3F9ZA

Structural insights into lysine multiple methylation by set domain methyltransferases, set8-y245f / h4-lys20 / adohcy
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
160
structure length
156
Chain Sequence
KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEFHGDLIEITDAKKREALYATGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural origins for the product specificity of SET domain protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SETD8
total genus 45
structure length 156
sequence length 160
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3f9zA00
3RAYA 3HNAA 3OPEA 5TH7A 5KJNA 5HI7A 3MO0A 3M56A 1MVHA 1N3JA 5KJMA 3M57A 2IGQA 1XQHA 3CBPA 3M58A 5EG2A 1MVXA 4YNDA 3M59A 4YPAA 3M55A 1MUFA 3TG5A 5KJLA 3QWPA 3VUZA 5F59A 3F9WA 5LSZA 3EP0A 5ARFA 5F6LA 1PEGA 5JINA 3RQ4A 1MT6A 4AU7A 4C1QA 4O30A 3M54A 5T5GA 2F69A 4IJ8A 3F9YA 1ML9A 3M53A 4NJ5A 4O6FA 3F9ZA 5T0KA 5T0MA 5JHNA 3QWVA 4QENA 3BO5A 2O8JA 5KJKA 3FPDA 4QEPA 1N6AA 3S7JA 4YNPA 3OS5A 2RFIA 3CBOA 4YPUA 5F6KC 1ZKKA 2W5YA 3SWCA 5AYFA 3PDNA 2BQZA 4MI0A 4QEOA 3S7BA 4I51A 4H12A 4WUYA 2QPWA 4BUPA 4Z4PA 3OXLA 1N6CA 2G46A 4J8OA 3N71A 3OXFA 3RIBA 5HQ8A 4E47A 5JJ0A 4JDSA 4IJDA 3K5KA 4J83A 3KMJA 3CBMA 3OOIA 3SW9A 3KMTA 5CPRB 4MI5A 4J7IA 4YPEA 2W5ZA 5LSXA 2JV0A 3IHXA 4JLGA 3RU0A 3DB5A 5EX3A 3F9XA 3OXGA 4LDGA 4J7FA 3TG4A 5EX0A 3MO5A 5CCMA 2R3AA 3RJWA 3MO2A 5TTFA 3S8PA 3MEKA 1O9SA 3S7FA 4YNMA 4NVQA 4FMUA 3VV0A 3S7DA 1H3IA 5JIYA 3DALA 3M5AA 5CCLA 5ARGA 5F5EA 5TEGA 3KMAA 3QWWA 4RZ0A
chains in the Genus database with same CATH superfamily
3RAYA 3HNAA 3OPEA 5TH7A 5KJNA 5HI7A 3MO0A 3M56A 1MVHA 1N3JA 5KJMA 3M57A 2IGQA 1XQHA 3CBPA 3M58A 5EG2A 1MVXA 4YNDA 3M59A 4YPAA 3M55A 1MUFA 3TG5A 5KJLA 3QWPA 3VUZA 5F59A 3F9WA 5LSZA 3EP0A 5ARFA 5F6LA 1PEGA 5JINA 3RQ4A 1MT6A 4AU7A 4C1QA 4O30A 3M54A 5T5GA 2F69A 4IJ8A 3F9YA 1ML9A 3M53A 4NJ5A 4O6FA 3F9ZA 5T0KA 5T0MA 5JHNA 3QWVA 4QENA 3BO5A 2O8JA 5KJKA 3FPDA 4QEPA 1N6AA 3S7JA 4YNPA 3OS5A 2RFIA 3CBOA 4YPUA 5F6KC 1ZKKA 2W5YA 3SWCA 5AYFA 3PDNA 2BQZA 4MI0A 4QEOA 3S7BA 4I51A 4H12A 4WUYA 2QPWA 4BUPA 4Z4PA 3OXLA 1N6CA 2G46A 4J8OA 3N71A 3OXFA 3RIBA 5HQ8A 4E47A 5JJ0A 4JDSA 4IJDA 3K5KA 4J83A 3KMJA 3CBMA 3OOIA 3SW9A 3KMTA 5CPRB 4MI5A 4J7IA 4YPEA 2W5ZA 5LSXA 2JV0A 3IHXA 4JLGA 3RU0A 3DB5A 5EX3A 3F9XA 3OXGA 4LDGA 4J7FA 3TG4A 5EX0A 3MO5A 5CCMA 2R3AA 3RJWA 3MO2A 5TTFA 3S8PA 3MEKA 1O9SA 3S7FA 4YNMA 4NVQA 4FMUA 3VV0A 3S7DA 1H3IA 5JIYA 3DALA 3M5AA 5CCLA 5ARGA 5F5EA 5TEGA 3KMAA 3QWWA 4RZ0A
chains in the Genus database with same CATH topology
