5F59A

The crystal structure of mll3 set domain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
154
structure length
148
Chain Sequence
SKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSSRRIQKGEELCYDYKFDKIPCHCGAVNCRKWM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for activity regulation of MLL family methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase 2C
total genus 38
structure length 148
sequence length 154
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5f59A00
5F5EA 2RFIA 3RAYA 4NVQA 5JHNA 3M57A 4YPUA 3M59A 3M53A 3EP0A 5CPRB 4YNPA 3M54A 5F6LA 3F9WA 3IHXA 3MO0A 2W5ZA 4Z4PA 1N6CA 5TEGA 5EX3A 4AU7A 3M5AA 1ZKKA 3S8PA 4BUPA 2G46A 2BQZA 4QENA 3M58A 4WUYA 2O8JA 4FMUA 3MO2A 4O6FA 5KJMA 3KMAA 5T0KA 3K5KA 5ARFA 3OS5A 5LSZA 2W5YA 3SWCA 4IJ8A 4J7FA 3KMTA 3RIBA 4NJ5A 5HQ8A 4J8OA 1N6AA 4C1QA 5JINA 5TTFA 3DALA 5T0MA 3DB5A 3RQ4A 3RJWA 5CCMA 3F9XA 4QEPA 4JDSA 3BO5A 2JV0A 5HI7A 2QPWA 4RZ0A 2F69A 3RU0A 5TH7A 3HNAA 3S7BA 5KJKA 5KJLA 5F59A 1ML9A 4E47A 3KMJA 3OXLA 3S7FA 5ARGA 3F9YA 2R3AA 1N3JA 3CBPA 4JLGA 4YNMA 5CCLA 3OOIA 5T5GA 3M55A 1MUFA 3CBOA 3MO5A 1MVXA 3TG4A 4J83A 5F6KC 4O30A 3M56A 4LDGA 4H12A 4J7IA 3SW9A 3OXFA 3F9ZA 4QEOA 5JIYA 4MI0A 3MEKA 1XQHA 3TG5A 1H3IA 4MI5A 4YPAA 1PEGA 3S7JA 5JJ0A 2IGQA 5EG2A 3VUZA 4I51A 4IJDA 3OPEA 3VV0A 3QWWA 1MVHA 5EX0A 5LSXA 5KJNA 1O9SA 3PDNA 3FPDA 3QWPA 3QWVA 5AYFA 3S7DA 4YNDA 3CBMA 3N71A 3OXGA 1MT6A 4YPEA
chains in the Genus database with same CATH superfamily
5F5EA 2RFIA 3RAYA 4NVQA 5JHNA 3M57A 4YPUA 3M59A 3M53A 3EP0A 5CPRB 4YNPA 3M54A 5F6LA 3F9WA 3IHXA 3MO0A 2W5ZA 4Z4PA 1N6CA 5TEGA 5EX3A 4AU7A 3M5AA 1ZKKA 3S8PA 4BUPA 2G46A 2BQZA 4QENA 3M58A 4WUYA 2O8JA 4FMUA 3MO2A 4O6FA 5KJMA 3KMAA 5T0KA 3K5KA 5ARFA 3OS5A 5LSZA 2W5YA 3SWCA 4IJ8A 4J7FA 3KMTA 3RIBA 4NJ5A 5HQ8A 4J8OA 1N6AA 4C1QA 5JINA 5TTFA 3DALA 5T0MA 3DB5A 3RQ4A 3RJWA 5CCMA 3F9XA 4QEPA 4JDSA 3BO5A 2JV0A 5HI7A 2QPWA 4RZ0A 2F69A 3RU0A 5TH7A 3HNAA 3S7BA 5KJKA 5KJLA 5F59A 1ML9A 4E47A 3KMJA 3OXLA 3S7FA 5ARGA 3F9YA 2R3AA 1N3JA 3CBPA 4JLGA 4YNMA 5CCLA 3OOIA 5T5GA 3M55A 1MUFA 3CBOA 3MO5A 1MVXA 3TG4A 4J83A 5F6KC 4O30A 3M56A 4LDGA 4H12A 4J7IA 3SW9A 3OXFA 3F9ZA 4QEOA 5JIYA 4MI0A 3MEKA 1XQHA 3TG5A 1H3IA 4MI5A 4YPAA 1PEGA 3S7JA 5JJ0A 2IGQA 5EG2A 3VUZA 4I51A 4IJDA 3OPEA 3VV0A 3QWWA 1MVHA 5EX0A 5LSXA 5KJNA 1O9SA 3PDNA 3FPDA 3QWPA 3QWVA 5AYFA 3S7DA 4YNDA 3CBMA 3N71A 3OXGA 1MT6A 4YPEA
chains in the Genus database with same CATH topology
