3F9ZA

Structural insights into lysine multiple methylation by set domain methyltransferases, set8-y245f / h4-lys20 / adohcy
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
160
structure length
156
Chain Sequence
KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEFHGDLIEITDAKKREALYATGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural origins for the product specificity of SET domain protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SETD8
total genus 45
structure length 156
sequence length 160
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3f9zA00
3M54A 3S7DA 3CBPA 4QEPA 3OXGA 4J8OA 3F9YA 5EX3A 3OOIA 5TH7A 1XQHA 3RAYA 1MVXA 4YNDA 5F6LA 3KMJA 4IJ8A 4JLGA 3QWPA 1ML9A 5JHNA 5ARFA 2BQZA 5F6KC 5JIYA 4YPAA 2JV0A 4QEOA 5T5GA 3RU0A 5TTFA 5ARGA 3VV0A 5CPRB 1MUFA 3RJWA 5CCMA 3S7FA 5HQ8A 5T0MA 1H3IA 3KMAA 4MI0A 3PDNA 5HI7A 1O9SA 3K5KA 3OPEA 5CCLA 5TEGA 4YPUA 3M5AA 3CBMA 3HNAA 3F9WA 4J7IA 2W5YA 3BO5A 1N6AA 4WUYA 3RIBA 1MT6A 3TG4A 2QPWA 4MI5A 5EX0A 5LSZA 5LSXA 4YNMA 3S7JA 1PEGA 4QENA 4YPEA 3OXFA 2W5ZA 3OXLA 4NJ5A 4RZ0A 5T0KA 3RQ4A 2O8JA 3M58A 4J7FA 2G46A 3EP0A 1ZKKA 3S8PA 3SW9A 3QWWA 5AYFA 5KJNA 2R3AA 3M57A 4O6FA 4NVQA 3DALA 3MO2A 3M53A 1N6CA 3KMTA 5JJ0A 3CBOA 2RFIA 3M55A 3OS5A 3F9ZA 3MEKA 4YNPA 3QWVA 4LDGA 3DB5A 3MO0A 3M56A 3MO5A 4JDSA 4E47A 5KJKA 1MVHA 5JINA 4I51A 5F5EA 5KJMA 4BUPA 3VUZA 5KJLA 4FMUA 4J83A 3S7BA 1N3JA 4IJDA 3SWCA 3N71A 4H12A 3IHXA 5EG2A 3M59A 4Z4PA 4AU7A 3TG5A 4O30A 2IGQA 2F69A 3F9XA 5F59A 4C1QA 3FPDA
chains in the Genus database with same CATH superfamily
3M54A 3S7DA 3CBPA 4QEPA 3OXGA 4J8OA 3F9YA 5EX3A 3OOIA 5TH7A 1XQHA 3RAYA 1MVXA 4YNDA 5F6LA 3KMJA 4IJ8A 4JLGA 3QWPA 1ML9A 5JHNA 5ARFA 2BQZA 5F6KC 5JIYA 4YPAA 2JV0A 4QEOA 5T5GA 3RU0A 5TTFA 5ARGA 3VV0A 5CPRB 1MUFA 3RJWA 5CCMA 3S7FA 5HQ8A 5T0MA 1H3IA 3KMAA 4MI0A 3PDNA 5HI7A 1O9SA 3K5KA 3OPEA 5CCLA 5TEGA 4YPUA 3M5AA 3CBMA 3HNAA 3F9WA 4J7IA 2W5YA 3BO5A 1N6AA 4WUYA 3RIBA 1MT6A 3TG4A 2QPWA 4MI5A 5EX0A 5LSZA 5LSXA 4YNMA 3S7JA 1PEGA 4QENA 4YPEA 3OXFA 2W5ZA 3OXLA 4NJ5A 4RZ0A 5T0KA 3RQ4A 2O8JA 3M58A 4J7FA 2G46A 3EP0A 1ZKKA 3S8PA 3SW9A 3QWWA 5AYFA 5KJNA 2R3AA 3M57A 4O6FA 4NVQA 3DALA 3MO2A 3M53A 1N6CA 3KMTA 5JJ0A 3CBOA 2RFIA 3M55A 3OS5A 3F9ZA 3MEKA 4YNPA 3QWVA 4LDGA 3DB5A 3MO0A 3M56A 3MO5A 4JDSA 4E47A 5KJKA 1MVHA 5JINA 4I51A 5F5EA 5KJMA 4BUPA 3VUZA 5KJLA 4FMUA 4J83A 3S7BA 1N3JA 4IJDA 3SWCA 3N71A 4H12A 3IHXA 5EG2A 3M59A 4Z4PA 4AU7A 3TG5A 4O30A 2IGQA 2F69A 3F9XA 5F59A 4C1QA 3FPDA
chains in the Genus database with same CATH topology
