3QWWA

Crystal structure of histone lysine methyltransferase smyd2 in complex with the methyltransferase inhibitor sinefungin
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
430
structure length
430
Chain Sequence
AEARGGLERFCSAGKGRGLRALRPFHVGDLLFSCPAYACVLTVGERGHHCECCFARKEGLSKCGRCKQAFYCDVECQKEDWPLHKLECSSMVVLGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVREFESHLDKLDNEKKDLIQSDIAALHQFYSKYLEFPDHSSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGDEVFTSYIDLLYPTEDRNDRLRDSYFFTCECRECTTKDKDKAKVEVRKLSSPPQAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALKYGQKIIKPYSKHYPVYSLNVASMWLKLGRLYMGLENKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords SET and MYND domain-containing protein 2
publication title Crystal structures of histone and p53 methyltransferase SmyD2 reveal a conformational flexibility of the autoinhibitory C-terminal domain.
pubmed doi rcsb
source organism Mus musculus
total genus 150
structure length 430
sequence length 430
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3qwwA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3qwwA01
2XGSA 4XI9A 5C1DA 5G04J 5G04C 4J0UA 3LY9A 5A7DB 3F9ZA 4GA2A 3CEQA 4WNGA 2XGMA 4GYOA 4U0ZA 4AY6A 4EQFA 2ONDA 4RG9A 3LKUA 4CGVA 1ZKKA 3CKBA 3RJWA 3GZ2A 4NRHB 3ASGA 3BEEA 4ABNA 4G24A 4QEPA 2NC9A 5JJ0A 2LNIA 4O6FA 3CV0A 1HH8A 4YNMA 4GZ3A 3TAXA 3FPDA 1XNFA 4E47A 3PDNA 3Q47B 5DBKA 4N3CA 4WUYA 3GZ1A 4U0UA 3M57A 4GYWA 2V5FA 1B89A 4CGWA 1WAO1 3U3WA 1FCHA 3LY8A 5HQ8A 2IGQA 2KCLA 5BT1A 2P58C 3RKVA 5JJ6A 4N2SA 4I9EA 4C1QA 3Q4AB 3RQ4A 3S8PA 5TEGA 3KMJA 3NF1A 4J8EA 3SWCA 5KJKA 5FJYA 2KCVA 5FZQA 2VQ2A 4UQXA 3S7BA 4J8OA 2VSNA 5KJMA 3F9WA 4N3AA 3RO2A 1KLXA 4KXKB 2R5SA 4BTBA 4JHRA 5EX0A 3ASDA 3QWVA 4QEOA 3FP3A 3VV0A 1N6CA 2GW1A 4YPEA 1KT1A 3U4TA 3MV2B 2O8JA 4I2WA 3ASFA 4JA9A 2KCKA 2RFIA 4G25A 4BT9A 5EG2A 3ZGQA 3QOUA 3M53A 4AY5A 3TG4A 4WNDA 5FZRA 4BT8A 4AM9A 4APOA 5BNWA 3Q15A 2IFUA 3K9IA 2BQZA 1NA3A 4GA0A 4GZ5A 3CKCA 3WXXA 2FEZA 3UQ3A 2FO7A 4LEUA 1HXIA 3FWVA 5EKQD 1ZU2A 4UI9K 3KMAA 2Y4UA 5ARGA 3KAEA 3QDNA 3M58A 3TGOA 4J8DA 3VTXA 4AIFA 2VYIA 3LPZA 2R3AA 1QQEA 1TJCA 3PE4A 4G26A 5F5EA 3SF4A 2VGYA 1N6AA 3CK7A 5AYWD 4QENA 1PEGA 1NA0A 5F59A 1W3BA 2FF4A 5G05C 3RJVA 5T5GA 3RU0A 5T0KA 5EX3A 2Y4TA 5HI7A 3IHXA 4A1SA 3VTYA 2HR2A 3M54A 4I2ZA 1MT6A 2WPVA 4U07A 4HOTA 3DALA 2VGXA 3CVQA 3RIBA 3F9XA 3BO5A 3OPEA 2C0LA 4HOUA 3MKRA 2UY1A 3E4BA 4H7XA 2MHKA 2PQNA 3CVPA 3KS2A 2XGOA 3ZPJA 3OOIA 4YNDA 4UQYA 5A6CA 2XCCA 5JJ7A 2KATA 3ASHA 3OS5A 4U0SA 3S7JA 1YA0A 2Q7FA 2WQHA 4JDSA 2BUGA 4HOSA 2FI7A 5M72A 2VGXB 2C2LA 4NQ0A 4BUPA 4GZ6A 3CBPA 4N2QA 4RG6A 3ZN3A 2QFCA 2YQ8A 3CVLA 4IJ8A 4Y6CA 4WNFA 1E96B 4XI0A 3CK8A 2UY1B 4F3VA 4JLGA 1O9SA 4LDGA 4UI9J 2UWJG 4UI9C 3AS5A 2G46A 4H7YA 3MO0A 3UPVA 4CDRA 1ZBPA 3CBOA 5CCLA 2PQRA 4N3BA 1IYGA 1ML9A 5CCMA 4J8FA 4AU7A 5FT9A 5ARFA 3ESKA 3RAYA 3R9AB 1A17A 1MUFA 3N71A 4YVOA 5D0QD 3M55A 1ELWA 3CVNA 3EDTB 4KBQA 3MEKA 5DIZA 3CK9A 4G1TA 5F6KC 4I9CA 3M59A 3ZHEA 3SZ7A 5TTFA 2DBAA 3PE3A 4UQZA 3LCAA 5CHEE 4BTAA 5JIYA 3MO5A 1OUVA 1NZNA 2XEVA 4WNEA 3MO2A 3HYMB 1ELRA 2KC7A 2JLBA 2XCBA 1HZ4A 1MVXA 5TH7A 1KT0A 4I1AA 3ZHEB 5G05J 5FZSA 2LSVA 4ME2A 3K5KA 2LSUA 4GCOA 2I6HA 2JV0A 4J83A 4Z4PA 3JYSA 4MI5A 2AVPA 4J7FA 3KD7A 3GW4A 3S7FA 1XQHA 5KJNA 2XPIA 5KJLA 4JL0A 3RO3A 4Y6WA 5AYFA 5JHNA 3URZA 4BWRA 3TG5A 3VUZA 