3F9ZA

Structural insights into lysine multiple methylation by set domain methyltransferases, set8-y245f / h4-lys20 / adohcy
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
160
structure length
156
Chain Sequence
KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEFHGDLIEITDAKKREALYATGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase SETD8
publication title Structural origins for the product specificity of SET domain protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 45
structure length 156
sequence length 160
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3f9zA00
5TH7A 3QWWA 5T5GA 3OXFA 3S8PA 3M53A 3EP0A 2W5ZA 3HNAA 4FMUA 3M56A 3BO5A 2JV0A 4QEOA 1H3IA 4BUPA 3MO5A 4J8OA 1PEGA 4YPAA 4QENA 4J7FA 4C1QA 5HI7A 4IJ8A 3F9WA 2G46A 3RJWA 3S7JA 3CBMA 5T0KA 5KJNA 5F6KC 1MT6A 4AU7A 3M54A 3S7DA 3SW9A 5AYFA 5CPRB 3K5KA 2W5YA 2BQZA 5JINA 4QEPA 3VV0A 5T0MA 3OS5A 3OPEA 3MO2A 1XQHA 3IHXA 1MVXA 4JLGA 5TEGA 4YNMA 5ARFA 3M55A 3RQ4A 4O6FA 3KMTA 3DB5A 4YNPA 4IJDA 3M58A 3F9YA 2RFIA 3RIBA 5CCLA 4WUYA 3CBOA 5JHNA 3F9XA 2R3AA 4H12A 3RAYA 2IGQA 3KMAA 3N71A 3OOIA 5EX3A 5F59A 3SWCA 5F5EA 1O9SA 2F69A 4YPEA 4JDSA 3S7BA 1ZKKA 3RU0A 3PDNA 4Z4PA 3OXGA 3TG4A 4I51A 4NJ5A 1N6CA 3VUZA 5JIYA 1N3JA 4YNDA 1MVHA 5F6LA 1N6AA 5ARGA 5KJMA 4MI0A 3TG5A 5LSXA 5KJLA 4NVQA 3CBPA 5TTFA 3OXLA 4E47A 4MI5A 3QWVA 3MEKA 1ML9A 1MUFA 3M59A 5HQ8A 4J7IA 3M5AA 5LSZA 3F9ZA 4YPUA 5JJ0A 5CCMA 3QWPA 4J83A 4O30A 4RZ0A 3FPDA 5KJKA 5EG2A 2QPWA 5EX0A 3S7FA 3M57A 3MO0A 3KMJA 4LDGA 3DALA 2O8JA
chains in the Genus database with same CATH superfamily
5TH7A 3QWWA 5T5GA 3OXFA 3S8PA 3M53A 3EP0A 2W5ZA 3HNAA 4FMUA 3M56A 3BO5A 2JV0A 4QEOA 1H3IA 4BUPA 3MO5A 4J8OA 1PEGA 4YPAA 4QENA 4J7FA 4C1QA 5HI7A 4IJ8A 3F9WA 2G46A 3RJWA 3S7JA 3CBMA 5T0KA 5KJNA 5F6KC 1MT6A 4AU7A 3M54A 3S7DA 3SW9A 5AYFA 5CPRB 3K5KA 2W5YA 2BQZA 5JINA 4QEPA 3VV0A 5T0MA 3OS5A 3OPEA 3MO2A 1XQHA 3IHXA 1MVXA 4JLGA 5TEGA 4YNMA 5ARFA 3M55A 3RQ4A 4O6FA 3KMTA 3DB5A 4YNPA 4IJDA 3M58A 3F9YA 2RFIA 3RIBA 5CCLA 4WUYA 3CBOA 5JHNA 3F9XA 2R3AA 4H12A 3RAYA 2IGQA 3KMAA 3N71A 3OOIA 5EX3A 5F59A 3SWCA 5F5EA 1O9SA 2F69A 4YPEA 4JDSA 3S7BA 1ZKKA 3RU0A 3PDNA 4Z4PA 3OXGA 3TG4A 4I51A 4NJ5A 1N6CA 3VUZA 5JIYA 1N3JA 4YNDA 1MVHA 5F6LA 1N6AA 5ARGA 5KJMA 4MI0A 3TG5A 5LSXA 5KJLA 4NVQA 3CBPA 5TTFA 3OXLA 4E47A 4MI5A 3QWVA 3MEKA 1ML9A 1MUFA 3M59A 5HQ8A 4J7IA 3M5AA 5LSZA 3F9ZA 4YPUA 5JJ0A 5CCMA 3QWPA 4J83A 4O30A 4RZ0A 3FPDA 5KJKA 5EG2A 2QPWA 5EX0A 3S7FA 3M57A 3MO0A 3KMJA 4LDGA 3DALA 2O8JA
chains in the Genus database with same CATH topology