5F5EA 2RFIA 3RAYA 4NVQA 5JHNA 3M57A 4YPUA 3M59A 3M53A 3EP0A 5CPRB 4YNPA 3M54A 5F6LA 3F9WA 3IHXA 3MO0A 2W5ZA 4Z4PA 1N6CA 5TEGA 5EX3A 4AU7A 3M5AA 1ZKKA 3S8PA 4BUPA 2G46A 2BQZA 4QENA 3M58A 4WUYA 2O8JA 4FMUA 3MO2A 4O6FA 5KJMA 3KMAA 5T0KA 3K5KA 5ARFA 3OS5A 5LSZA 2W5YA 3SWCA 4IJ8A 4J7FA 3KMTA 3RIBA 4NJ5A 5HQ8A 4J8OA 1N6AA 4C1QA 5JINA 5TTFA 3DALA 5T0MA 3DB5A 3RQ4A 3RJWA 5CCMA 3F9XA 4QEPA 4JDSA 3BO5A 2JV0A 5HI7A 2QPWA 4RZ0A 2F69A 3RU0A 5TH7A 3HNAA 3S7BA 5KJKA 5KJLA 5F59A 1ML9A 4E47A 3KMJA 3OXLA 3S7FA 5ARGA 3F9YA 2R3AA 1N3JA 3CBPA 4JLGA 4YNMA 5CCLA 3OOIA 5T5GA 3M55A 1MUFA 3CBOA 3MO5A 1MVXA 3TG4A 4J83A 5F6KC 4O30A 3M56A 4LDGA 4H12A 4J7IA 3SW9A 3OXFA 3F9ZA 4QEOA 5JIYA 4MI0A 3MEKA 1XQHA 3TG5A 1H3IA 4MI5A 4YPAA 1PEGA 3S7JA 5JJ0A 2IGQA 5EG2A 3VUZA 4I51A 4IJDA 3OPEA 3VV0A 3QWWA 1MVHA 5EX0A 5LSXA 5KJNA 1O9SA 3PDNA 3FPDA 3QWPA 3QWVA 5AYFA 3S7DA 4YNDA 3CBMA 3N71A 3OXGA 1MT6A 4YPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F5E A;  2RFI A;  3RAY A;  4NVQ A;  5JHN A;  3M57 A;  4YPU A;  3M59 A;  3M53 A;  3EP0 A;  5CPR B;  4YNP A;  3M54 A;  5F6L A;  3F9W A;  3IHX A;  3MO0 A;  2W5Z A;  4Z4P A;  1N6C A;  5TEG A;  5EX3 A;  4AU7 A;  3M5A A;  1ZKK A;  3S8P A;  4BUP A;  2G46 A;  2BQZ A;  4QEN A;  3M58 A;  4WUY A;  2O8J A;  4FMU A;  3MO2 A;  4O6F A;  5KJM A;  3KMA A;  5T0K A;  3K5K A;  5ARF A;  3OS5 A;  5LSZ A;  2W5Y A;  3SWC A;  4IJ8 A;  4J7F A;  3KMT A;  3RIB A;  4NJ5 A;  5HQ8 A;  4J8O A;  1N6A A;  4C1Q A;  5JIN A;  5TTF A;  3DAL A;  5T0M A;  3DB5 A;  3RQ4 A;  3RJW A;  5CCM A;  3F9X A;  4QEP A;  4JDS A;  3BO5 A;  2JV0 A;  5HI7 A;  2QPW A;  4RZ0 A;  2F69 A;  3RU0 A;  5TH7 A;  3HNA A;  3S7B A;  5KJK A;  5KJL A;  5F59 A;  1ML9 A;  4E47 A;  3KMJ A;  3OXL A;  3S7F A;  5ARG A;  3F9Y A;  2R3A A;  1N3J A;  3CBP A;  4JLG A;  4YNM A;  5CCL A;  3OOI A;  5T5G A;  3M55 A;  1MUF A;  3CBO A;  3MO5 A;  1MVX A;  3TG4 A;  4J83 A;  5F6K C;  4O30 A;  3M56 A;  4LDG A;  4H12 A;  4J7I A;  3SW9 A;  3OXF A;  3F9Z A;  4QEO A;  5JIY A;  4MI0 A;  3MEK A;  1XQH A;  3TG5 A;  1H3I A;  4MI5 A;  4YPA A;  1PEG A;  3S7J A;  5JJ0 A;  2IGQ A;  5EG2 A;  3VUZ A;  4I51 A;  4IJD A;  3OPE A;  3VV0 A;  3QWW A;  1MVH A;  5EX0 A;  5LSX A;  5KJN A;  1O9S A;  3PDN A;  3FPD A;  3QWP A;  3QWV A;  5AYF A;  3S7D A;  4YND A;  3CBM A;  3N71 A;  3OXG A;  1MT6 A;  4YPE A; 
#chains in the Genus database with same CATH topology
