3F9ZA

Structural insights into lysine multiple methylation by set domain methyltransferases, set8-y245f / h4-lys20 / adohcy
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
160
structure length
156
Chain Sequence
b'KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEFHGDLIEITDAKKREALYATGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase SETD8
publication title Structural origins for the product specificity of SET domain protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 45
structure length 156
sequence length 160
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3f9zA00
4QEPA 2JV0A 5T5GA 1MVXA 3K5KA 4IJDA 3RIBA 3S8PA 4QENA 3KMJA 4Z4PA 5EX0A 5AYFA 4QEOA 3SW9A 2BQZA 3OXFA 4E47A 5CCMA 3QWVA 2QPWA 5TEGA 4YNDA 5TH7A 3DALA 3M53A 4RZ0A 5ARGA 5TTFA 1MT6A 3RU0A 2G46A 3S7FA 3CBPA 3KMAA 3IHXA 5F6KC 2R3AA 2W5YA 4LDGA 4MI5A 3CBOA 3TG5A 4WUYA 5LSXA 5EX3A 4J83A 5EG2A 4NJ5A 1XQHA 5JINA 4H12A 4YPEA 3VV0A 3VUZA 1H3IA 3OS5A 5JIYA 3MO5A 2IGQA 5F6LA 2O8JA 4J7FA 5KJKA 2F69A 4AU7A 2RFIA 3M55A 1N3JA 3F9YA 3KMTA 3N71A 3M54A 1MVHA 3F9WA 5HQ8A 3F9XA 4BUPA 5KJMA 3MEKA 5F59A 3QWWA 1PEGA 5KJNA 4FMUA 5JJ0A 3HNAA 3M59A 3M58A 1O9SA 4C1QA 1MUFA 3EP0A 3M57A 4YPUA 3RAYA 3OXGA 5JHNA 3FPDA 2W5ZA 3QWPA 3S7BA 4O6FA 5ARFA 5T0KA 4JLGA 5F5EA 3TG4A 1N6CA 3OOIA 3BO5A 3RQ4A 4IJ8A 4I51A 4YPAA 3MO2A 4O30A 4YNMA 4J8OA 3F9ZA 3M56A 3M5AA 5KJLA 3DB5A 1N6AA 3MO0A 3OPEA 4NVQA 5CPRB 3OXLA 3S7DA 3S7JA 4J7IA 5LSZA 3PDNA 4MI0A 5HI7A 3SWCA 4YNPA 1ML9A 1ZKKA 5CCLA 4JDSA 3CBMA 3RJWA 5T0MA
chains in the Genus database with same CATH superfamily
4QEPA 2JV0A 5T5GA 1MVXA 3K5KA 4IJDA 3RIBA 3S8PA 4QENA 3KMJA 4Z4PA 5EX0A 5AYFA 4QEOA 3SW9A 2BQZA 3OXFA 4E47A 5CCMA 3QWVA 2QPWA 5TEGA 4YNDA 5TH7A 3DALA 3M53A 4RZ0A 5ARGA 5TTFA 1MT6A 3RU0A 2G46A 3S7FA 3CBPA 3KMAA 3IHXA 5F6KC 2R3AA 2W5YA 4LDGA 4MI5A 3CBOA 3TG5A 4WUYA 5LSXA 5EX3A 4J83A 5EG2A 4NJ5A 1XQHA 5JINA 4H12A 4YPEA 3VV0A 3VUZA 1H3IA 3OS5A 5JIYA 3MO5A 2IGQA 5F6LA 2O8JA 4J7FA 5KJKA 2F69A 4AU7A 2RFIA 3M55A 1N3JA 3F9YA 3KMTA 3N71A 3M54A 1MVHA 3F9WA 5HQ8A 3F9XA 4BUPA 5KJMA 3MEKA 5F59A 3QWWA 1PEGA 5KJNA 4FMUA 5JJ0A 3HNAA 3M59A 3M58A 1O9SA 4C1QA 1MUFA 3EP0A 3M57A 4YPUA 3RAYA 3OXGA 5JHNA 3FPDA 2W5ZA 3QWPA 3S7BA 4O6FA 5ARFA 5T0KA 4JLGA 5F5EA 3TG4A 1N6CA 3OOIA 3BO5A 3RQ4A 4IJ8A 4I51A 4YPAA 3MO2A 4O30A 4YNMA 4J8OA 3F9ZA 3M56A 3M5AA 5KJLA 3DB5A 1N6AA 3MO0A 3OPEA 4NVQA 5CPRB 3OXLA 3S7DA 3S7JA 4J7IA 5LSZA 3PDNA 4MI0A 5HI7A 3SWCA 4YNPA 1ML9A 1ZKKA 5CCLA 4JDSA 3CBMA 3RJWA 5T0MA
chains in the Genus database with same CATH topology