5TH7A 3QWWA 5T5GA 3OXFA 3S8PA 3M53A 3EP0A 2W5ZA 3HNAA 4FMUA 3M56A 3BO5A 2JV0A 4QEOA 1H3IA 4BUPA 3MO5A 4J8OA 1PEGA 4YPAA 4QENA 4J7FA 4C1QA 5HI7A 4IJ8A 3F9WA 2G46A 3RJWA 3S7JA 3CBMA 5T0KA 5KJNA 5F6KC 1MT6A 4AU7A 3M54A 3S7DA 3SW9A 5AYFA 5CPRB 3K5KA 2W5YA 2BQZA 5JINA 4QEPA 3VV0A 5T0MA 3OS5A 3OPEA 3MO2A 1XQHA 3IHXA 1MVXA 4JLGA 5TEGA 4YNMA 5ARFA 3M55A 3RQ4A 4O6FA 3KMTA 3DB5A 4YNPA 4IJDA 3M58A 3F9YA 2RFIA 3RIBA 5CCLA 4WUYA 3CBOA 5JHNA 3F9XA 2R3AA 4H12A 3RAYA 2IGQA 3KMAA 3N71A 3OOIA 5EX3A 5F59A 3SWCA 5F5EA 1O9SA 2F69A 4YPEA 4JDSA 3S7BA 1ZKKA 3RU0A 3PDNA 4Z4PA 3OXGA 3TG4A 4I51A 4NJ5A 1N6CA 3VUZA 5JIYA 1N3JA 4YNDA 1MVHA 5F6LA 1N6AA 5ARGA 5KJMA 4MI0A 3TG5A 5LSXA 5KJLA 4NVQA 3CBPA 5TTFA 3OXLA 4E47A 4MI5A 3QWVA 3MEKA 1ML9A 1MUFA 3M59A 5HQ8A 4J7IA 3M5AA 5LSZA 3F9ZA 4YPUA 5JJ0A 5CCMA 3QWPA 4J83A 4O30A 4RZ0A 3FPDA 5KJKA 5EG2A 2QPWA 5EX0A 3S7FA 3M57A 3MO0A 3KMJA 4LDGA 3DALA 2O8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TH7 A;  3QWW A;  5T5G A;  3OXF A;  3S8P A;  3M53 A;  3EP0 A;  2W5Z A;  3HNA A;  4FMU A;  3M56 A;  3BO5 A;  2JV0 A;  4QEO A;  1H3I A;  4BUP A;  3MO5 A;  4J8O A;  1PEG A;  4YPA A;  4QEN A;  4J7F A;  4C1Q A;  5HI7 A;  4IJ8 A;  3F9W A;  2G46 A;  3RJW A;  3S7J A;  3CBM A;  5T0K A;  5KJN A;  5F6K C;  1MT6 A;  4AU7 A;  3M54 A;  3S7D A;  3SW9 A;  5AYF A;  5CPR B;  3K5K A;  2W5Y A;  2BQZ A;  5JIN A;  4QEP A;  3VV0 A;  5T0M A;  3OS5 A;  3OPE A;  3MO2 A;  1XQH A;  3IHX A;  1MVX A;  4JLG A;  5TEG A;  4YNM A;  5ARF A;  3M55 A;  3RQ4 A;  4O6F A;  3KMT A;  3DB5 A;  4YNP A;  4IJD A;  3M58 A;  3F9Y A;  2RFI A;  3RIB A;  5CCL A;  4WUY A;  3CBO A;  5JHN A;  3F9X A;  2R3A A;  4H12 A;  3RAY A;  2IGQ A;  3KMA A;  3N71 A;  3OOI A;  5EX3 A;  5F59 A;  3SWC A;  5F5E A;  1O9S A;  2F69 A;  4YPE A;  4JDS A;  3S7B A;  1ZKK A;  3RU0 A;  3PDN A;  4Z4P A;  3OXG A;  3TG4 A;  4I51 A;  4NJ5 A;  1N6C A;  3VUZ A;  5JIY A;  1N3J A;  4YND A;  1MVH A;  5F6L A;  1N6A A;  5ARG A;  5KJM A;  4MI0 A;  3TG5 A;  5LSX A;  5KJL A;  4NVQ A;  3CBP A;  5TTF A;  3OXL A;  4E47 A;  4MI5 A;  3QWV A;  3MEK A;  1ML9 A;  1MUF A;  3M59 A;  5HQ8 A;  4J7I A;  3M5A A;  5LSZ A;  3F9Z A;  4YPU A;  5JJ0 A;  5CCM A;  3QWP A;  4J83 A;  4O30 A;  4RZ0 A;  3FPD A;  5KJK A;  5EG2 A;  2QPW A;  5EX0 A;  3S7F A;  3M57 A;  3MO0 A;  3KMJ A;  4LDG A;  3DAL A;  2O8J A; 
#chains in the Genus database with same CATH topology