3M54A 3S7DA 3CBPA 4QEPA 3OXGA 4J8OA 3F9YA 5EX3A 3OOIA 5TH7A 1XQHA 3RAYA 1MVXA 4YNDA 5F6LA 3KMJA 4IJ8A 4JLGA 3QWPA 1ML9A 5JHNA 5ARFA 2BQZA 5F6KC 5JIYA 4YPAA 2JV0A 4QEOA 5T5GA 3RU0A 5TTFA 5ARGA 3VV0A 5CPRB 1MUFA 3RJWA 5CCMA 3S7FA 5HQ8A 5T0MA 1H3IA 3KMAA 4MI0A 3PDNA 5HI7A 1O9SA 3K5KA 3OPEA 5CCLA 5TEGA 4YPUA 3M5AA 3CBMA 3HNAA 3F9WA 4J7IA 2W5YA 3BO5A 1N6AA 4WUYA 3RIBA 1MT6A 3TG4A 2QPWA 4MI5A 5EX0A 5LSZA 5LSXA 4YNMA 3S7JA 1PEGA 4QENA 4YPEA 3OXFA 2W5ZA 3OXLA 4NJ5A 4RZ0A 5T0KA 3RQ4A 2O8JA 3M58A 4J7FA 2G46A 3EP0A 1ZKKA 3S8PA 3SW9A 3QWWA 5AYFA 5KJNA 2R3AA 3M57A 4O6FA 4NVQA 3DALA 3MO2A 3M53A 1N6CA 3KMTA 5JJ0A 3CBOA 2RFIA 3M55A 3OS5A 3F9ZA 3MEKA 4YNPA 3QWVA 4LDGA 3DB5A 3MO0A 3M56A 3MO5A 4JDSA 4E47A 5KJKA 1MVHA 5JINA 4I51A 5F5EA 5KJMA 4BUPA 3VUZA 5KJLA 4FMUA 4J83A 3S7BA 1N3JA 4IJDA 3SWCA 3N71A 4H12A 3IHXA 5EG2A 3M59A 4Z4PA 4AU7A 3TG5A 4O30A 2IGQA 2F69A 3F9XA 5F59A 4C1QA 3FPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M54 A;  3S7D A;  3CBP A;  4QEP A;  3OXG A;  4J8O A;  3F9Y A;  5EX3 A;  3OOI A;  5TH7 A;  1XQH A;  3RAY A;  1MVX A;  4YND A;  5F6L A;  3KMJ A;  4IJ8 A;  4JLG A;  3QWP A;  1ML9 A;  5JHN A;  5ARF A;  2BQZ A;  5F6K C;  5JIY A;  4YPA A;  2JV0 A;  4QEO A;  5T5G A;  3RU0 A;  5TTF A;  5ARG A;  3VV0 A;  5CPR B;  1MUF A;  3RJW A;  5CCM A;  3S7F A;  5HQ8 A;  5T0M A;  1H3I A;  3KMA A;  4MI0 A;  3PDN A;  5HI7 A;  1O9S A;  3K5K A;  3OPE A;  5CCL A;  5TEG A;  4YPU A;  3M5A A;  3CBM A;  3HNA A;  3F9W A;  4J7I A;  2W5Y A;  3BO5 A;  1N6A A;  4WUY A;  3RIB A;  1MT6 A;  3TG4 A;  2QPW A;  4MI5 A;  5EX0 A;  5LSZ A;  5LSX A;  4YNM A;  3S7J A;  1PEG A;  4QEN A;  4YPE A;  3OXF A;  2W5Z A;  3OXL A;  4NJ5 A;  4RZ0 A;  5T0K A;  3RQ4 A;  2O8J A;  3M58 A;  4J7F A;  2G46 A;  3EP0 A;  1ZKK A;  3S8P A;  3SW9 A;  3QWW A;  5AYF A;  5KJN A;  2R3A A;  3M57 A;  4O6F A;  4NVQ A;  3DAL A;  3MO2 A;  3M53 A;  1N6C A;  3KMT A;  5JJ0 A;  3CBO A;  2RFI A;  3M55 A;  3OS5 A;  3F9Z A;  3MEK A;  4YNP A;  3QWV A;  4LDG A;  3DB5 A;  3MO0 A;  3M56 A;  3MO5 A;  4JDS A;  4E47 A;  5KJK A;  1MVH A;  5JIN A;  4I51 A;  5F5E A;  5KJM A;  4BUP A;  3VUZ A;  5KJL A;  4FMU A;  4J83 A;  3S7B A;  1N3J A;  4IJD A;  3SWC A;  3N71 A;  4H12 A;  3IHX A;  5EG2 A;  3M59 A;  4Z4P A;  4AU7 A;  3TG5 A;  4O30 A;  2IGQ A;  2F69 A;  3F9X A;  5F59 A;  4C1Q A;  3FPD A; 
#chains in the Genus database with same CATH topology
