDGA
chains in the Genus database with same CATH superfamily
3M57A 5ARFA 2W5YA 5ARGA 3M59A 2QPWA 3S7JA 3MO5A 1N6CA 4H12A 3SWCA 2O8JA 3TG5A 3S7FA 4YNMA 3OXFA 3M53A 4J8OA 5LSZA 4JLGA 3OXGA 5TEGA 3MO0A 3QWPA 4YNPA 3VV0A 4YPEA 4JDSA 4NJ5A 3RU0A 2JV0A 3RJWA 5KJMA 3SW9A 3M56A 3VUZA 5KJKA 5CPRB 4C1QA 4YNDA 3OXLA 4J7IA 3DALA 3OPEA 4RZ0A 5KJLA 4QEOA 1MVHA 3OOIA 4QEPA 2IGQA 1N3JA 3FPDA 3IHXA 3MEKA 3S7BA 1PEGA 2R3AA 5T0KA 4J7FA 1ML9A 4WUYA 3BO5A 5TH7A 3F9WA 3M55A 4IJDA 4IJ8A 1N6AA 5JHNA 4YPUA 2BQZA 3M54A 1H3IA 3F9ZA 4O30A 3DB5A 3TG4A 5JJ0A 5KJNA 1MT6A 4BUPA 4MI0A 3S7DA 5HQ8A 4NVQA 3KMJA 4O6FA 4FMUA 2RFIA 3EP0A 3N71A 5EX0A 4AU7A 1MUFA 4E47A 5EG2A 3F9YA 4YPAA 3CBOA 5HI7A 2G46A 5CCLA 5JINA 3KMTA 5T5GA 3QWWA 3S8PA 5JIYA 4I51A 1MVXA 5AYFA 5LSXA 2W5ZA 3PDNA 5T0MA 3RAYA 3RIBA 4QENA 3CBPA 5F5EA 3F9XA 3OS5A 5CCMA 1ZKKA 5F59A 4J83A 5EX3A 5TTFA 5F6KC 3QWVA 4MI5A 3KMAA 1O9SA 5F6LA 2F69A 1XQHA 3M5AA 3HNAA 3CBMA 3M58A 3MO2A 4Z4PA 3K5KA 3RQ4A 4LDGA
chains in the Genus database with same CATH topology
3M57A 5ARFA 2W5YA 5ARGA 3M59A 2QPWA 3S7JA 3MO5A 1N6CA 4H12A 3SWCA 2O8JA 3TG5A 3S7FA 4YNMA 3OXFA 3M53A 4J8OA 5LSZA 4JLGA 3OXGA 5TEGA 3MO0A 3QWPA 4YNPA 3VV0A 4YPEA 4JDSA 4NJ5A 3RU0A 2JV0A 3RJWA 5KJMA 3SW9A 3M56A 3VUZA 5KJKA 5CPRB 4C1QA 4YNDA 3OXLA 4J7IA 3DALA 3OPEA 4RZ0A 5KJLA 4QEOA 1MVHA 3OOIA 4QEPA 2IGQA 1N3JA 3FPDA 3IHXA 3MEKA 3S7BA 1PEGA 2R3AA 5T0KA 4J7FA 1ML9A 4WUYA 3BO5A 5TH7A 3F9WA 3M55A 4IJDA 4IJ8A 1N6AA 5JHNA 4YPUA 2BQZA 3M54A 1H3IA 3F9ZA 4O30A 3DB5A 3TG4A 5JJ0A 5KJNA 1MT6A 4BUPA 4MI0A 3S7DA 5HQ8A 4NVQA 3KMJA 4O6FA 4FMUA 2RFIA 3EP0A 3N71A 5EX0A 4AU7A 1MUFA 4E47A 5EG2A 3F9YA 4YPAA 3CBOA 5HI7A 2G46A 5CCLA 5JINA 3KMTA 5T5GA 3QWWA 3S8PA 5JIYA 4I51A 1MVXA 5AYFA 5LSXA 2W5ZA 3PDNA 5T0MA 3RAYA 3RIBA 4QENA 3CBPA 5F5EA 3F9XA 3OS5A 5CCMA 1ZKKA 5F59A 4J83A 5EX3A 5TTFA 5F6KC 3QWVA 4MI5A 3KMAA 1O9SA 5F6LA 2F69A 1XQHA 3M5AA 3HNAA 3CBMA 3M58A 3MO2A 4Z4PA 3K5KA 3RQ4A 4LDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M57 A;  5ARF A;  2W5Y A;  5ARG A;  3M59 A;  2QPW A;  3S7J A;  3MO5 A;  1N6C A;  4H12 A;  