3OXGA 5CPRB 3AS8A 4GCNA 2L6JA 2F69A 1H3IA 3QWWA 4N5CA 1Y8MA 4G2VA 3M5AA 3M56A 2IF4A 4J7IA 3Q5MA 3O48A 2J9QA 3LY7A 2PL2A 4IN3B 3HNAA 3GYZA 3IEGA 4KYOB 5LSZA 4JA7A 3KMTA 2C0MA 3QWPA 3F9YA 4I17A 1QZ2A 4IJDA 3FFLA 4NJ5A 2OOEA 4FMUA 1PC2A 4W9RA 5D0OD 4GA1A 4O30A 5JJTA 2QPWA 3OXFA 2W5YA 2E2EA 5F6LA 3DB5A 4YVQC 4GYYA 3SW9A 5JINA 3MA5A 4G23A 3ULQA 4YNPA 1WM5A 4YPUA 4HOQA 3CBMA 3QKYA 2HYZA 4MI0A 3EP0A 4HORA 4XIFA 4U04A 2W5ZA 4RZ0A 5LSXA 5T0MA 2HO1A 2VSYA 5BW8C 3AS4A 4GPKA 4B94A 2YHCA 3Q49B 3OXLA 3S7DA 2FBNA 4I51A 5LCWJ 5LCWC 1IHGA 1P5QA 4H12A 4YPAA 3MV3B 1MVHA 1N3JA 4NVQA 3LYAA 5FTPA 4N39A 3ZFWA 2PZIA 3UUXA
chains in the Genus database with same CATH superfamily
5G04J 2OEWA 5G04C 2IJGX 4DUIA 3ULEG 4HRLA 4M3OA 3MJWA 1MHQA 4WNGA 2XGMA 2L0IA 2ONDA 5T4YA 3RJWA 3GZ2A 4NRHB 4JEUA 1TNUA 2ZGDA 3BEEA 4G24A 3C98A 3TWRA 5B1BE 3T9KA 5DBKA 4WUYA 3LDZA 2LAIA 4HFGA 4U0UA 1OWNA 4GYWA 1L5JA 4B8AA 1MX4A 3TXNA 3CVYA 2QYJA 4G8KA 1JCSA 1QYMA 5BT1A 2P58C 3D9PA 3RKVA 2F37A 4JC8A 4L2YA 4U7EB 3S8PA 3E32A 3G2WA 4O60A 3SWCA 3LVQE 3FUDA 2VQ2A 3S7BA 4GMJA 3MCXA 4GPMA 2RD0A 1N0RA 3TWQA 4GZCA 4BTBA 4JHJA 2WXMA 3ASDA 3QWVA 3FP3A 3UX4A 3PH0C 3FUEA 3MV2B 2O8JA 4JA9A 5ENNA 4G25A 1OT8A 3G2UA 4A3TA 1NP7A 4BT9A 5EG2A 3ZGQA 4AY5A 3BU8A 3DXKG 5FZRA 5BNWA 1SZ9A 4HLEA 1NA3A 3B7BA 3E37A 3SD5A 3E33A 1OWLA 2IO2C 1JCQA 3CKCA 3QK0A 1EDUA 2DZOA 3CHPA 3UQ3A 2FO7A 2V4HC 1HXIA 1HO8A 4CEMA 3KMAA 3LJNA 3ZEFA 1V55E 1D9SA 3KAEA 3TGOA 2EILE 4OAVB 4AIFA 3O4ZA 4N5QA 3L17A 2P9NG 4PDXA 5JA4D 2WXIA 3CK7A 5AYWD 3MGBA 1IQRA 1E8ZA 1NA0A 3V2XA 3MZLB 1W3BA 1QBQA 5T5GA 1BI7B 1E90A 4E6HA 2I1KA 4U95D 5B1AE 3EU5A 4I2ZA 4YDEA 1FPPA 4U07A 2I1JA 3JUEA 3RIBA 4ANUA 3BO5A 3OPEA 3FUNA 2UY1A 3QB2A 4HI8A 2OVBA 5A6CA 2XCCA 2KATA 2WXKA 4EHMA 4WWNA 3EUVA 2ETCA 3OS5A 5JHAA 4U0SA 2HM8A 1DNPA 4HRMB 3L13A 5ENQD 5B3SE 4EBAG 4BETA 5J08A 4BUPA 4GZ6A 3RRNB 3APFA 3L9TA 4I1OB 4XI0A 3CK8A 5HRYA 4LG6A 4DI4A 4JLGA 1HG5A 4TXPA 4H7YA 4BFRA 2IOSA 1LTXA 3CBOA 4MKTA 4KMOA 4N3BA 1IYGA 4L7TA 5CCMA 4J8FA 5FT9A 5ARFA 4LSZE 1A17A 1MUFA 2GROB 3HG0D 1WDYA 1Y6IA 2XRYA 3FTYA 2WQ7A 4KBQA 5C2YA 3NZSA 5A23A 4I9CA 2V4LA 4OVUA 4B89A 3FHEA 4TUUA 3PE3A 2H6GA 4CZ2D 3MO5A 3IXEA 4TUMA 2GRPB 4OYSA 3HYMB 2KC7A 4U96D 4AV7A 1MVXA 4FU3A 3ZIMA 2DIWA 3FUHA 5G05J 1H0AA 3JYSA 2AVPA 3KD7A 1E7UA 1H19A 1TN8A 4GB9A 1XQHA 3QNKA 2P9SG 5AYFA 2VSOE 3U9WA 3TG5A 3RSEG 4JVSA 2WXLA 3D9JA 3OXGA 3NOCD 3ZXPA 2RFMA 4N5CA 3M56A 4IRUA 2F0YA 2BF0X 2PL2A 4IN3B 3FH5A 3GYZA 3FTZA 3FUIA 3KMTA 2C0MA 3QWPA 2WVIA 5FQ8A 3PNTB 4G11A 3T5XA 1PC2A 3VLEA 3LVRE 4URKA 5IY5E 3DB5A 1TN6A 3QC1A 5JHBA 3PZ3A 3NZUA 2WXNA 4YPUA 3EP0A 1JPLA 4XIFA 2W5ZA 4RZ0A 1OCCE 2EQXA 3PEUB 5T0MA 4C48B 3HDXA 2P9PG 4GPKA 4ZFHA 2YHCA 1Z6TA 3OXLA 3BQOA 2FBNA 1FVFA 4RVBA 4YDYA 3AG1E 3TWXA 4WWPA 3U66A 1N3JA 4NVQA 5FTPA 1KZOA 5EYLA 3ZFWA 2LUHA 3E30A 3JXIA 1SA5A 1K8KG 5CRUA 2A5EA 1E8YA 2M63A 4J0UA 3LY9A 5AN8A 5A7DB 4RLYA 4GA2A 1PAQA 3CEQA 4BEPA 5AARA 1MX2A 4EQFA 4RG9A 1LF8A 3LKUA 1N0QA 4JD2G 3CKBA 4JZYA 3I5PA 3ASGA 3J5PA 3DEPA 2JEKA 3IBEA 2LNIA 4O6FA 3CV0A 1IXVA 1DC2A 3FPDA 3UIOC 5AAOA 3SFXA 3Q47B 1X81A 1DCEA 3CLJA 3ABME 2YNQA 4ANXA 2X6IA 3KEZA 1WAO1 4QQIA 3LY8A 3Q7AA 5HQ8A 2IGQA 4I6EA 3OTNA 4UWGA 5JJ6A 4N2SA 4C1QA 3CSFA 2P9KG 4M7CA 5TEGA 5FQ4A 4J8EA 5KNHD 5KJKA 3NQPA 5FZQA 4UQXA 1TN7A 4GTQA 1H2VC 3F9WA 1KLXA 1MX6A 3I4RB 4X8QA 3SBSA 2DWZA 