 5F5E A;  2RFI A;  3RAY A;  4NVQ A;  5JHN A;  3M57 A;  4YPU A;  3M59 A;  3M53 A;  3EP0 A;  5CPR B;  4YNP A;  3M54 A;  5F6L A;  3F9W A;  3IHX A;  3MO0 A;  2W5Z A;  4Z4P A;  1N6C A;  5TEG A;  5EX3 A;  4AU7 A;  3M5A A;  1ZKK A;  3S8P A;  4BUP A;  2G46 A;  2BQZ A;  4QEN A;  3M58 A;  4WUY A;  2O8J A;  4FMU A;  3MO2 A;  4O6F A;  5KJM A;  3KMA A;  5T0K A;  3K5K A;  5ARF A;  3OS5 A;  5LSZ A;  2W5Y A;  3SWC A;  4IJ8 A;  4J7F A;  3KMT A;  3RIB A;  4NJ5 A;  5HQ8 A;  4J8O A;  1N6A A;  4C1Q A;  5JIN A;  5TTF A;  3DAL A;  5T0M A;  3DB5 A;  3RQ4 A;  3RJW A;  5CCM A;  3F9X A;  4QEP A;  4JDS A;  3BO5 A;  2JV0 A;  5HI7 A;  2QPW A;  4RZ0 A;  2F69 A;  3RU0 A;  5TH7 A;  3HNA A;  3S7B A;  5KJK A;  5KJL A;  5F59 A;  1ML9 A;  4E47 A;  3KMJ A;  3OXL A;  3S7F A;  5ARG A;  3F9Y A;  2R3A A;  1N3J A;  3CBP A;  4JLG A;  4YNM A;  5CCL A;  3OOI A;  5T5G A;  3M55 A;  1MUF A;  3CBO A;  3MO5 A;  1MVX A;  3TG4 A;  4J83 A;  5F6K C;  4O30 A;  3M56 A;  4LDG A;  4H12 A;  4J7I A;  3SW9 A;  3OXF A;  3F9Z A;  4QEO A;  5JIY A;  4MI0 A;  3MEK A;  1XQH A;  3TG5 A;  1H3I A;  4MI5 A;  4YPA A;  1PEG A;  3S7J A;  5JJ0 A;  2IGQ A;  5EG2 A;  3VUZ A;  4I51 A;  4IJD A;  3OPE A;  3VV0 A;  3QWW A;  1MVH A;  5EX0 A;  5LSX A;  5KJN A;  1O9S A;  3PDN A;  3FPD A;  3QWP A;  3QWV A;  5AYF A;  3S7D A;  4YND A;  3CBM A;  3N71 A;  3OXG A;  1MT6 A;  4YPE A; 
#chains in the Genus database with same CATH homology
 5F5E A;  2RFI A;  3RAY A;  4NVQ A;  5JHN A;  3M57 A;  4YPU A;  3M59 A;  3M53 A;  3EP0 A;  5CPR B;  4YNP A;  3M54 A;  5F6L A;  3F9W A;  3IHX A;  3MO0 A;  2W5Z A;  4Z4P A;  1N6C A;  5TEG A;  5EX3 A;  4AU7 A;  3M5A A;  1ZKK A;  3S8P A;  4BUP A;  2G46 A;  2BQZ A;  4QEN A;  3M58 A;  4WUY A;  2O8J A;  4FMU A;  3MO2 A;  4O6F A;  5KJM A;  3KMA A;  5T0K A;  3K5K A;  5ARF A;  3OS5 A;  5LSZ A;  2W5Y A;  3SWC A;  4IJ8 A;  4J7F A;  3KMT A;  3RIB A;  4NJ5 A;  5HQ8 A;  4J8O A;  1N6A A;  4C1Q A;  5JIN A;  5TTF A;  3DAL A;  5T0M A;  3DB5 A;  3RQ4 A;  3RJW A;  5CCM A;  3F9X A;  4QEP A;  4JDS A;  3BO5 A;  2JV0 A;  5HI7 A;  2QPW A;  4RZ0 A;  2F69 A;  3RU0 A;  5TH7 A;  3HNA A;  3S7B A;  5KJK A;  5KJL A;  5F59 A;  1ML9 A;  4E47 A;  3KMJ A;  3OXL A;  3S7F A;  5ARG A;  3F9Y A;  2R3A A;  1N3J A;  3CBP A;  4JLG A;  4YNM A;  5CCL A;  3OOI A;  5T5G A;  3M55 A;  1MUF A;  3CBO A;  3MO5 A;  1MVX A;  3TG4 A;  4J83 A;  5F6K C;  4O30 A;  3M56 A;  4LDG A;  4H12 A;  4J7I A;  3SW9 A;  3OXF A;  3F9Z A;  4QEO A;  5JIY A;  4MI0 A;  3MEK A;  1XQH A;  3TG5 A;  1H3I A;  4MI5 A;  4YPA A;  1PEG A;  3S7J A;  5JJ0 A;  2IGQ A;  5EG2 A;  3VUZ A;  4I51 A;  4IJD A;  3OPE A;  3VV0 A;  3QWW A;  1MVH A;  5EX0 A;  5LSX A;  5KJN A;  1O9S A;  3PDN A;  3FPD A;  3QWP A;  3QWV A;  5AYF A;  3S7D A;  4YND A;  3CBM A;  3N71 A;  3OXG A;  1MT6 A;  4YPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...