3F9ZA

Structural insights into lysine multiple methylation by set domain methyltransferases, set8-y245f / h4-lys20 / adohcy
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
160
structure length
156
Chain Sequence
b'KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEFHGDLIEITDAKKREALYATGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase SETD8
molecule tags Transferase
source organism Homo sapiens
publication title Structural origins for the product specificity of SET domain protein methyltransferases.
pubmed doi rcsb
total genus 45
structure length 156
sequence length 160
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3f9zA00
3OOIA 1MUFA 3TG5A 2W5ZA 1ML9A 3QWPA 4YNPA 3S8PA 4J83A 5CPRB 2W5YA 4FMUA 3OXGA 4QEOA 5HI7A 1MT6A 4QEPA 3S7JA 5HQ8A 5ARGA 4WUYA 4RZ0A 5F5EA 3S7DA 3CBMA 3M57A 4H12A 5KJKA 5JINA 1XQHA 5TH7A 4Z4PA 4I51A 4IJ8A 3QWWA 5TTFA 4YPAA 3DALA 5TEGA 2F69A 5F59A 3F9WA 4YNMA 3RJWA 3K5KA 5EG2A 5JHNA 1O9SA 3QWVA 4QENA 4J8OA 5ARFA 2O8JA 5LSXA 3OS5A 5AYFA 4YPEA 3M55A 3EP0A 4JDSA 4NVQA 2RFIA 5CCLA 3MO5A 5T0KA 3KMTA 5KJLA 3OXFA 5F6KC 3RQ4A 3KMAA 4O6FA 3BO5A 4J7IA 2G46A 4YNDA 1N6AA 3DB5A 3IHXA 4IJDA 2QPWA 1MVHA 3SW9A 1H3IA 3HNAA 4E47A 3S7BA 1PEGA 5EX3A 2JV0A 3RIBA 3CBOA 3M53A 5JJ0A 5T5GA 3VUZA 2IGQA 4JLGA 3OPEA 4MI0A 4LDGA 4C1QA 3N71A 4MI5A 3CBPA 3MO0A 4NJ5A 1ZKKA 3M5AA 1N3JA 3RAYA 3M59A 5EX0A 5JIYA 5T0MA 3F9ZA 3VV0A 4AU7A 5CCMA 3F9YA 3SWCA 3RU0A 3TG4A 3KMJA 4YPUA 2BQZA 1N6CA 4O30A 3OXLA 3MO2A 3M54A 4J7FA 2R3AA 3S7FA 3F9XA 3M56A 3M58A 5KJMA 5LSZA 3MEKA 3PDNA 5F6LA 1MVXA 4BUPA 5KJNA 3FPDA
chains in the Genus database with same CATH superfamily
3OOIA 1MUFA 3TG5A 2W5ZA 1ML9A 3QWPA 4YNPA 3S8PA 4J83A 5CPRB 2W5YA 4FMUA 3OXGA 4QEOA 5HI7A 1MT6A 4QEPA 3S7JA 5HQ8A 5ARGA 4WUYA 4RZ0A 5F5EA 3S7DA 3CBMA 3M57A 4H12A 5KJKA 5JINA 1XQHA 5TH7A 4Z4PA 4I51A 4IJ8A 3QWWA 5TTFA 4YPAA 3DALA 5TEGA 2F69A 5F59A 3F9WA 4YNMA 3RJWA 3K5KA 5EG2A 5JHNA 1O9SA 3QWVA 4QENA 4J8OA 5ARFA 2O8JA 5LSXA 3OS5A 5AYFA 4YPEA 3M55A 3EP0A 4JDSA 4NVQA 2RFIA 5CCLA 3MO5A 5T0KA 3KMTA 5KJLA 3OXFA 5F6KC 3RQ4A 3KMAA 4O6FA 3BO5A 4J7IA 2G46A 4YNDA 1N6AA 3DB5A 3IHXA 4IJDA 2QPWA 1MVHA 3SW9A 1H3IA 3HNAA 4E47A 3S7BA 1PEGA 5EX3A 2JV0A 3RIBA 3CBOA 3M53A 5JJ0A 5T5GA 3VUZA 2IGQA 4JLGA 3OPEA 4MI0A 4LDGA 4C1QA 3N71A 4MI5A 3CBPA 3MO0A 4NJ5A 1ZKKA 3M5AA 1N3JA 3RAYA 3M59A 5EX0A 5JIYA 5T0MA 3F9ZA 3VV0A 4AU7A 5CCMA 3F9YA 3SWCA 3RU0A 3TG4A 3KMJA 4YPUA 2BQZA 1N6CA 4O30A 3OXLA 3MO2A 3M54A 4J7FA 2R3AA 3S7FA 3F9XA 3M56A 3M58A 5KJMA 5LSZA 3MEKA 3PDNA 5F6LA 1MVXA 4BUPA 5KJNA 3FPDA
chains in the Genus database with same CATH topology