3DXMG 4PS3A 4GTSA 3ZYLA 4UWLA 5KBAA 4J8YA 4ATZD 3VV0A 3EHQA 1N6CA 2Y3AA 2PM6A 4HRNA 3IKOB 3CVUA 2ZISA 2RFIA 4WWOA 4FJYA 4YDOA 3QOUA 3CHRA 2X3MA 4WNDA 3SY2A 1Q2ZA 4AM9A 4APOA 3HHMA 4JPSA 3Q15A 3HXFA 1U3CA 3L6AA 4LNUD 1NI1A 2HE0A 4U8HA 2EIKE 2FEZA 1O1SA 2IOLA 2Y1LE 3TJPA 2WXPA 5T3RA 2WB2A 1ZU2A 1IHBA 2Y4UA 4DX7D 3Q7FA 3HRAA 1UN8A 3QDNA 5BXUA 4AOFA 4J8DA 2LXLA 2A4ZA 1S0PA 2VYIA 2B0OE 3ABLE 3CGHA 3I3NA 1QQEA 1OCRE 2NXPA 2J4DA 3SF4A 4BSXA 2VGYA 3LJ3A 3T8MA 5BV1A 3S2AA 2R03A 2FF4A 3DBSA 3RJVA 3RU0A 4YDWA 2I9CA 5T0KA 2WXFA 5EX3A 2I2OA 5HI7A 4A1SA 1K1BA 3TWTA 3GZSA 3M54A 1MT6A 1N52A 4CDNA 2WPVA 4HNAD 2MOWA 2VGXA 1N4QA 3F9XA 3MKQA 3C3QA 1TR4A 3CHQA 2GGFA 4EBAA 3E4BA 4H7XA 2MHKA 2PQNA 4C0EA 1YMPA 2XGOA 3KS2A 4YNDA 4UQYA 3UINC 2BTDA 4ANVA 1YA0A 2Q7FA 4LERA 5H7PA 2XEEA 4JDSA 3ZRHA 5LFAA 3FTWA 2BUGA 5M72A 1SVXA 4N2QA 2QFCA 3OAWA 2WXHA 4Y6CA 2J49A 5CMWA 4D10C 2UY1B 3HXEA 3AS5A 2G46A 4XKCA 4AU7A 2CFZA 3ESKA 4LNBA 5KCMA 3JQ1A 1BU9A 1S64A 1ELWA 2V0PA 3D9HA 4U63A 4JEHA 4FP7A 5DIZA 2QY7A 2OCCE 3CK9A 1MQSA 3TXMA 1K1AA 3D3MA 4IULA 5AQ7A 4K5AB 1RW2A 4J7WA 4FHKA 3PZ1A 2DBAA 5AQ9A 4UQZA 3LCAA 5CHEE 2CG3A 1N11A 2KBXA 2XRZA 1N94A 1NZNA 3ZU7B 3Q79A 1OXJA 2XEVA 3CHMA 3MO2A 5G2NA 2JLBA 4F1SA 3FTVA 3L16A 4XE0A 2R05A 4O1PA 4HS2A 5TH7A 3C3OA 4ME2A 2L6BA 2LSUA 4J83A 4Z4PA 4KVOA 3V2OA 1SZAA 1JWFA 3FU6A 2NSZA 2J8SD 3D9MA 3S7FA 4L9PA 1O1RA 3SNXA 3QJZA 3DSSA 4DX1A 4XKBA 3UXGA 4DLOA 4JL0A 4UWHA 3RO3A 4MBGA 4F53A 3PRZA 3URZA 4KZ0A 3VUZA 3UKRG 1UJKA 3TWVA 5BV0A 3AS8A 4GCNA 5D66A 1H3IA 4U8VD 1HE8A 1Y8MA 4CRWA 1HU3A 2J9QA 3ZYMA 1HX8A 3SHFA 4JA7A 3UT8A 5KWDA 3LEWA 3B7UX 4FMUA 5D0OD 2XZTG 5JJTA 1D8EA 2W5YA 2E2EA 5F6LA 1HFAA 3PVLA 3FEXA 3MA5A 3ULQA 4I1MA 4MI0A 4HORA 3TL5A 5LSXA 5EIBE 4JB8P 3B13A 3L08A 2J09A 4FA6A 1RZ4A 3HXDA 2HO1A 2VSYA 3PS6A 4DX5D 4LRZA 3EHRA 5LCWJ 5LCWC 1IHGA 2DYSE 2ZXWE 1H2UA 2EIJE 1MVHA 3FH7A 4C0MA 2ZIRA 3LYAA 2H6IA 4N39A 4DX6D 5EDSA 2PZIA 1UOHA 3E34A 2WXQA 4GTMA 2XGSA 4TXQA 5C1DA 3B95A 2E0IA 3FUJA 1H2TC 5LX8A 2CHWA 3F9ZA 3ENEA 4GTTA 2ILRA 4GYOA 4U0ZA 4AY6A 4NURA 4CGVA 3C3RA 5CERB 1ZKKA 2L9BA 2QZAA 1D8DA 3AAAC 2GRMA 4ILIA 4ABNA 4QEPA 1EF1C 3R7QA 3AG4E 1BD8A 2XS1A 4FC8A 2KM4A 1QNFA 3TAXA 5EILA 3W9GA 2ETAA 4PS8A 4N3CA 2L0TB 1UG3A 2V5FA 5FQ7A 1B89A 4CGWA 4CYMD 2VSXE 1FT1A 3X2QE 3U3WA 1FCHA 2KCLA 4OAUC 3UT4A 3FEYA 2DYRE 4I9EA 1HS6A 2R17C 3Q4AB 3AG3E 1TNYA 2FULA 5ANLA 3KMJA 3V30A 3NF1A 2KCVA 3UIPC 4ATGA 2CHZA 1OWOA 4J8OA 5KJMA 4RQIA 4N3AA 4KXKB 2R5SA 2IONA 2RG8A 4JXTA 3ASOE 5EX0A 1E7VA 2GW1A 5AIJA 4PS7A 4APFA 2VJ8A 4E85A 2BEDA 1KT1A 3U4TA 5JMND 3ASFA 3UKUG 3R7RA 4B8CB 5EN5D 4GMRA 4GTOA 3B7RL 5ENRD 3ZVVA 3HIZA 2BQZA 4GA0A 1JWGA 3FY4A 4Z68A 1MJ0A 5ANRA 1TYQG 2ZGGA 1OWMA 1V54E 4Q96A 3FWVA 2XQ0A 3EHNA 1UN9A 4UI9K 3FTSA 3UI2A 5AQBA 5ARGA 4UUCA 3M58A 2XZDG 2J07A 3P2BA 2ZU6B 2AXVA 5FWQA 1OCOE 4NIKA 4CT4A 2H6HA 4I43A 1TJCA 4G26A 3EHMA 3TWUA 2XS8A 4QENA 1PEGA 4HB5A 3P1UA 4GU5A 3IV0A 1O5MA 3ML8A 3JCKC 3Q73A 3DSVA 3ZYKA 3L54A 4ACKA 3J5QB 2AXUA 2HR2A 4WAFA 3ZNGA 3PZ2A 4TV3A 1SQMA 3DALA 2KZTA 3DRAA 3MKRA 4JHKA 3CVPA 3ZPJA 3OOIA 3BG0B 5JJ7A 2R2LA 3ASHA 3RAUA 4K5CA 4HI9A 4ILGA 4GTPA 5AJDA 3FU3A 2FI7A 2VGXB 4NQ0A 3IHYA 3ZN3A 3MKQB 4DJAA 2CHXA 3CQCB 1E96B 2B6CA 3L22A 3NAWA 4B0ZA 5CBOA 3CHOA 3ONKA 4KZCA 1O9SA 4LDGA 1IQUA 3VLFA 3D9IA 3BUAA 5CCLA 2PQRA 4BSZB 2X38A 2X6JA 1ML9A 3R9AB 3VLDA 3EDTB 