3F9ZA

Structural insights into lysine multiple methylation by set domain methyltransferases, set8-y245f / h4-lys20 / adohcy
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
160
structure length
156
Chain Sequence
KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEFHGDLIEITDAKKREALYATGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SETD8
publication title Structural origins for the product specificity of SET domain protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 156
sequence length 160
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3f9zA00
5ARFA 5ARGA 5JJ0A 3SW9A 1MT6A 1ML9A 5KJNA 3HNAA 2JV0A 4IJDA 4YNMA 4O6FA 3FPDA 3KMJA 4FMUA 3RJWA 3M56A 2W5YA 3S7DA 1ZKKA 3F9ZA 3EP0A 5CPRB 5EX0A 3M5AA 3S8PA 3F9WA 5EX3A 4BUPA 3M58A 5AYFA 4YPUA 5F5EA 3QWWA 2IGQA 3RU0A 3F9YA 4JDSA 5F6LA 4MI0A 5T5GA 4MI5A 2BQZA 4NVQA 3QWVA 3K5KA 4IJ8A 3QWPA 4NJ5A 3VV0A 1N6AA 5TEGA 3TG4A 3MO0A 4QEPA 4J7FA 1MVHA 5LSZA 3M59A 2QPWA 5CCMA 3OPEA 5HI7A 5TH7A 3S7FA 3MO5A 1N6CA 4YNPA 5F59A 3KMAA 3RQ4A 5KJMA 5JIYA 1H3IA 1XQHA 4QENA 5CCLA 4JLGA 3S7JA 4H12A 3KMTA 4I51A 3F9XA 3M57A 2G46A 3CBPA 2R3AA 3MEKA 4C1QA 4QEOA 4YPAA 5KJKA 4LDGA 5LSXA 4AU7A 4O30A 3OS5A 4Z4PA 1N3JA 4WUYA 2O8JA 3MO2A 3PDNA 4J83A 3M53A 3OXLA 3RIBA 3CBOA 4J7IA 3S7BA 5HQ8A 4YPEA 3BO5A 5TTFA 1O9SA 3N71A 2F69A 1PEGA 3DB5A 3M55A 3IHXA 1MUFA 3RAYA 5T0KA 4J8OA 3CBMA 4YNDA 5KJLA 3VUZA 5EG2A 5JHNA 4E47A 3OXFA 5JINA 3SWCA 3TG5A 2RFIA 3OXGA 3OOIA 1MVXA 3DALA 5F6KC 5T0MA 4RZ0A 3M54A 2W5ZA
chains in the Genus database with same CATH superfamily
5ARFA 5ARGA 5JJ0A 3SW9A 1MT6A 1ML9A 5KJNA 3HNAA 2JV0A 4IJDA 4YNMA 4O6FA 3FPDA 3KMJA 4FMUA 3RJWA 3M56A 2W5YA 3S7DA 1ZKKA 3F9ZA 3EP0A 5CPRB 5EX0A 3M5AA 3S8PA 3F9WA 5EX3A 4BUPA 3M58A 5AYFA 4YPUA 5F5EA 3QWWA 2IGQA 3RU0A 3F9YA 4JDSA 5F6LA 4MI0A 5T5GA 4MI5A 2BQZA 4NVQA 3QWVA 3K5KA 4IJ8A 3QWPA 4NJ5A 3VV0A 1N6AA 5TEGA 3TG4A 3MO0A 4QEPA 4J7FA 1MVHA 5LSZA 3M59A 2QPWA 5CCMA 3OPEA 5HI7A 5TH7A 3S7FA 3MO5A 1N6CA 4YNPA 5F59A 3KMAA 3RQ4A 5KJMA 5JIYA 1H3IA 1XQHA 4QENA 5CCLA 4JLGA 3S7JA 4H12A 3KMTA 4I51A 3F9XA 3M57A 2G46A 3CBPA 2R3AA 3MEKA 4C1QA 4QEOA 4YPAA 5KJKA 4LDGA 5LSXA 4AU7A 4O30A 3OS5A 4Z4PA 1N3JA 4WUYA 2O8JA 3MO2A 3PDNA 4J83A 3M53A 3OXLA 3RIBA 3CBOA 4J7IA 3S7BA 5HQ8A 4YPEA 3BO5A 5TTFA 1O9SA 3N71A 2F69A 1PEGA 3DB5A 3M55A 3IHXA 1MUFA 3RAYA 5T0KA 4J8OA 3CBMA 4YNDA 5KJLA 3VUZA 5EG2A 5JHNA 4E47A 3OXFA 5JINA 3SWCA 3TG5A 2RFIA 3OXGA 3OOIA 1MVXA 3DALA 5F6KC 5T0MA 4RZ0A 3M54A 2W5ZA
chains in the Genus database with same CATH topology