3SWC A;  2O8J A;  3TG5 A;  3S7F A;  4YNM A;  3OXF A;  3M53 A;  4J8O A;  5LSZ A;  4JLG A;  3OXG A;  5TEG A;  3MO0 A;  3QWP A;  4YNP A;  3VV0 A;  4YPE A;  4JDS A;  4NJ5 A;  3RU0 A;  2JV0 A;  3RJW A;  5KJM A;  3SW9 A;  3M56 A;  3VUZ A;  5KJK A;  5CPR B;  4C1Q A;  4YND A;  3OXL A;  4J7I A;  3DAL A;  3OPE A;  4RZ0 A;  5KJL A;  4QEO A;  1MVH A;  3OOI A;  4QEP A;  2IGQ A;  1N3J A;  3FPD A;  3IHX A;  3MEK A;  3S7B A;  1PEG A;  2R3A A;  5T0K A;  4J7F A;  1ML9 A;  4WUY A;  3BO5 A;  5TH7 A;  3F9W A;  3M55 A;  4IJD A;  4IJ8 A;  1N6A A;  5JHN A;  4YPU A;  2BQZ A;  3M54 A;  1H3I A;  3F9Z A;  4O30 A;  3DB5 A;  3TG4 A;  5JJ0 A;  5KJN A;  1MT6 A;  4BUP A;  4MI0 A;  3S7D A;  5HQ8 A;  4NVQ A;  3KMJ A;  4O6F A;  4FMU A;  2RFI A;  3EP0 A;  3N71 A;  5EX0 A;  4AU7 A;  1MUF A;  4E47 A;  5EG2 A;  3F9Y A;  4YPA A;  3CBO A;  5HI7 A;  2G46 A;  5CCL A;  5JIN A;  3KMT A;  5T5G A;  3QWW A;  3S8P A;  5JIY A;  4I51 A;  1MVX A;  5AYF A;  5LSX A;  2W5Z A;  3PDN A;  5T0M A;  3RAY A;  3RIB A;  4QEN A;  3CBP A;  5F5E A;  3F9X A;  3OS5 A;  5CCM A;  1ZKK A;  5F59 A;  4J83 A;  5EX3 A;  5TTF A;  5F6K C;  3QWV A;  4MI5 A;  3KMA A;  1O9S A;  5F6L A;  2F69 A;  1XQH A;  3M5A A;  3HNA A;  3CBM A;  3M58 A;  3MO2 A;  4Z4P A;  3K5K A;  3RQ4 A;  4LDG A; 
#chains in the Genus database with same CATH topology
 3M57 A;  5ARF A;  2W5Y A;  5ARG A;  3M59 A;  2QPW A;  3S7J A;  3MO5 A;  1N6C A;  4H12 A;  3SWC A;  2O8J A;  3TG5 A;  3S7F A;  4YNM A;  3OXF A;  3M53 A;  4J8O A;  5LSZ A;  4JLG A;  3OXG A;  5TEG A;  3MO0 A;  3QWP A;  4YNP A;  3VV0 A;  4YPE A;  4JDS A;  4NJ5 A;  3RU0 A;  2JV0 A;  3RJW A;  5KJM A;  3SW9 A;  3M56 A;  3VUZ A;  5KJK A;  5CPR B;  4C1Q A;  4YND A;  3OXL A;  4J7I A;  3DAL A;  3OPE A;  4RZ0 A;  5KJL A;  4QEO A;  1MVH A;  3OOI A;  4QEP A;  2IGQ A;  1N3J A;  3FPD A;  3IHX A;  3MEK A;  3S7B A;  1PEG A;  2R3A A;  5T0K A;  4J7F A;  1ML9 A;  4WUY A;  3BO5 A;  5TH7 A;  3F9W A;  3M55 A;  4IJD A;  4IJ8 A;  1N6A A;  5JHN A;  4YPU A;  2BQZ A;  3M54 A;  1H3I A;  3F9Z A;  4O30 A;  3DB5 A;  3TG4 A;  5JJ0 A;  5KJN A;  1MT6 A;  