 3M54 A;  3S7D A;  3CBP A;  4QEP A;  3OXG A;  4J8O A;  3F9Y A;  5EX3 A;  3OOI A;  5TH7 A;  1XQH A;  3RAY A;  1MVX A;  4YND A;  5F6L A;  3KMJ A;  4IJ8 A;  4JLG A;  3QWP A;  1ML9 A;  5JHN A;  5ARF A;  2BQZ A;  5F6K C;  5JIY A;  4YPA A;  2JV0 A;  4QEO A;  5T5G A;  3RU0 A;  5TTF A;  5ARG A;  3VV0 A;  5CPR B;  1MUF A;  3RJW A;  5CCM A;  3S7F A;  5HQ8 A;  5T0M A;  1H3I A;  3KMA A;  4MI0 A;  3PDN A;  5HI7 A;  1O9S A;  3K5K A;  3OPE A;  5CCL A;  5TEG A;  4YPU A;  3M5A A;  3CBM A;  3HNA A;  3F9W A;  4J7I A;  2W5Y A;  3BO5 A;  1N6A A;  4WUY A;  3RIB A;  1MT6 A;  3TG4 A;  2QPW A;  4MI5 A;  5EX0 A;  5LSZ A;  5LSX A;  4YNM A;  3S7J A;  1PEG A;  4QEN A;  4YPE A;  3OXF A;  2W5Z A;  3OXL A;  4NJ5 A;  4RZ0 A;  5T0K A;  3RQ4 A;  2O8J A;  3M58 A;  4J7F A;  2G46 A;  3EP0 A;  1ZKK A;  3S8P A;  3SW9 A;  3QWW A;  5AYF A;  5KJN A;  2R3A A;  3M57 A;  4O6F A;  4NVQ A;  3DAL A;  3MO2 A;  3M53 A;  1N6C A;  3KMT A;  5JJ0 A;  3CBO A;  2RFI A;  3M55 A;  3OS5 A;  3F9Z A;  3MEK A;  4YNP A;  3QWV A;  4LDG A;  3DB5 A;  3MO0 A;  3M56 A;  3MO5 A;  4JDS A;  4E47 A;  5KJK A;  1MVH A;  5JIN A;  4I51 A;  5F5E A;  5KJM A;  4BUP A;  3VUZ A;  5KJL A;  4FMU A;  4J83 A;  3S7B A;  1N3J A;  4IJD A;  3SWC A;  3N71 A;  4H12 A;  3IHX A;  5EG2 A;  3M59 A;  4Z4P A;  4AU7 A;  3TG5 A;  4O30 A;  2IGQ A;  2F69 A;  3F9X A;  5F59 A;  4C1Q A;  3FPD A; 
#chains in the Genus database with same CATH homology
 3M54 A;  3S7D A;  3CBP A;  4QEP A;  3OXG A;  4J8O A;  3F9Y A;  5EX3 A;  3OOI A;  5TH7 A;  1XQH A;  3RAY A;  1MVX A;  4YND A;  5F6L A;  3KMJ A;  4IJ8 A;  4JLG A;  3QWP A;  1ML9 A;  5JHN A;  5ARF A;  2BQZ A;  5F6K C;  5JIY A;  4YPA A;  2JV0 A;  4QEO A;  5T5G A;  3RU0 A;  5TTF A;  5ARG A;  3VV0 A;  5CPR B;  1MUF A;  3RJW A;  5CCM A;  3S7F A;  5HQ8 A;  5T0M A;  1H3I A;  3KMA A;  4MI0 A;  3PDN A;  5HI7 A;  1O9S A;  3K5K A;  3OPE A;  5CCL A;  5TEG A;  4YPU A;  3M5A A;  3CBM A;  3HNA A;  3F9W A;  4J7I A;  2W5Y A;  3BO5 A;  1N6A A;  4WUY A;  3RIB A;  1MT6 A;  3TG4 A;  2QPW A;  4MI5 A;  5EX0 A;  5LSZ A;  5LSX A;  4YNM A;  3S7J A;  1PEG A;  4QEN A;  4YPE A;  3OXF A;  2W5Z A;  3OXL A;  4NJ5 A;  4RZ0 A;  5T0K A;  3RQ4 A;  2O8J A;  3M58 A;  4J7F A;  2G46 A;  3EP0 A;  1ZKK A;  3S8P A;  3SW9 A;  3QWW A;  5AYF A;  5KJN A;  2R3A A;  3M57 A;  4O6F A;  4NVQ A;  3DAL A;  3MO2 A;  3M53 A;  1N6C A;  3KMT A;  5JJ0 A;  3CBO A;  2RFI A;  3M55 A;  3OS5 A;  3F9Z A;  3MEK A;  4YNP A;  3QWV A;  4LDG A;  3DB5 A;  3MO0 A;  3M56 A;  3MO5 A;  4JDS A;  4E47 A;  5KJK A;  1MVH A;  5JIN A;  4I51 A;  5F5E A;  5KJM A;  4BUP A;  3VUZ A;  5KJL A;  4FMU A;  4J83 A;  3S7B A;  1N3J A;  4IJD A;  3SWC A;  3N71 A;  4H12 A;  3IHX A;  5EG2 A;  3M59 A;  4Z4P A;  4AU7 A;  3TG5 A;  4O30 A;  2IGQ A;  2F69 A;  3F9X A;  5F59 A;  4C1Q A;  3FPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...