3B7TA 2XENA 3ML9A 3CHSA 3R9MA 2QC9A 4G1TA 1E8WA 2IU1A 3M59A 1TEZA 3ZHEA 4BX8A 2NYJA 5TTFA 1X5BA 4DRXE 1H6OA 1KPSB 4BTAA 3ZXSA 4F6RD 2DCPA 3UM1A 5JIYA 5CEDB 4I6JA 3Q75A 4FJZA 3U64A 2P9IG 1ELRA 3RK6A 3AG2E 1HZ4A 3EIJA 4OVVA 3CQGB 2QYUA 3CIAA 1Z5SC 1KT0A 3DPYA 2X6KA 4Q94A 5FZSA 3FUKA 3L82A 2JV0A 2WXRA 2XPZA 4LNGA 4J6IA 4J7FA 2RFAA 1JCRA 4CDMA 4F1PA 1YYHA 5KJNA 5KJLA 5HS0A 4EZLA 5JHNA 3G2VA 3NOGD 4TRQA 1KZPA 4DLQA 2VTBA 2Y0BG 3QWWA 3HVEA 4R7LA 3M5AA 2IF4A 4J7IA 4KVMA 3SBTB 4KT6B 1ELKA 3CVVA 5BPPA 4ACLA 4KYOB 4A3VA 3FULA 4CT0A 2AXZA 1BLXB 1TJFA 5ENSD 4IJDA 4L1BA 4NJ5A 1N9AA 4HBDA 4W9RA 5AENA 4O30A 1OCZE 2QPWA 3OXFA 3MX3A 3PZ4A 4BESA 4FLHA 3C5RA 4PH4B 1E8XA 1N4SA 4YVQC 4EPZA 4GYYA 2VGEA 4O1OA 4G23A 3ZYQA 1WM5A 1FVHA 1BPOA 2WXOA 4HVBA 1IKND 3DPDA 3AU4A 3SFYA 4G8LA 4B94A 3DEOA 5AQAA 2FO1E 1N4PA 2KXPC 3C72A 3Q49B 4I51A 1TNBA 1A5EA 4YPAA 3TWWA 4F7AA 4HLLA 3EU9A 2Y69E 3PUJA 4AJWA 2R02A 3CSTA 2BKGA 4L23A 3UUXA 3LY7A 2OV8A 4XI9A 2XEHA 1GW6A 3ULYA 1G3NB 1Z3XA 3ASNE 1Z3YA 5CEAA 1N4RA 4GAAA 3APCA 2NC9A 1SW6A 3D9NA 5JJ0A 5FIOA 1HH8A 2OVFA 4YNMA 2MRIA 4GZ3A 1XNFA 4E47A 3PDNA 2P9UG 5CECB 3PEVB 5ITZF 1H6KA 2X6FA 3ESLA 3GZ1A 3KSLA 3M57A 2AWIA 3FH8A 4AVXA 1O1TA 2GRQB 4FADA 1JUQA 2IO3C 3T8KA 2GRLA 2P9LG 3APDA 1H6PA 5CBNA 5BUZA 3ZUVB 1EYHA 3RQ4A 3QAQA 5LP0A 1BI8B 4K5BA 4XZ4A 5FJYA 4K03A 3ONLA 4GZDA 1UW4B 4MS6A 2VSNA 3UM3A 3RO2A 3CVXA 4UWFA 1HG2A 2BKKB 4Q69A 4JHRA 3ABKE 4I6GA 5T8IA 4QEOA 4RSYA 5CMYA 3NBNB 4YPEA 4I2WA 3BG1B 2KCKA 4QFVA 4GTRA 1VDYA 5E75A 1ZB1A 3M53A 3JXJA 3D9LA 3TG4A 2IQCA 4BT8A 2J4BA 2IFUA 3K9IA 4JW1A 4DPRA 3ISMC 3UTMA 3FUFA 1INZA 3SFZA 4GZ5A 3QARA 5ENPD 3WXXA 4GMLA 5ENTD 1WG0A 4LEUA 1FT2A 1U2VG 5EKQD 2J08A 2CFUA 4GTVA 3LS8A 1PY1A 3UM0A 1MYOA 2F8YA 4LUNU 2LAHA 3VTXA 5G55A 2V5QC 5EIDA 3LPZA 2R3AA 1K3ZD 2WMNA 3MYVA 3DSTA 3PE4A 5F5EA 2F8XK 1N6AA 2GRNB 2LXMA 3HXBA 3EIQC 4ANWA 5F59A 5G05C 4V3IA 2GRRB 1UJJA 4PUCA 2Y4TA 3IHXA 2AW6A 3NB2A 3VTYA 3G2SA 1MZCA 3DSXA 2P2CP 3AJIA 4K0RA 2XHEA 4HOTA 4XX5A 3CVQA 2C0LA 4HOUA 4HXIA 4AP2A 2IEJA 2WQ6A 4ILHB 3FTXA 1DVPA 3JQ0A 4ZHBA 5J90A 4DI3A 3PREA 3JUIA 3S7JA 3F6QA 4J8SA 2WQHA 3SGHA 2EIME 4B93B 4HOSA 1N95A 3D9OA 4AEZC 2C2LA 3CBPA 3FU5A 4RG6A 3TWSA 2YQ8A 2KZTB 5E76A 3SO8A 3CVLA 4IJ8A 2H6FA 4WNFA 1HF8A 2JABA 5HKPA 4F3VA 4C9BB 3DWLG 4UI9J 2UWJG 4UI9C 1TNOA 3CVWA 3MO0A 1OWPA 3UPVA 3SQVA 4CDRA 1ZBPA 2OEVA 3FU0A 2RKKA 2PM7A 3Q78A 1AWCB 2YHEA 3RAYA 3ZW3A 5KNGA 3N71A 4YVOA 5D0QD 5D2MC 3M55A 3CVNA 5FQ6A 2XPYA 4P29A 1LD8A 3MEKA 1OY3D 3RRUA 2A5UA 5AJLA 3PUKA 5F6KC 4DX2A 4MRUA 3CR3A 5CRVA 3SZ7A 3HXCA 3FDHA 4EZKA 3WG7E 4BY6A 3FTUA 1OUVA 3LXUX 4A63B 2X6HA 4WNEA 4TXRA 3Q9UC 2XCBA 2AJAA 3T5VA 3V31A 4U8YD 4I1AA 5LOZA 3FUMA 2LSVA 3ZHEB 3K5KA 3D9KA 4GCOA 2I6HA 4A1GA 4CCAA 4MI5A 3SI5A 3GW4A 2DZNA 3PZDA 4EZJA 3W9FA 2XPIA 4HQDA 3ZKJA 2PNNA 3EJNA 4Y6WA 4NACA 4BWRA 1LD7A 1XGWA 2YINA 3IHVA 5CPRB 2L6JA 2EINE 4L2LA 2F69A 2WM9A 2WXJA 4G2VA 3KEAA 2LO6A 3Q5MA 3V79K 3O48A 3KSQA 3HNAA 3IEGA 3RRMB 3UT7A 5LSZA 1EPUA 4UWKA 2WXGA 3F9YA 1U3DA 1AP7A 2WMOA 4DK5A 4I17A 1QZ2A 4BX9A 4MLPA 4FHJA 3FFLA 2OOEA 2MYOA 4GA1A 3UM2A 4IYPA 1S70B 3G2TA 2VTBB 1DCQA 3HVEB 3SW9A 5JINA 1N54A 4YNPA 1WY6A 4HOQA 3CBMA 2V8SE 3QKYA 2IY0C 2HYZA 3B7SA 4U04A 2ETBA 4AXHA 3PNLB 3UMVA 3DSUA 1YCSB 5BW8C 1NFIE 3AS4A 4FLBA 1SA4A 1NL4A 3S7DA 1TNZA 2CG2A 2R59A 3DSWA 1P5QA 4H12A 5ENOD 4EECA 4FULA 3MV3B 4BERA 5BXOA 1S63A 4LCTA 3Q9NC 2DVWA 3AU5A 4XEIG 4A55A 5FINA 3I4GA 5EYPF