4QEPA 2JV0A 5T5GA 1MVXA 3K5KA 4IJDA 3RIBA 3S8PA 4QENA 3KMJA 4Z4PA 5EX0A 5AYFA 4QEOA 3SW9A 2BQZA 3OXFA 4E47A 5CCMA 3QWVA 2QPWA 5TEGA 4YNDA 5TH7A 3DALA 3M53A 4RZ0A 5ARGA 5TTFA 1MT6A 3RU0A 2G46A 3S7FA 3CBPA 3KMAA 3IHXA 5F6KC 2R3AA 2W5YA 4LDGA 4MI5A 3CBOA 3TG5A 4WUYA 5LSXA 5EX3A 4J83A 5EG2A 4NJ5A 1XQHA 5JINA 4H12A 4YPEA 3VV0A 3VUZA 1H3IA 3OS5A 5JIYA 3MO5A 2IGQA 5F6LA 2O8JA 4J7FA 5KJKA 2F69A 4AU7A 2RFIA 3M55A 1N3JA 3F9YA 3KMTA 3N71A 3M54A 1MVHA 3F9WA 5HQ8A 3F9XA 4BUPA 5KJMA 3MEKA 5F59A 3QWWA 1PEGA 5KJNA 4FMUA 5JJ0A 3HNAA 3M59A 3M58A 1O9SA 4C1QA 1MUFA 3EP0A 3M57A 4YPUA 3RAYA 3OXGA 5JHNA 3FPDA 2W5ZA 3QWPA 3S7BA 4O6FA 5ARFA 5T0KA 4JLGA 5F5EA 3TG4A 1N6CA 3OOIA 3BO5A 3RQ4A 4IJ8A 4I51A 4YPAA 3MO2A 4O30A 4YNMA 4J8OA 3F9ZA 3M56A 3M5AA 5KJLA 3DB5A 1N6AA 3MO0A 3OPEA 4NVQA 5CPRB 3OXLA 3S7DA 3S7JA 4J7IA 5LSZA 3PDNA 4MI0A 5HI7A 3SWCA 4YNPA 1ML9A 1ZKKA 5CCLA 4JDSA 3CBMA 3RJWA 5T0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QEP A;  2JV0 A;  5T5G A;  1MVX A;  3K5K A;  4IJD A;  3RIB A;  3S8P A;  4QEN A;  3KMJ A;  4Z4P A;  5EX0 A;  5AYF A;  4QEO A;  3SW9 A;  2BQZ A;  3OXF A;  4E47 A;  5CCM A;  3QWV A;  2QPW A;  5TEG A;  4YND A;  5TH7 A;  3DAL A;  3M53 A;  4RZ0 A;  5ARG A;  5TTF A;  1MT6 A;  3RU0 A;  2G46 A;  3S7F A;  3CBP A;  3KMA A;  3IHX A;  5F6K C;  2R3A A;  2W5Y A;  4LDG A;  4MI5 A;  3CBO A;  3TG5 A;  4WUY A;  5LSX A;  5EX3 A;  4J83 A;  5EG2 A;  4NJ5 A;  1XQH A;  5JIN A;  4H12 A;  4YPE A;  3VV0 A;  3VUZ A;  1H3I A;  3OS5 A;  5JIY A;  3MO5 A;  2IGQ A;  5F6L A;  2O8J A;  4J7F A;  5KJK A;  2F69 A;  4AU7 A;  2RFI A;  3M55 A;  1N3J A;  3F9Y A;  3KMT A;  3N71 A;  3M54 A;  1MVH A;  3F9W A;  5HQ8 A;  3F9X A;  4BUP A;  5KJM A;  3MEK A;  5F59 A;  3QWW A;  1PEG A;  5KJN A;  4FMU A;  5JJ0 A;  3HNA A;  3M59 A;  3M58 A;  1O9S A;  4C1Q A;  1MUF A;  3EP0 A;  3M57 A;  4YPU A;  3RAY A;  3OXG A;  5JHN A;  3FPD A;  2W5Z A;  3QWP A;  3S7B A;  4O6F A;  5ARF A;  5T0K A;  4JLG A;  5F5E A;  3TG4 A;  1N6C A;  3OOI A;  3BO5 A;  3RQ4 A;  4IJ8 A;  4I51 A;  4YPA A;  3MO2 A;  4O30 A;  4YNM A;  4J8O A;  3F9Z A;  3M56 A;  3M5A A;  5KJL A;  3DB5 A;  1N6A A;  3MO0 A;  3OPE A;  4NVQ A;  5CPR B;  3OXL A;  3S7D A;  3S7J A;  4J7I A;  5LSZ A;  3PDN A;  4MI0 A;  5HI7 A;  3SWC A;  4YNP A;  1ML9 A;  1ZKK A;  5CCL A;  4JDS A;  3CBM A;  3RJW A;  5T0M A; 
#chains in the Genus database with same CATH topology