5ARFA 5ARGA 5JJ0A 3SW9A 1MT6A 1ML9A 5KJNA 3HNAA 2JV0A 4IJDA 4YNMA 4O6FA 3FPDA 3KMJA 4FMUA 3RJWA 3M56A 2W5YA 3S7DA 1ZKKA 3F9ZA 3EP0A 5CPRB 5EX0A 3M5AA 3S8PA 3F9WA 5EX3A 4BUPA 3M58A 5AYFA 4YPUA 5F5EA 3QWWA 2IGQA 3RU0A 3F9YA 4JDSA 5F6LA 4MI0A 5T5GA 4MI5A 2BQZA 4NVQA 3QWVA 3K5KA 4IJ8A 3QWPA 4NJ5A 3VV0A 1N6AA 5TEGA 3TG4A 3MO0A 4QEPA 4J7FA 1MVHA 5LSZA 3M59A 2QPWA 5CCMA 3OPEA 5HI7A 5TH7A 3S7FA 3MO5A 1N6CA 4YNPA 5F59A 3KMAA 3RQ4A 5KJMA 5JIYA 1H3IA 1XQHA 4QENA 5CCLA 4JLGA 3S7JA 4H12A 3KMTA 4I51A 3F9XA 3M57A 2G46A 3CBPA 2R3AA 3MEKA 4C1QA 4QEOA 4YPAA 5KJKA 4LDGA 5LSXA 4AU7A 4O30A 3OS5A 4Z4PA 1N3JA 4WUYA 2O8JA 3MO2A 3PDNA 4J83A 3M53A 3OXLA 3RIBA 3CBOA 4J7IA 3S7BA 5HQ8A 4YPEA 3BO5A 5TTFA 1O9SA 3N71A 2F69A 1PEGA 3DB5A 3M55A 3IHXA 1MUFA 3RAYA 5T0KA 4J8OA 3CBMA 4YNDA 5KJLA 3VUZA 5EG2A 5JHNA 4E47A 3OXFA 5JINA 3SWCA 3TG5A 2RFIA 3OXGA 3OOIA 1MVXA 3DALA 5F6KC 5T0MA 4RZ0A 3M54A 2W5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ARF A;  5ARG A;  5JJ0 A;  3SW9 A;  1MT6 A;  1ML9 A;  5KJN A;  3HNA A;  2JV0 A;  4IJD A;  4YNM A;  4O6F A;  3FPD A;  3KMJ A;  4FMU A;  3RJW A;  3M56 A;  2W5Y A;  3S7D A;  1ZKK A;  3F9Z A;  3EP0 A;  5CPR B;  5EX0 A;  3M5A A;  3S8P A;  3F9W A;  5EX3 A;  4BUP A;  3M58 A;  5AYF A;  4YPU A;  5F5E A;  3QWW A;  2IGQ A;  3RU0 A;  3F9Y A;  4JDS A;  5F6L A;  4MI0 A;  5T5G A;  4MI5 A;  2BQZ A;  4NVQ A;  3QWV A;  3K5K A;  4IJ8 A;  3QWP A;  4NJ5 A;  3VV0 A;  1N6A A;  5TEG A;  3TG4 A;  3MO0 A;  4QEP A;  4J7F A;  1MVH A;  5LSZ A;  3M59 A;  2QPW A;  5CCM A;  3OPE A;  5HI7 A;  5TH7 A;  3S7F A;  3MO5 A;  1N6C A;  4YNP A;  5F59 A;  3KMA A;  3RQ4 A;  5KJM A;  5JIY A;  1H3I A;  1XQH A;  4QEN A;  5CCL A;  4JLG A;  3S7J A;  4H12 A;  3KMT A;  4I51 A;  3F9X A;  3M57 A;  2G46 A;  3CBP A;  2R3A A;  3MEK A;  4C1Q A;  4QEO A;  4YPA A;  5KJK A;  4LDG A;  5LSX A;  4AU7 A;  4O30 A;  3OS5 A;  4Z4P A;  1N3J A;  4WUY A;  2O8J A;  3MO2 A;  3PDN A;  4J83 A;  3M53 A;  3OXL A;  3RIB A;  3CBO A;  4J7I A;  3S7B A;  5HQ8 A;  4YPE A;  3BO5 A;  5TTF A;  1O9S A;  3N71 A;  2F69 A;  1PEG A;  3DB5 A;  3M55 A;  3IHX A;  1MUF A;  3RAY A;  5T0K A;  4J8O A;  3CBM A;  4YND A;  5KJL A;  3VUZ A;  5EG2 A;  5JHN A;  4E47 A;  3OXF A;  5JIN A;  3SWC A;  3TG5 A;  2RFI A;  3OXG A;  3OOI A;  1MVX A;  3DAL A;  5F6K C;  5T0M A;  4RZ0 A;  3M54 A;  2W5Z A; 
#chains in the Genus database with same CATH topology