3RAYA 3HNAA 3OPEA 5TH7A 5KJNA 5HI7A 3MO0A 3M56A 1MVHA 1N3JA 5KJMA 3M57A 2IGQA 1XQHA 3CBPA 3M58A 5EG2A 1MVXA 4YNDA 3M59A 4YPAA 3M55A 1MUFA 3TG5A 5KJLA 3QWPA 3VUZA 5F59A 3F9WA 5LSZA 3EP0A 5ARFA 5F6LA 1PEGA 5JINA 3RQ4A 1MT6A 4AU7A 4C1QA 4O30A 3M54A 5T5GA 2F69A 4IJ8A 3F9YA 1ML9A 3M53A 4NJ5A 4O6FA 3F9ZA 5T0KA 5T0MA 5JHNA 3QWVA 4QENA 3BO5A 2O8JA 5KJKA 3FPDA 4QEPA 1N6AA 3S7JA 4YNPA 3OS5A 2RFIA 3CBOA 4YPUA 5F6KC 1ZKKA 2W5YA 3SWCA 5AYFA 3PDNA 2BQZA 4MI0A 4QEOA 3S7BA 4I51A 4H12A 4WUYA 2QPWA 4BUPA 4Z4PA 3OXLA 1N6CA 2G46A 4J8OA 3N71A 3OXFA 3RIBA 5HQ8A 4E47A 5JJ0A 4JDSA 4IJDA 3K5KA 4J83A 3KMJA 3CBMA 3OOIA 3SW9A 3KMTA 5CPRB 4MI5A 4J7IA 4YPEA 2W5ZA 5LSXA 2JV0A 3IHXA 4JLGA 3RU0A 3DB5A 5EX3A 3F9XA 3OXGA 4LDGA 4J7FA 3TG4A 5EX0A 3MO5A 5CCMA 2R3AA 3RJWA 3MO2A 5TTFA 3S8PA 3MEKA 1O9SA 3S7FA 4YNMA 4NVQA 4FMUA 3VV0A 3S7DA 1H3IA 5JIYA 3DALA 3M5AA 5CCLA 5ARGA 5F5EA 5TEGA 3KMAA 3QWWA 4RZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RAY A;  3HNA A;  3OPE A;  5TH7 A;  5KJN A;  5HI7 A;  3MO0 A;  3M56 A;  1MVH A;  1N3J A;  5KJM A;  3M57 A;  2IGQ A;  1XQH A;  3CBP A;  3M58 A;  5EG2 A;  1MVX A;  4YND A;  3M59 A;  4YPA A;  3M55 A;  1MUF A;  3TG5 A;  5KJL A;  3QWP A;  3VUZ A;  5F59 A;  3F9W A;  5LSZ A;  3EP0 A;  5ARF A;  5F6L A;  1PEG A;  5JIN A;  3RQ4 A;  1MT6 A;  4AU7 A;  4C1Q A;  4O30 A;  3M54 A;  5T5G A;  2F69 A;  4IJ8 A;  3F9Y A;  1ML9 A;  3M53 A;  4NJ5 A;  4O6F A;  3F9Z A;  5T0K A;  5T0M A;  5JHN A;  3QWV A;  4QEN A;  3BO5 A;  2O8J A;  5KJK A;  3FPD A;  4QEP A;  1N6A A;  3S7J A;  4YNP A;  3OS5 A;  2RFI A;  3CBO A;  4YPU A;  5F6K C;  1ZKK A;  2W5Y A;  3SWC A;  5AYF A;  3PDN A;  2BQZ A;  4MI0 A;  4QEO A;  3S7B A;  4I51 A;  4H12 A;  4WUY A;  2QPW A;  4BUP A;  4Z4P A;  3OXL A;  1N6C A;  2G46 A;  4J8O A;  3N71 A;  3OXF A;  3RIB A;  5HQ8 A;  4E47 A;  5JJ0 A;  4JDS A;  4IJD A;  3K5K A;  4J83 A;  3KMJ A;  3CBM A;  3OOI A;  3SW9 A;  3KMT A;  5CPR B;  4MI5 A;  4J7I A;  4YPE A;  2W5Z A;  5LSX A;  2JV0 A;  3IHX A;  4JLG A;  3RU0 A;  3DB5 A;  5EX3 A;  3F9X A;  3OXG A;  4LDG A;  4J7F A;  3TG4 A;  5EX0 A;  3MO5 A;  5CCM A;  2R3A A;  3RJW A;  3MO2 A;  5TTF A;  3S8P A;  3MEK A;  1O9S A;  3S7F A;  4YNM A;  4NVQ A;  4FMU A;  3VV0 A;  3S7D A;  1H3I A;  5JIY A;  3DAL A;  3M5A A;  5CCL A;  5ARG A;  5F5E A;  5TEG A;  3KMA A;  3QWW A;  4RZ0 A; 
#chains in the Genus database with same CATH topology