3OOIA 1MUFA 3TG5A 2W5ZA 1ML9A 3QWPA 4YNPA 3S8PA 4J83A 5CPRB 2W5YA 4FMUA 3OXGA 4QEOA 5HI7A 1MT6A 4QEPA 3S7JA 5HQ8A 5ARGA 4WUYA 4RZ0A 5F5EA 3S7DA 3CBMA 3M57A 4H12A 5KJKA 5JINA 1XQHA 5TH7A 4Z4PA 4I51A 4IJ8A 3QWWA 5TTFA 4YPAA 3DALA 5TEGA 2F69A 5F59A 3F9WA 4YNMA 3RJWA 3K5KA 5EG2A 5JHNA 1O9SA 3QWVA 4QENA 4J8OA 5ARFA 2O8JA 5LSXA 3OS5A 5AYFA 4YPEA 3M55A 3EP0A 4JDSA 4NVQA 2RFIA 5CCLA 3MO5A 5T0KA 3KMTA 5KJLA 3OXFA 5F6KC 3RQ4A 3KMAA 4O6FA 3BO5A 4J7IA 2G46A 4YNDA 1N6AA 3DB5A 3IHXA 4IJDA 2QPWA 1MVHA 3SW9A 1H3IA 3HNAA 4E47A 3S7BA 1PEGA 5EX3A 2JV0A 3RIBA 3CBOA 3M53A 5JJ0A 5T5GA 3VUZA 2IGQA 4JLGA 3OPEA 4MI0A 4LDGA 4C1QA 3N71A 4MI5A 3CBPA 3MO0A 4NJ5A 1ZKKA 3M5AA 1N3JA 3RAYA 3M59A 5EX0A 5JIYA 5T0MA 3F9ZA 3VV0A 4AU7A 5CCMA 3F9YA 3SWCA 3RU0A 3TG4A 3KMJA 4YPUA 2BQZA 1N6CA 4O30A 3OXLA 3MO2A 3M54A 4J7FA 2R3AA 3S7FA 3F9XA 3M56A 3M58A 5KJMA 5LSZA 3MEKA 3PDNA 5F6LA 1MVXA 4BUPA 5KJNA 3FPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OOI A;  1MUF A;  3TG5 A;  2W5Z A;  1ML9 A;  3QWP A;  4YNP A;  3S8P A;  4J83 A;  5CPR B;  2W5Y A;  4FMU A;  3OXG A;  4QEO A;  5HI7 A;  1MT6 A;  4QEP A;  3S7J A;  5HQ8 A;  5ARG A;  4WUY A;  4RZ0 A;  5F5E A;  3S7D A;  3CBM A;  3M57 A;  4H12 A;  5KJK A;  5JIN A;  1XQH A;  5TH7 A;  4Z4P A;  4I51 A;  4IJ8 A;  3QWW A;  5TTF A;  4YPA A;  3DAL A;  5TEG A;  2F69 A;  5F59 A;  3F9W A;  4YNM A;  3RJW A;  3K5K A;  5EG2 A;  5JHN A;  1O9S A;  3QWV A;  4QEN A;  4J8O A;  5ARF A;  2O8J A;  5LSX A;  3OS5 A;  5AYF A;  4YPE A;  3M55 A;  3EP0 A;  4JDS A;  4NVQ A;  2RFI A;  5CCL A;  3MO5 A;  5T0K A;  3KMT A;  5KJL A;  3OXF A;  5F6K C;  3RQ4 A;  3KMA A;  4O6F A;  3BO5 A;  4J7I A;  2G46 A;  4YND A;  1N6A A;  3DB5 A;  3IHX A;  4IJD A;  2QPW A;  1MVH A;  3SW9 A;  1H3I A;  3HNA A;  4E47 A;  3S7B A;  1PEG A;  5EX3 A;  2JV0 A;  3RIB A;  3CBO A;  3M53 A;  5JJ0 A;  5T5G A;  3VUZ A;  2IGQ A;  4JLG A;  3OPE A;  4MI0 A;  4LDG A;  4C1Q A;  3N71 A;  4MI5 A;  3CBP A;  3MO0 A;  4NJ5 A;  1ZKK A;  3M5A A;  1N3J A;  3RAY A;  3M59 A;  5EX0 A;  5JIY A;  5T0M A;  3F9Z A;  3VV0 A;  4AU7 A;  5CCM A;  3F9Y A;  3SWC A;  3RU0 A;  3TG4 A;  3KMJ A;  4YPU A;  2BQZ A;  1N6C A;  4O30 A;  3OXL A;  3MO2 A;  3M54 A;  4J7F A;  2R3A A;  3S7F A;  3F9X A;  3M56 A;  3M58 A;  5KJM A;  5LSZ A;  3MEK A;  3PDN A;  5F6L A;  1MVX A;  4BUP A;  5KJN A;  3FPD A; 
#chains in the Genus database with same CATH topology