chains in the Genus database with same CATH topology
2OV8A 2XGSA 4XI9A 1E8YA 5C1DA 2M63A 2E0IA 3FUJA 1GW6A 5G04J 5G04C 2IJGX 4J0UA 1H2TC 3LY9A 5A7DB 4M3OA 3MJWA 5LX8A 1Z3XA 2CHWA 3ENEA 3F9ZA 4GA2A 1PAQA 3CEQA 1MHQA 1Z3YA 4WNGA 2ILRA 2XGMA 4GYOA 4U0ZA 4AY6A 4EQFA 2L0IA 4NURA 2ONDA 4RG9A 1LF8A 3LKUA 4CGVA 1ZKKA 5T4YA 3CKBA 4JZYA 2L9BA 3GZ2A 3I5PA 4NRHB 4JEUA 3ASGA 3RJWA 4GAAA 2GRMA 3APCA 3BEEA 4ILIA 4ABNA 2JEKA 4G24A 3IBEA 3C98A 4QEPA 1EF1C 2NC9A 3D9NA 5JJ0A 2LNIA 4O6FA 3CV0A 3R7QA 1HH8A 2OVFA 4YNMA 2MRIA 4FC8A 2KM4A 4GZ3A 1QNFA 3TAXA 3FPDA 1XNFA 4E47A 3PDNA 3Q47B 4PS8A 5DBKA 4N3CA 3PEVB 4WUYA 3LDZA 1H6KA 2LAIA 2X6FA 2L0TB 3ESLA 3GZ1A 1OWNA 1UG3A 4HFGA 3CLJA 4U0UA 4GYWA 2AWIA 1L5JA 4B8AA 2V5FA 5FQ7A 1B89A 2YNQA 3TXNA 2X6IA 3KEZA 4ANXA 4CGWA 3FH8A 4AVXA 2VSXE 3CVYA 1WAO1 3U3WA 4FADA 1FCHA 3LY8A 5HQ8A 2IGQA 2KCLA 1JUQA 4I6EA 5BT1A 3OTNA 2GRLA 2P58C 3D9PA 3RKVA 3UT4A 3APDA 4UWGA 3FEYA 5JJ6A 4N2SA 4I9EA 5BUZA 4C1QA 1EYHA 3CSFA 1HS6A 2R17C 3Q4AB 4JC8A 4L2YA 3RQ4A 3S8PA 2FULA 3QAQA 5TEGA 5LP0A 3G2WA 5ANLA 5FQ4A 3KMJA 3NF1A 4J8EA 3SWCA 3LVQE 5KJKA 4XZ4A 5FJYA 2KCVA 4K03A 3NQPA 3ONLA 3FUDA 4GZDA 2VQ2A 4UQXA 5FZQA 4ATGA 2CHZA 1OWOA 3S7BA 1H2VC 4J8OA 1UW4B 4MS6A 2VSNA 4GMJA 3MCXA 5KJMA 3F9WA 4N3AA 3RO2A 1KLXA 3CVXA 2RD0A 3I4RB 4UWFA 4KXKB 3SBSA 3M57A 2R5SA 4GZCA 1HG2A 2IONA 4PS3A 2RG8A 4BTBA 4JHJA 4JXTA 2WXMA 3ZYLA 4Q69A 4JHRA 5EX0A 3ASDA 3QWVA 4UWLA 4I6GA 5T8IA 4QEOA 3FP3A 3VV0A 4RSYA 3UX4A 1E7VA 1N6CA 3PH0C 2GW1A 5AIJA 5CMYA 2Y3AA 4PS7A 4APFA 2VJ8A 4YPEA 4E85A 2PM6A 3IKOB 1KT1A 3FUEA 3MV2B 3U4TA 2O8JA 4I2WA 3BG1B 3CVUA 3ASFA 2KCKA 4JA9A 5ENNA 2RFIA 4WWOA 4G25A 3R7RA 4QFVA 3G2UA 1VDYA 4A3TA 4B8CB 1NP7A 4FJYA 4BT9A 5EG2A 5E75A 3ZGQA 3QOUA 3CHRA 3M53A 4AY5A 3B7RL 3D9LA 3TG4A 2X3MA 2IQCA 4WNDA 5FZRA 4BT8A 2J4BA 4AM9A 4APOA 3HHMA 4JPSA 5BNWA 3Q15A 3ZVVA 3HIZA 2IFUA 1SZ9A 3K9IA 4HLEA 4JW1A 4DPRA 1NA3A 1U3CA 3L6AA 2BQZA 4GA0A 3FUFA 1JWGA 3FY4A 1INZA 4U8HA 3SD5A 1OWLA 3SFZA 4GZ5A 5ANRA 3CKCA 3QARA 3QK0A 1EDUA 3WXXA 2FEZA 3CHPA 4GMLA 2IOLA 3UQ3A 2FO7A 4LEUA 1OWMA 3TJPA 2WXPA 4Q96A 1HXIA 3FWVA 5T3RA 2WB2A 5EKQD 1ZU2A 2XQ0A 3EHNA 2J08A 1UN9A 1HO8A 4UI9K 4CEMA 3KMAA 2CFUA 2Y4UA 3ZEFA 3FTSA 1UN8A 3LS8A 5ARGA 3KAEA 3QDNA 1PY1A 4AOFA 3M58A 3TGOA 4J8DA 2J07A 4LUNU 3P2BA 2ZU6B 2LAHA 2AXVA 3VTXA 5FWQA 2A4ZA 5G55A 4AIFA 4CT4A 1S0PA 2VYIA 3LPZA 3O4ZA 3CGHA 3I3NA 2R3AA 1QQEA 4I43A 3L17A 1TJCA 2NXPA 2WMNA 3MYVA 2J4DA 4PDXA 3PE4A 3EHMA 4G26A 5F5EA 3SF4A 4BSXA 2WXIA 2VGYA 1N6AA 3CK7A 3LJ3A 5AYWD 3MGBA 3T8MA 5BV1A 1IQRA 3EIQC 1PEGA 4QENA 1E8ZA 4ANWA 1NA0A 3P1UA 5F59A 3S2AA 3MZLB 1W3BA 2FF4A 3DBSA 5G05C 3RJVA 4GU5A 3IV0A 4V3IA 5T5GA 3RU0A 2I9CA 1E90A 3ML8A 5T0KA 1UJJA 2WXFA 3JCKC 4PUCA 5EX3A 2I2OA 2Y4TA 3L54A 5HI7A 3ZYKA 4ACKA 3IHXA 2AW6A 4A1SA 4E6HA 2I1KA 3VTYA 3G2SA 3CBPA 2AXUA 2HR2A 3GZSA 4WAFA 3M54A 4I2ZA 1MT6A 1N52A 4CDNA 2WPVA 4K0RA 3UUXA 2XHEA 4U07A 4HOTA 4TV3A 2I1JA 1SQMA 2MOWA 4XX5A 2VGXA 3CVQA 3DALA 3RIBA 4ANUA 3F9XA 3BO5A 2KZTA 3MKQA 3OPEA 2C0LA 3CHQA 4HOUA 2GGFA 4HXIA 3FUNA 3MKRA 4AP2A 4JHKA 4EBAA 2UY1A 3QB2A 3E4BA 4H7XA 2MHKA 2WQ6A 4ILHB 2PQNA 4C0EA 3CVPA 3KS2A 2XGOA 3ZPJA 3OOIA 2OVBA 4YNDA 3BG0B 3FTXA 4UQYA 5A6CA 1DVPA 2XCCA 2KATA 5JJ7A 2WXKA 3JQ0A 3ASHA 2BTDA 4WWNA 5J90A 3OS5A 5JHAA 