 5ARF A;  5ARG A;  5JJ0 A;  3SW9 A;  1MT6 A;  1ML9 A;  5KJN A;  3HNA A;  2JV0 A;  4IJD A;  4YNM A;  4O6F A;  3FPD A;  3KMJ A;  4FMU A;  3RJW A;  3M56 A;  2W5Y A;  3S7D A;  1ZKK A;  3F9Z A;  3EP0 A;  5CPR B;  5EX0 A;  3M5A A;  3S8P A;  3F9W A;  5EX3 A;  4BUP A;  3M58 A;  5AYF A;  4YPU A;  5F5E A;  3QWW A;  2IGQ A;  3RU0 A;  3F9Y A;  4JDS A;  5F6L A;  4MI0 A;  5T5G A;  4MI5 A;  2BQZ A;  4NVQ A;  3QWV A;  3K5K A;  4IJ8 A;  3QWP A;  4NJ5 A;  3VV0 A;  1N6A A;  5TEG A;  3TG4 A;  3MO0 A;  4QEP A;  4J7F A;  1MVH A;  5LSZ A;  3M59 A;  2QPW A;  5CCM A;  3OPE A;  5HI7 A;  5TH7 A;  3S7F A;  3MO5 A;  1N6C A;  4YNP A;  5F59 A;  3KMA A;  3RQ4 A;  5KJM A;  5JIY A;  1H3I A;  1XQH A;  4QEN A;  5CCL A;  4JLG A;  3S7J A;  4H12 A;  3KMT A;  4I51 A;  3F9X A;  3M57 A;  2G46 A;  3CBP A;  2R3A A;  3MEK A;  4C1Q A;  4QEO A;  4YPA A;  5KJK A;  4LDG A;  5LSX A;  4AU7 A;  4O30 A;  3OS5 A;  4Z4P A;  1N3J A;  4WUY A;  2O8J A;  3MO2 A;  3PDN A;  4J83 A;  3M53 A;  3OXL A;  3RIB A;  3CBO A;  4J7I A;  3S7B A;  5HQ8 A;  4YPE A;  3BO5 A;  5TTF A;  1O9S A;  3N71 A;  2F69 A;  1PEG A;  3DB5 A;  3M55 A;  3IHX A;  1MUF A;  3RAY A;  5T0K A;  4J8O A;  3CBM A;  4YND A;  5KJL A;  3VUZ A;  5EG2 A;  5JHN A;  4E47 A;  3OXF A;  5JIN A;  3SWC A;  3TG5 A;  2RFI A;  3OXG A;  3OOI A;  1MVX A;  3DAL A;  5F6K C;  5T0M A;  4RZ0 A;  3M54 A;  2W5Z A; 
#chains in the Genus database with same CATH homology
 5ARF A;  5ARG A;  5JJ0 A;  3SW9 A;  1MT6 A;  1ML9 A;  5KJN A;  3HNA A;  2JV0 A;  4IJD A;  4YNM A;  4O6F A;  3FPD A;  3KMJ A;  4FMU A;  3RJW A;  3M56 A;  2W5Y A;  3S7D A;  1ZKK A;  3F9Z A;  3EP0 A;  5CPR B;  5EX0 A;  3M5A A;  3S8P A;  3F9W A;  5EX3 A;  4BUP A;  3M58 A;  5AYF A;  4YPU A;  5F5E A;  3QWW A;  2IGQ A;  3RU0 A;  3F9Y A;  4JDS A;  5F6L A;  4MI0 A;  5T5G A;  4MI5 A;  2BQZ A;  4NVQ A;  3QWV A;  3K5K A;  4IJ8 A;  3QWP A;  4NJ5 A;  3VV0 A;  1N6A A;  5TEG A;  3TG4 A;  3MO0 A;  4QEP A;  4J7F A;  1MVH A;  5LSZ A;  3M59 A;  2QPW A;  5CCM A;  3OPE A;  5HI7 A;  5TH7 A;  3S7F A;  3MO5 A;  1N6C A;  4YNP A;  5F59 A;  3KMA A;  3RQ4 A;  5KJM A;  5JIY A;  1H3I A;  1XQH A;  4QEN A;  5CCL A;  4JLG A;  3S7J A;  4H12 A;  3KMT A;  4I51 A;  3F9X A;  3M57 A;  2G46 A;  3CBP A;  2R3A A;  3MEK A;  4C1Q A;  4QEO A;  4YPA A;  5KJK A;  4LDG A;  5LSX A;  4AU7 A;  4O30 A;  3OS5 A;  4Z4P A;  1N3J A;  4WUY A;  2O8J A;  3MO2 A;  3PDN A;  4J83 A;  3M53 A;  3OXL A;  3RIB A;  3CBO A;  4J7I A;  3S7B A;  5HQ8 A;  4YPE A;  3BO5 A;  5TTF A;  1O9S A;  3N71 A;  2F69 A;  1PEG A;  3DB5 A;  3M55 A;  3IHX A;  1MUF A;  3RAY A;  5T0K A;  4J8O A;  3CBM A;  4YND A;  5KJL A;  3VUZ A;  5EG2 A;  5JHN A;  4E47 A;  3OXF A;  5JIN A;  3SWC A;  3TG5 A;  2RFI A;  3OXG A;  3OOI A;  1MVX A;  3DAL A;  5F6K C;  5T0M A;  4RZ0 A;  3M54 A;  2W5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...