 5TH7 A;  3QWW A;  5T5G A;  3OXF A;  3S8P A;  3M53 A;  3EP0 A;  2W5Z A;  3HNA A;  4FMU A;  3M56 A;  3BO5 A;  2JV0 A;  4QEO A;  1H3I A;  4BUP A;  3MO5 A;  4J8O A;  1PEG A;  4YPA A;  4QEN A;  4J7F A;  4C1Q A;  5HI7 A;  4IJ8 A;  3F9W A;  2G46 A;  3RJW A;  3S7J A;  3CBM A;  5T0K A;  5KJN A;  5F6K C;  1MT6 A;  4AU7 A;  3M54 A;  3S7D A;  3SW9 A;  5AYF A;  5CPR B;  3K5K A;  2W5Y A;  2BQZ A;  5JIN A;  4QEP A;  3VV0 A;  5T0M A;  3OS5 A;  3OPE A;  3MO2 A;  1XQH A;  3IHX A;  1MVX A;  4JLG A;  5TEG A;  4YNM A;  5ARF A;  3M55 A;  3RQ4 A;  4O6F A;  3KMT A;  3DB5 A;  4YNP A;  4IJD A;  3M58 A;  3F9Y A;  2RFI A;  3RIB A;  5CCL A;  4WUY A;  3CBO A;  5JHN A;  3F9X A;  2R3A A;  4H12 A;  3RAY A;  2IGQ A;  3KMA A;  3N71 A;  3OOI A;  5EX3 A;  5F59 A;  3SWC A;  5F5E A;  1O9S A;  2F69 A;  4YPE A;  4JDS A;  3S7B A;  1ZKK A;  3RU0 A;  3PDN A;  4Z4P A;  3OXG A;  3TG4 A;  4I51 A;  4NJ5 A;  1N6C A;  3VUZ A;  5JIY A;  1N3J A;  4YND A;  1MVH A;  5F6L A;  1N6A A;  5ARG A;  5KJM A;  4MI0 A;  3TG5 A;  5LSX A;  5KJL A;  4NVQ A;  3CBP A;  5TTF A;  3OXL A;  4E47 A;  4MI5 A;  3QWV A;  3MEK A;  1ML9 A;  1MUF A;  3M59 A;  5HQ8 A;  4J7I A;  3M5A A;  5LSZ A;  3F9Z A;  4YPU A;  5JJ0 A;  5CCM A;  3QWP A;  4J83 A;  4O30 A;  4RZ0 A;  3FPD A;  5KJK A;  5EG2 A;  2QPW A;  5EX0 A;  3S7F A;  3M57 A;  3MO0 A;  3KMJ A;  4LDG A;  3DAL A;  2O8J A; 
#chains in the Genus database with same CATH homology
 5TH7 A;  3QWW A;  5T5G A;  3OXF A;  3S8P A;  3M53 A;  3EP0 A;  2W5Z A;  3HNA A;  4FMU A;  3M56 A;  3BO5 A;  2JV0 A;  4QEO A;  1H3I A;  4BUP A;  3MO5 A;  4J8O A;  1PEG A;  4YPA A;  4QEN A;  4J7F A;  4C1Q A;  5HI7 A;  4IJ8 A;  3F9W A;  2G46 A;  3RJW A;  3S7J A;  3CBM A;  5T0K A;  5KJN A;  5F6K C;  1MT6 A;  4AU7 A;  3M54 A;  3S7D A;  3SW9 A;  5AYF A;  5CPR B;  3K5K A;  2W5Y A;  2BQZ A;  5JIN A;  4QEP A;  3VV0 A;  5T0M A;  3OS5 A;  3OPE A;  3MO2 A;  1XQH A;  3IHX A;  1MVX A;  4JLG A;  5TEG A;  4YNM A;  5ARF A;  3M55 A;  3RQ4 A;  4O6F A;  3KMT A;  3DB5 A;  4YNP A;  4IJD A;  3M58 A;  3F9Y A;  2RFI A;  3RIB A;  5CCL A;  4WUY A;  3CBO A;  5JHN A;  3F9X A;  2R3A A;  4H12 A;  3RAY A;  2IGQ A;  3KMA A;  3N71 A;  3OOI A;  5EX3 A;  5F59 A;  3SWC A;  5F5E A;  1O9S A;  2F69 A;  4YPE A;  4JDS A;  3S7B A;  1ZKK A;  3RU0 A;  3PDN A;  4Z4P A;  3OXG A;  3TG4 A;  4I51 A;  4NJ5 A;  1N6C A;  3VUZ A;  5JIY A;  1N3J A;  4YND A;  1MVH A;  5F6L A;  1N6A A;  5ARG A;  5KJM A;  4MI0 A;  3TG5 A;  5LSX A;  5KJL A;  4NVQ A;  3CBP A;  5TTF A;  3OXL A;  4E47 A;  4MI5 A;  3QWV A;  3MEK A;  1ML9 A;  1MUF A;  3M59 A;  5HQ8 A;  4J7I A;  3M5A A;  5LSZ A;  3F9Z A;  4YPU A;  5JJ0 A;  5CCM A;  3QWP A;  4J83 A;  4O30 A;  4RZ0 A;  3FPD A;  5KJK A;  5EG2 A;  2QPW A;  5EX0 A;  3S7F A;  3M57 A;  3MO0 A;  3KMJ A;  4LDG A;  3DAL A;  2O8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...