4ANVA 4DI3A 4U0SA 3PREA 3JUIA 2HM8A 3S7JA 1YA0A 2Q7FA 1DNPA 4J8SA 3L13A 4LERA 2WQHA 4JDSA 3SGHA 4ILGA 3ZRHA 5LFAA 3FTWA 2BUGA 4HOSA 5AJDA 3FU3A 4EBAG 3D9OA 2FI7A 5J08A 4AEZC 5M72A 2VGXB 2C2LA 4NQ0A 4BUPA 3IHYA 4GZ6A 3FU5A 4RG6A 3ZN3A 2QFCA 3RRNB 4N2QA 2YQ8A 3APFA 3OAWA 2KZTB 3MKQB 5E76A 4DJAA 3CVLA 2WXHA 4IJ8A 4I1OB 4Y6CA 2J49A 2CHXA 4WNFA 1HF8A 3CQCB 1E96B 5CMWA 4XI0A 4D10C 3CK8A 2UY1B 3L22A 4B0ZA 4DI4A 4F3VA 3CHOA 3ONKA 4KZCA 4C9BB 1O9SA 4JLGA 4LDGA 1HG5A 2UWJG 4UI9J 4UI9C 3AS5A 2G46A 3CVWA 4H7YA 1IQUA 4BFRA 3MO0A 1OWPA 2IOSA 3VLFA 3UPVA 4XKCA 3D9IA 4CDRA 1ZBPA 3FU0A 4MKTA 5CCLA 3CBOA 4KMOA 2PQRA 4N3BA 1IYGA 2X38A 2PM7A 2X6JA 4J8FA 4L7TA 5CCMA 5FT9A 1ML9A 4AU7A 5ARFA 2CFZA 3ESKA 2YHEA 5KCMA 3RAYA 3R9AB 1A17A 1MUFA 3ZW3A 3N71A 3JQ1A 4YVOA 5D0QD 3VLDA 1Y6IA 2XRYA 3M55A 1ELWA 3CVNA 2V0PA 3EDTB 3FTYA 4KBQA 2XPYA 4JEHA 4U63A 3B7TA 3ML9A 4P29A 5FQ6A 2WQ7A 5C2YA 3CHSA 4FP7A 3MEKA 3NZSA 5DIZA 2A5UA 3RRUA 2QY7A 5AJLA 3PUKA 3CK9A 4G1TA 1MQSA 5A23A 1E8WA 5F6KC 2IU1A 4I9CA 3M59A 3TXMA 2V4LA 3D3MA 1TEZA 4OVUA 4IULA 4B89A 4MRUA 3ZHEA 4BX8A 3FHEA 3CR3A 3SZ7A 5TTFA 1X5BA 4FHKA 4TUUA 2DBAA 3FDHA 3PE3A 4UQZA 3LCAA 5CHEE 4BTAA 4EZKA 2CG3A 3ZXSA 4BY6A 2DCPA 2XRZA 3FTUA 5JIYA 3MO5A 1OUVA 1NZNA 4OYSA 4I6JA 3LXUX 4FJZA 2X6HA 2XEVA 4WNEA 3CHMA 3U64A 3MO2A 3HYMB 1ELRA 2KC7A 3RK6A 5G2NA 2JLBA 2XCBA 4F1SA 3T5VA 4AV7A 1HZ4A 3EIJA 4OVVA 3CQGB 3FTVA 1MVXA 3L16A 4XE0A 4FU3A 3CIAA 3ZIMA 4HS2A 5TH7A 1KT0A 2X6KA 4I1AA 5LOZA 2DIWA 3FUHA 3FUMA 2LSVA 4ME2A 4Q94A 5FZSA 5G05J 3ZHEB 2LSUA 3D9KA 2I6HA 3FUKA 4GCOA 2JV0A 1H0AA 4J83A 4Z4PA 4A1GA 4CCAA 3JYSA 4KVOA 2WXRA 2XPZA 4J6IA 4MI5A 2AVPA 4J7FA 3SI5A 3KD7A 1E7UA 1SZAA 1JWFA 3FU6A 2NSZA 3GW4A 3K5KA 3D9MA 3S7FA 4CDMA 1H19A 3PZDA 3SNXA 4GB9A 1XQHA 3QJZA 5KJNA 4EZJA 4XKBA 2XPIA 4DLOA 5KJLA 4JL0A 3QNKA 4UWHA 4EZLA 3RO3A 3EJNA 4Y6WA 4F53A 5AYFA 3PRZA 5JHNA 3URZA 3G2VA 4NACA 2VSOE 3U9WA 4BWRA 3TG5A 4KZ0A 4JVSA 3VUZA 1UJKA 1XGWA 4TRQA 2WXLA 2YINA 3D9JA 3IHVA 3OXGA 5BV0A 4DLQA 5CPRB 3AS8A 2VTBA 4GCNA 2L6JA 4L2LA 2F69A 1H3IA 2WM9A 3QWWA 3HVEA 4R7LA 4N5CA 1HE8A 1Y8MA 2WXJA 4G2VA 4CRWA 3M5AA 3M56A 2IF4A 4J7IA 2LO6A 3Q5MA 1HU3A 4IRUA 3O48A 4KVMA 2BF0X 2J9QA 3LY7A 3SBTB 3ZYMA 2PL2A 4IN3B 1ELKA 1HX8A 3FH5A 3GYZA 4KT6B 3FTZA 3IEGA 3SHFA 3CVVA 3HNAA 5BPPA 3RRMB 4ACLA 4KYOB 3FUIA 3UT7A 5LSZA 1EPUA 4JA7A 3UT8A 4UWKA 4A3VA 3KMTA 2C0MA 3QWPA 2WXGA 3FULA 3LEWA 2WVIA 1U3DA 4CT0A 2AXZA 3F9YA 5FQ8A 2WMOA 3PNTB 4DK5A 4I17A 1QZ2A 4BX9A 1TJFA 4MLPA 4FHJA 4G11A 4IJDA 3B7UX 3FFLA 2OOEA 4L1BA 4FMUA 4NJ5A 3T5XA 1PC2A 4W9RA 5D0OD 5AENA 4GA1A 4O30A 3VLEA 5JJTA 2QPWA 3LVRE 3OXFA 4IYPA 4URKA 3MX3A 2W5YA 4FLHA 2E2EA 4PH4B 3G2TA 1E8XA 2VTBB 5F6LA 1HFAA 3PVLA 3DB5A 3QC1A 4YVQC 4EPZA 5JHBA 3HVEB 4GYYA 3SW9A 5JINA 1N54A 3FEXA 3MA5A 4G23A 3NZUA 3ULQA 3ZYQA 4YNPA 1WM5A 2WXNA 4YPUA 1WY6A 1FVHA 4HOQA 2V8SE 3QKYA 3CBMA 4I1MA 1BPOA 2HYZA 4MI0A 2WXOA 3EP0A 1JPLA 4HVBA 4XIFA 3B7SA 4U04A 4HORA 2W5ZA 3DPDA 3TL5A 4RZ0A 5LSXA 3B13A 2EQXA 3PEUB 3PNLB 4AXHA 3UMVA 3L08A 5T0MA 2J09A 4FA6A 2HO1A 2VSYA 3HDXA 3AU4A 3PS6A 5BW8C 3AS4A 4GPKA 4FLBA 4B94A 2YHCA 4LRZA 1Z6TA 3Q49B 3OXLA 3S7DA 2FBNA 4I51A 1FVFA 5LCWJ 5LCWC 1IHGA 4RVBA 2CG2A 2R59A 1P5QA 4H12A 1H2UA 4YPAA 4EECA 4F7AA 4FULA 3MV3B 4WWPA 1MVHA 3FH7A 3U66A 1N3JA 4C0MA 4NVQA 3LYAA 5FTPA 4LCTA 3PUJA 4N39A 3ZFWA 4AJWA 5EDSA 3AU5A 2PZIA 