 3RAY A;  3HNA A;  3OPE A;  5TH7 A;  5KJN A;  5HI7 A;  3MO0 A;  3M56 A;  1MVH A;  1N3J A;  5KJM A;  3M57 A;  2IGQ A;  1XQH A;  3CBP A;  3M58 A;  5EG2 A;  1MVX A;  4YND A;  3M59 A;  4YPA A;  3M55 A;  1MUF A;  3TG5 A;  5KJL A;  3QWP A;  3VUZ A;  5F59 A;  3F9W A;  5LSZ A;  3EP0 A;  5ARF A;  5F6L A;  1PEG A;  5JIN A;  3RQ4 A;  1MT6 A;  4AU7 A;  4C1Q A;  4O30 A;  3M54 A;  5T5G A;  2F69 A;  4IJ8 A;  3F9Y A;  1ML9 A;  3M53 A;  4NJ5 A;  4O6F A;  3F9Z A;  5T0K A;  5T0M A;  5JHN A;  3QWV A;  4QEN A;  3BO5 A;  2O8J A;  5KJK A;  3FPD A;  4QEP A;  1N6A A;  3S7J A;  4YNP A;  3OS5 A;  2RFI A;  3CBO A;  4YPU A;  5F6K C;  1ZKK A;  2W5Y A;  3SWC A;  5AYF A;  3PDN A;  2BQZ A;  4MI0 A;  4QEO A;  3S7B A;  4I51 A;  4H12 A;  4WUY A;  2QPW A;  4BUP A;  4Z4P A;  3OXL A;  1N6C A;  2G46 A;  4J8O A;  3N71 A;  3OXF A;  3RIB A;  5HQ8 A;  4E47 A;  5JJ0 A;  4JDS A;  4IJD A;  3K5K A;  4J83 A;  3KMJ A;  3CBM A;  3OOI A;  3SW9 A;  3KMT A;  5CPR B;  4MI5 A;  4J7I A;  4YPE A;  2W5Z A;  5LSX A;  2JV0 A;  3IHX A;  4JLG A;  3RU0 A;  3DB5 A;  5EX3 A;  3F9X A;  3OXG A;  4LDG A;  4J7F A;  3TG4 A;  5EX0 A;  3MO5 A;  5CCM A;  2R3A A;  3RJW A;  3MO2 A;  5TTF A;  3S8P A;  3MEK A;  1O9S A;  3S7F A;  4YNM A;  4NVQ A;  4FMU A;  3VV0 A;  3S7D A;  1H3I A;  5JIY A;  3DAL A;  3M5A A;  5CCL A;  5ARG A;  5F5E A;  5TEG A;  3KMA A;  3QWW A;  4RZ0 A; 
#chains in the Genus database with same CATH homology
 3RAY A;  3HNA A;  3OPE A;  5TH7 A;  5KJN A;  5HI7 A;  3MO0 A;  3M56 A;  1MVH A;  1N3J A;  5KJM A;  3M57 A;  2IGQ A;  1XQH A;  3CBP A;  3M58 A;  5EG2 A;  1MVX A;  4YND A;  3M59 A;  4YPA A;  3M55 A;  1MUF A;  3TG5 A;  5KJL A;  3QWP A;  3VUZ A;  5F59 A;  3F9W A;  5LSZ A;  3EP0 A;  5ARF A;  5F6L A;  1PEG A;  5JIN A;  3RQ4 A;  1MT6 A;  4AU7 A;  4C1Q A;  4O30 A;  3M54 A;  5T5G A;  2F69 A;  4IJ8 A;  3F9Y A;  1ML9 A;  3M53 A;  4NJ5 A;  4O6F A;  3F9Z A;  5T0K A;  5T0M A;  5JHN A;  3QWV A;  4QEN A;  3BO5 A;  2O8J A;  5KJK A;  3FPD A;  4QEP A;  1N6A A;  3S7J A;  4YNP A;  3OS5 A;  2RFI A;  3CBO A;  4YPU A;  5F6K C;  1ZKK A;  2W5Y A;  3SWC A;  5AYF A;  3PDN A;  2BQZ A;  4MI0 A;  4QEO A;  3S7B A;  4I51 A;  4H12 A;  4WUY A;  2QPW A;  4BUP A;  4Z4P A;  3OXL A;  1N6C A;  2G46 A;  4J8O A;  3N71 A;  3OXF A;  3RIB A;  5HQ8 A;  4E47 A;  5JJ0 A;  4JDS A;  4IJD A;  3K5K A;  4J83 A;  3KMJ A;  3CBM A;  3OOI A;  3SW9 A;  3KMT A;  5CPR B;  4MI5 A;  4J7I A;  4YPE A;  2W5Z A;  5LSX A;  2JV0 A;  3IHX A;  4JLG A;  3RU0 A;  3DB5 A;  5EX3 A;  3F9X A;  3OXG A;  4LDG A;  4J7F A;  3TG4 A;  5EX0 A;  3MO5 A;  5CCM A;  2R3A A;  3RJW A;  3MO2 A;  5TTF A;  3S8P A;  3MEK A;  1O9S A;  3S7F A;  4YNM A;  4NVQ A;  4FMU A;  3VV0 A;  3S7D A;  1H3I A;  5JIY A;  3DAL A;  3M5A A;  5CCL A;  5ARG A;  5F5E A;  5TEG A;  3KMA A;  3QWW A;  4RZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...