 4QEP A;  2JV0 A;  5T5G A;  1MVX A;  3K5K A;  4IJD A;  3RIB A;  3S8P A;  4QEN A;  3KMJ A;  4Z4P A;  5EX0 A;  5AYF A;  4QEO A;  3SW9 A;  2BQZ A;  3OXF A;  4E47 A;  5CCM A;  3QWV A;  2QPW A;  5TEG A;  4YND A;  5TH7 A;  3DAL A;  3M53 A;  4RZ0 A;  5ARG A;  5TTF A;  1MT6 A;  3RU0 A;  2G46 A;  3S7F A;  3CBP A;  3KMA A;  3IHX A;  5F6K C;  2R3A A;  2W5Y A;  4LDG A;  4MI5 A;  3CBO A;  3TG5 A;  4WUY A;  5LSX A;  5EX3 A;  4J83 A;  5EG2 A;  4NJ5 A;  1XQH A;  5JIN A;  4H12 A;  4YPE A;  3VV0 A;  3VUZ A;  1H3I A;  3OS5 A;  5JIY A;  3MO5 A;  2IGQ A;  5F6L A;  2O8J A;  4J7F A;  5KJK A;  2F69 A;  4AU7 A;  2RFI A;  3M55 A;  1N3J A;  3F9Y A;  3KMT A;  3N71 A;  3M54 A;  1MVH A;  3F9W A;  5HQ8 A;  3F9X A;  4BUP A;  5KJM A;  3MEK A;  5F59 A;  3QWW A;  1PEG A;  5KJN A;  4FMU A;  5JJ0 A;  3HNA A;  3M59 A;  3M58 A;  1O9S A;  4C1Q A;  1MUF A;  3EP0 A;  3M57 A;  4YPU A;  3RAY A;  3OXG A;  5JHN A;  3FPD A;  2W5Z A;  3QWP A;  3S7B A;  4O6F A;  5ARF A;  5T0K A;  4JLG A;  5F5E A;  3TG4 A;  1N6C A;  3OOI A;  3BO5 A;  3RQ4 A;  4IJ8 A;  4I51 A;  4YPA A;  3MO2 A;  4O30 A;  4YNM A;  4J8O A;  3F9Z A;  3M56 A;  3M5A A;  5KJL A;  3DB5 A;  1N6A A;  3MO0 A;  3OPE A;  4NVQ A;  5CPR B;  3OXL A;  3S7D A;  3S7J A;  4J7I A;  5LSZ A;  3PDN A;  4MI0 A;  5HI7 A;  3SWC A;  4YNP A;  1ML9 A;  1ZKK A;  5CCL A;  4JDS A;  3CBM A;  3RJW A;  5T0M A; 
#chains in the Genus database with same CATH homology
 4QEP A;  2JV0 A;  5T5G A;  1MVX A;  3K5K A;  4IJD A;  3RIB A;  3S8P A;  4QEN A;  3KMJ A;  4Z4P A;  5EX0 A;  5AYF A;  4QEO A;  3SW9 A;  2BQZ A;  3OXF A;  4E47 A;  5CCM A;  3QWV A;  2QPW A;  5TEG A;  4YND A;  5TH7 A;  3DAL A;  3M53 A;  4RZ0 A;  5ARG A;  5TTF A;  1MT6 A;  3RU0 A;  2G46 A;  3S7F A;  3CBP A;  3KMA A;  3IHX A;  5F6K C;  2R3A A;  2W5Y A;  4LDG A;  4MI5 A;  3CBO A;  3TG5 A;  4WUY A;  5LSX A;  5EX3 A;  4J83 A;  5EG2 A;  4NJ5 A;  1XQH A;  5JIN A;  4H12 A;  4YPE A;  3VV0 A;  3VUZ A;  1H3I A;  3OS5 A;  5JIY A;  3MO5 A;  2IGQ A;  5F6L A;  2O8J A;  4J7F A;  5KJK A;  2F69 A;  4AU7 A;  2RFI A;  3M55 A;  1N3J A;  3F9Y A;  3KMT A;  3N71 A;  3M54 A;  1MVH A;  3F9W A;  5HQ8 A;  3F9X A;  4BUP A;  5KJM A;  3MEK A;  5F59 A;  3QWW A;  1PEG A;  5KJN A;  4FMU A;  5JJ0 A;  3HNA A;  3M59 A;  3M58 A;  1O9S A;  4C1Q A;  1MUF A;  3EP0 A;  3M57 A;  4YPU A;  3RAY A;  3OXG A;  5JHN A;  3FPD A;  2W5Z A;  3QWP A;  3S7B A;  4O6F A;  5ARF A;  5T0K A;  4JLG A;  5F5E A;  3TG4 A;  1N6C A;  3OOI A;  3BO5 A;  3RQ4 A;  4IJ8 A;  4I51 A;  4YPA A;  3MO2 A;  4O30 A;  4YNM A;  4J8O A;  3F9Z A;  3M56 A;  3M5A A;  5KJL A;  3DB5 A;  1N6A A;  3MO0 A;  3OPE A;  4NVQ A;  5CPR B;  3OXL A;  3S7D A;  3S7J A;  4J7I A;  5LSZ A;  3PDN A;  4MI0 A;  5HI7 A;  3SWC A;  4YNP A;  1ML9 A;  1ZKK A;  5CCL A;  4JDS A;  3CBM A;  3RJW A;  5T0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...