3CSTA 4A55A 4L23A 3I4GA 2WXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGS A;  4XI9 A;  5C1D A;  5G04 J;  5G04 C;  4J0U A;  3LY9 A;  5A7D B;  3F9Z A;  4GA2 A;  3CEQ A;  4WNG A;  2XGM A;  4GYO A;  4U0Z A;  4AY6 A;  4EQF A;  2OND A;  4RG9 A;  3LKU A;  4CGV A;  1ZKK A;  3CKB A;  3RJW A;  3GZ2 A;  4NRH B;  3ASG A;  3BEE A;  4ABN A;  4G24 A;  4QEP A;  2NC9 A;  5JJ0 A;  2LNI A;  4O6F A;  3CV0 A;  1HH8 A;  4YNM A;  4GZ3 A;  3TAX A;  3FPD A;  1XNF A;  4E47 A;  3PDN A;  3Q47 B;  5DBK A;  4N3C A;  4WUY A;  3GZ1 A;  4U0U A;  3M57 A;  4GYW A;  2V5F A;  1B89 A;  4CGW A;  1WAO 1;  3U3W A;  1FCH A;  3LY8 A;  5HQ8 A;  2IGQ A;  2KCL A;  5BT1 A;  2P58 C;  3RKV A;  5JJ6 A;  4N2S A;  4I9E A;  4C1Q A;  3Q4A B;  3RQ4 A;  3S8P A;  5TEG A;  3KMJ A;  3NF1 A;  4J8E A;  3SWC A;  5KJK A;  5FJY A;  2KCV A;  5FZQ A;  2VQ2 A;  4UQX A;  3S7B A;  4J8O A;  2VSN A;  5KJM A;  3F9W A;  4N3A A;  3RO2 A;  1KLX A;  4KXK B;  2R5S A;  4BTB A;  4JHR A;  5EX0 A;  3ASD A;  3QWV A;  4QEO A;  3FP3 A;  3VV0 A;  1N6C A;  2GW1 A;  4YPE A;  1KT1 A;  3U4T A;  3MV2 B;  2O8J A;  4I2W A;  3ASF A;  4JA9 A;  2KCK A;  2RFI A;  4G25 A;  4BT9 A;  5EG2 A;  3ZGQ A;  3QOU A;  3M53 A;  4AY5 A;  3TG4 A;  4WND A;  5FZR A;  4BT8 A;  4AM9 A;  4APO A;  5BNW A;  3Q15 A;  2IFU A;  3K9I A;  2BQZ A;  1NA3 A;  4GA0 A;  4GZ5 A;  3CKC A;  3WXX A;  2FEZ A;  3UQ3 A;  2FO7 A;  4LEU A;  1HXI A;  3FWV A;  5EKQ D;  1ZU2 A;  4UI9 K;  3KMA A;  2Y4U A;  5ARG A;  3KAE A;  3QDN A;  3M58 A;  3TGO A;  4J8D A;  3VTX A;  4AIF A;  2VYI A;  3LPZ A;  2R3A A;  1QQE A;  1TJC A;  3PE4 A;  4G26 A;  5F5E A;  3SF4 A;  2VGY A;  1N6A A;  3CK7 A;  5AYW D;  4QEN A;  1PEG A;  1NA0 A;  5F59 A;  1W3B A;  2FF4 A;  5G05 C;  3RJV A;  5T5G A;  3RU0 A;  5T0K A;  5EX3 A;  2Y4T A;  5HI7 A;  3IHX A;  4A1S A;  3VTY A;  2HR2 A;  3M54 A;  4I2Z A;  1MT6 A;  2WPV A;  4U07 A;  4HOT A;  3DAL A;  2VGX A;  3CVQ A;  3RIB A;  3F9X A;  3BO5 A;  3OPE A;  2C0L A;  4HOU A;  3MKR A;  2UY1 A;  3E4B A;  4H7X A;  2MHK A;  2PQN A;  3CVP A;  3KS2 A;  2XGO A;  3ZPJ A;  3OOI A;  4YND A;  4UQY A;  5A6C A;  2XCC A;  5JJ7 A;  2KAT A;  3ASH A;  3OS5 A;  4U0S A;  3S7J A;  1YA0 A;  2Q7F A;  2WQH A;  4JDS A;  2BUG A;  4HOS A;  2FI7 A;  5M72 A;  2VGX B;  2C2L A;  4NQ0 A;  4BUP A;  4GZ6 A;  3CBP A;  4N2Q A;  4RG6 A;  3ZN3 A;  2QFC A;  2YQ8 A;  3CVL A;  4IJ8 A;  4Y6C A;  4WNF A;  1E96 B;  4XI0 A;  3CK8 A;  2UY1 B;  4F3V A;  4JLG A;  1O9S A;  4LDG A;  4UI9 J;  2UWJ G;  4UI9 C;  3AS5 A;  2G46 A;  4H7Y A;  3MO0 A;  3UPV A;  4CDR A;  1ZBP A;  3CBO A;  5CCL A;  2PQR A;  4N3B A;  1IYG A;  1ML9 A;  5CCM A;  4J8F A;  4AU7 A;  5FT9 A;  5ARF A;  3ESK A;  3RAY A;  3R9A B;  1A17 A;  1MUF A;  3N71 A;  4YVO A;  5D0Q D;  3M55 A;  1ELW A;  3CVN A;  3EDT B;  4KBQ A;  3MEK A;  5DIZ A;  3CK9 A;  4G1T A;  5F6K C;  4I9C A;  3M59 A;  3ZHE A;  3SZ7 A;  5TTF A;  2DBA A;  3PE3 A;  4UQZ A;  3LCA A;  5CHE E;  4BTA A;  5JIY A;  3MO5 A;  1OUV A;  1NZN A;  2XEV A;  4WNE A;  3MO2 A;  3HYM B;  1ELR A;  2KC7 A;  2JLB A;  2XCB A;  1HZ4 A;  1MVX A;  5TH7 A;  1KT0 A;  4I1A A;  3ZHE B;  5G05 J;  5FZS A;  2LSV A;  4ME2 A;  3K5K A;  2LSU A;  4GCO A;  2I6H A;  2JV0 A;  4J83 A;  4Z4P A;  3JYS A;  4MI5 A;  2AVP A;  4J7F A;  3KD7 A;  3GW4 A;  3S7F A;  1XQH A;  5KJN A;  2XPI A;  5KJL A;  4JL0 A;  3RO3 A;  4Y6W A;  5AYF A;  