 3OOI A;  1MUF A;  3TG5 A;  2W5Z A;  1ML9 A;  3QWP A;  4YNP A;  3S8P A;  4J83 A;  5CPR B;  2W5Y A;  4FMU A;  3OXG A;  4QEO A;  5HI7 A;  1MT6 A;  4QEP A;  3S7J A;  5HQ8 A;  5ARG A;  4WUY A;  4RZ0 A;  5F5E A;  3S7D A;  3CBM A;  3M57 A;  4H12 A;  5KJK A;  5JIN A;  1XQH A;  5TH7 A;  4Z4P A;  4I51 A;  4IJ8 A;  3QWW A;  5TTF A;  4YPA A;  3DAL A;  5TEG A;  2F69 A;  5F59 A;  3F9W A;  4YNM A;  3RJW A;  3K5K A;  5EG2 A;  5JHN A;  1O9S A;  3QWV A;  4QEN A;  4J8O A;  5ARF A;  2O8J A;  5LSX A;  3OS5 A;  5AYF A;  4YPE A;  3M55 A;  3EP0 A;  4JDS A;  4NVQ A;  2RFI A;  5CCL A;  3MO5 A;  5T0K A;  3KMT A;  5KJL A;  3OXF A;  5F6K C;  3RQ4 A;  3KMA A;  4O6F A;  3BO5 A;  4J7I A;  2G46 A;  4YND A;  1N6A A;  3DB5 A;  3IHX A;  4IJD A;  2QPW A;  1MVH A;  3SW9 A;  1H3I A;  3HNA A;  4E47 A;  3S7B A;  1PEG A;  5EX3 A;  2JV0 A;  3RIB A;  3CBO A;  3M53 A;  5JJ0 A;  5T5G A;  3VUZ A;  2IGQ A;  4JLG A;  3OPE A;  4MI0 A;  4LDG A;  4C1Q A;  3N71 A;  4MI5 A;  3CBP A;  3MO0 A;  4NJ5 A;  1ZKK A;  3M5A A;  1N3J A;  3RAY A;  3M59 A;  5EX0 A;  5JIY A;  5T0M A;  3F9Z A;  3VV0 A;  4AU7 A;  5CCM A;  3F9Y A;  3SWC A;  3RU0 A;  3TG4 A;  3KMJ A;  4YPU A;  2BQZ A;  1N6C A;  4O30 A;  3OXL A;  3MO2 A;  3M54 A;  4J7F A;  2R3A A;  3S7F A;  3F9X A;  3M56 A;  3M58 A;  5KJM A;  5LSZ A;  3MEK A;  3PDN A;  5F6L A;  1MVX A;  4BUP A;  5KJN A;  3FPD A; 
#chains in the Genus database with same CATH homology
 3OOI A;  1MUF A;  3TG5 A;  2W5Z A;  1ML9 A;  3QWP A;  4YNP A;  3S8P A;  4J83 A;  5CPR B;  2W5Y A;  4FMU A;  3OXG A;  4QEO A;  5HI7 A;  1MT6 A;  4QEP A;  3S7J A;  5HQ8 A;  5ARG A;  4WUY A;  4RZ0 A;  5F5E A;  3S7D A;  3CBM A;  3M57 A;  4H12 A;  5KJK A;  5JIN A;  1XQH A;  5TH7 A;  4Z4P A;  4I51 A;  4IJ8 A;  3QWW A;  5TTF A;  4YPA A;  3DAL A;  5TEG A;  2F69 A;  5F59 A;  3F9W A;  4YNM A;  3RJW A;  3K5K A;  5EG2 A;  5JHN A;  1O9S A;  3QWV A;  4QEN A;  4J8O A;  5ARF A;  2O8J A;  5LSX A;  3OS5 A;  5AYF A;  4YPE A;  3M55 A;  3EP0 A;  4JDS A;  4NVQ A;  2RFI A;  5CCL A;  3MO5 A;  5T0K A;  3KMT A;  5KJL A;  3OXF A;  5F6K C;  3RQ4 A;  3KMA A;  4O6F A;  3BO5 A;  4J7I A;  2G46 A;  4YND A;  1N6A A;  3DB5 A;  3IHX A;  4IJD A;  2QPW A;  1MVH A;  3SW9 A;  1H3I A;  3HNA A;  4E47 A;  3S7B A;  1PEG A;  5EX3 A;  2JV0 A;  3RIB A;  3CBO A;  3M53 A;  5JJ0 A;  5T5G A;  3VUZ A;  2IGQ A;  4JLG A;  3OPE A;  4MI0 A;  4LDG A;  4C1Q A;  3N71 A;  4MI5 A;  3CBP A;  3MO0 A;  4NJ5 A;  1ZKK A;  3M5A A;  1N3J A;  3RAY A;  3M59 A;  5EX0 A;  5JIY A;  5T0M A;  3F9Z A;  3VV0 A;  4AU7 A;  5CCM A;  3F9Y A;  3SWC A;  3RU0 A;  3TG4 A;  3KMJ A;  4YPU A;  2BQZ A;  1N6C A;  4O30 A;  3OXL A;  3MO2 A;  3M54 A;  4J7F A;  2R3A A;  3S7F A;  3F9X A;  3M56 A;  3M58 A;  5KJM A;  5LSZ A;  3MEK A;  3PDN A;  5F6L A;  1MVX A;  4BUP A;  5KJN A;  3FPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...