4BUP A;  4MI0 A;  3S7D A;  5HQ8 A;  4NVQ A;  3KMJ A;  4O6F A;  4FMU A;  2RFI A;  3EP0 A;  3N71 A;  5EX0 A;  4AU7 A;  1MUF A;  4E47 A;  5EG2 A;  3F9Y A;  4YPA A;  3CBO A;  5HI7 A;  2G46 A;  5CCL A;  5JIN A;  3KMT A;  5T5G A;  3QWW A;  3S8P A;  5JIY A;  4I51 A;  1MVX A;  5AYF A;  5LSX A;  2W5Z A;  3PDN A;  5T0M A;  3RAY A;  3RIB A;  4QEN A;  3CBP A;  5F5E A;  3F9X A;  3OS5 A;  5CCM A;  1ZKK A;  5F59 A;  4J83 A;  5EX3 A;  5TTF A;  5F6K C;  3QWV A;  4MI5 A;  3KMA A;  1O9S A;  5F6L A;  2F69 A;  1XQH A;  3M5A A;  3HNA A;  3CBM A;  3M58 A;  3MO2 A;  4Z4P A;  3K5K A;  3RQ4 A;  4LDG A; 
#chains in the Genus database with same CATH homology
 3M57 A;  5ARF A;  2W5Y A;  5ARG A;  3M59 A;  2QPW A;  3S7J A;  3MO5 A;  1N6C A;  4H12 A;  3SWC A;  2O8J A;  3TG5 A;  3S7F A;  4YNM A;  3OXF A;  3M53 A;  4J8O A;  5LSZ A;  4JLG A;  3OXG A;  5TEG A;  3MO0 A;  3QWP A;  4YNP A;  3VV0 A;  4YPE A;  4JDS A;  4NJ5 A;  3RU0 A;  2JV0 A;  3RJW A;  5KJM A;  3SW9 A;  3M56 A;  3VUZ A;  5KJK A;  5CPR B;  4C1Q A;  4YND A;  3OXL A;  4J7I A;  3DAL A;  3OPE A;  4RZ0 A;  5KJL A;  4QEO A;  1MVH A;  3OOI A;  4QEP A;  2IGQ A;  1N3J A;  3FPD A;  3IHX A;  3MEK A;  3S7B A;  1PEG A;  2R3A A;  5T0K A;  4J7F A;  1ML9 A;  4WUY A;  3BO5 A;  5TH7 A;  3F9W A;  3M55 A;  4IJD A;  4IJ8 A;  1N6A A;  5JHN A;  4YPU A;  2BQZ A;  3M54 A;  1H3I A;  3F9Z A;  4O30 A;  3DB5 A;  3TG4 A;  5JJ0 A;  5KJN A;  1MT6 A;  4BUP A;  4MI0 A;  3S7D A;  5HQ8 A;  4NVQ A;  3KMJ A;  4O6F A;  4FMU A;  2RFI A;  3EP0 A;  3N71 A;  5EX0 A;  4AU7 A;  1MUF A;  4E47 A;  5EG2 A;  3F9Y A;  4YPA A;  3CBO A;  5HI7 A;  2G46 A;  5CCL A;  5JIN A;  3KMT A;  5T5G A;  3QWW A;  3S8P A;  5JIY A;  4I51 A;  1MVX A;  5AYF A;  5LSX A;  2W5Z A;  3PDN A;  5T0M A;  3RAY A;  3RIB A;  4QEN A;  3CBP A;  5F5E A;  3F9X A;  3OS5 A;  5CCM A;  1ZKK A;  5F59 A;  4J83 A;  5EX3 A;  5TTF A;  5F6K C;  3QWV A;  4MI5 A;  3KMA A;  1O9S A;  5F6L A;  2F69 A;  1XQH A;  3M5A A;  3HNA A;  3CBM A;  3M58 A;  3MO2 A;  4Z4P A;  3K5K A;  3RQ4 A;  4LDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...