5JHN A;  3URZ A;  4BWR A;  3TG5 A;  3VUZ A;  3OXG A;  5CPR B;  3AS8 A;  4GCN A;  2L6J A;  2F69 A;  1H3I A;  3QWW A;  4N5C A;  1Y8M A;  4G2V A;  3M5A A;  3M56 A;  2IF4 A;  4J7I A;  3Q5M A;  3O48 A;  2J9Q A;  3LY7 A;  2PL2 A;  4IN3 B;  3HNA A;  3GYZ A;  3IEG A;  4KYO B;  5LSZ A;  4JA7 A;  3KMT A;  2C0M A;  3QWP A;  3F9Y A;  4I17 A;  1QZ2 A;  4IJD A;  3FFL A;  4NJ5 A;  2OOE A;  4FMU A;  1PC2 A;  4W9R A;  5D0O D;  4GA1 A;  4O30 A;  5JJT A;  2QPW A;  3OXF A;  2W5Y A;  2E2E A;  5F6L A;  3DB5 A;  4YVQ C;  4GYY A;  3SW9 A;  5JIN A;  3MA5 A;  4G23 A;  3ULQ A;  4YNP A;  1WM5 A;  4YPU A;  4HOQ A;  3CBM A;  3QKY A;  2HYZ A;  4MI0 A;  3EP0 A;  4HOR A;  4XIF A;  4U04 A;  2W5Z A;  4RZ0 A;  5LSX A;  5T0M A;  2HO1 A;  2VSY A;  5BW8 C;  3AS4 A;  4GPK A;  4B94 A;  2YHC A;  3Q49 B;  3OXL A;  3S7D A;  2FBN A;  4I51 A;  5LCW J;  5LCW C;  1IHG A;  1P5Q A;  4H12 A;  4YPA A;  3MV3 B;  1MVH A;  1N3J A;  4NVQ A;  3LYA A;  5FTP A;  4N39 A;  3ZFW A;  2PZI A;  3UUX A; 
#chains in the Genus database with same CATH topology
 5G04 J;  2OEW A;  5G04 C;  2IJG X;  4DUI A;  3ULE G;  4HRL A;  4M3O A;  3MJW A;  1MHQ A;  4WNG A;  2XGM A;  2L0I A;  2OND A;  5T4Y A;  3RJW A;  3GZ2 A;  4NRH B;  4JEU A;  1TNU A;  2ZGD A;  3BEE A;  4G24 A;  3C98 A;  3TWR A;  5B1B E;  3T9K A;  5DBK A;  4WUY A;  3LDZ A;  2LAI A;  4HFG A;  4U0U A;  1OWN A;  4GYW A;  1L5J A;  4B8A A;  1MX4 A;  3TXN A;  3CVY A;  2QYJ A;  4G8K A;  1JCS A;  1QYM A;  5BT1 A;  2P58 C;  3D9P A;  3RKV A;  2F37 A;  4JC8 A;  4L2Y A;  4U7E B;  3S8P A;  3E32 A;  3G2W A;  4O60 A;  3SWC A;  3LVQ E;  3FUD A;  2VQ2 A;  3S7B A;  4GMJ A;  3MCX A;  4GPM A;  2RD0 A;  1N0R A;  3TWQ A;  4GZC A;  4BTB A;  4JHJ A;  2WXM A;  3ASD A;  3QWV A;  3FP3 A;  3UX4 A;  3PH0 C;  3FUE A;  3MV2 B;  2O8J A;  4JA9 A;  5ENN A;  4G25 A;  1OT8 A;  3G2U A;  4A3T A;  1NP7 A;  4BT9 A;  5EG2 A;  3ZGQ A;  4AY5 A;  3BU8 A;  3DXK G;  5FZR A;  5BNW A;  1SZ9 A;  4HLE A;  1NA3 A;  3B7B A;  3E37 A;  3SD5 A;  3E33 A;  1OWL A;  2IO2 C;  1JCQ A;  3CKC A;  3QK0 A;  1EDU A;  2DZO A;  3CHP A;  3UQ3 A;  2FO7 A;  2V4H C;  1HXI A;  1HO8 A;  4CEM A;  3KMA A;  3LJN A;  3ZEF A;  1V55 E;  1D9S A;  3KAE A;  3TGO A;  2EIL E;  4OAV B;  4AIF A;  3O4Z A;  4N5Q A;  3L17 A;  2P9N G;  4PDX A;  5JA4 D;  2WXI A;  3CK7 A;  5AYW D;  3MGB A;  1IQR A;  1E8Z A;  1NA0 A;  3V2X A;  3MZL B;  1W3B A;  1QBQ A;  5T5G A;  1BI7 B;  1E90 A;  4E6H A;  2I1K A;  4U95 D;  5B1A E;  3EU5 A;  4I2Z A;  4YDE A;  1FPP A;  4U07 A;  2I1J A;  3JUE A;  3RIB A;  4ANU A;  3BO5 A;  3OPE A;  3FUN A;  2UY1 A;  3QB2 A;  4HI8 A;  2OVB A;  5A6C A;  2XCC A;  2KAT A;  2WXK A;  4EHM A;  4WWN A;  3EUV A;  2ETC A;  3OS5 A;  5JHA A;  4U0S A;  2HM8 A;  1DNP A;  4HRM B;  3L13 A;  5ENQ D;  5B3S E;  4EBA G;  4BET A;  5J08 A;  4BUP A;  4GZ6 A;  3RRN B;  3APF A;  3L9T A;  4I1O B;  4XI0 A;  3CK8 A;  5HRY A;  4LG6 A;  4DI4 A;  4JLG A;  1HG5 A;  4TXP A;  4H7Y A;  4BFR A;  2IOS A;  1LTX A;  3CBO A;  4MKT A;  4KMO A;  4N3B A;  1IYG A;  4L7T A;  5CCM A;  4J8F A;  5FT9 A;  5ARF A;  4LSZ E;  1A17 A;  1MUF A;  2GRO B;  3HG0 D;  1WDY A;  1Y6I A;  2XRY A;  3FTY A;  2WQ7 A;  4KBQ A;  5C2Y A;  3NZS A;  5A23 A;  4I9C A;  2V4L A;  4OVU A;  4B89 A;  3FHE A;  4TUU A;  3PE3 A;  2H6G A;  4CZ2 D;  3MO5 A;  3IXE A;  4TUM A;  2GRP B;  4OYS A;  3HYM B;  2KC7 A;  4U96 D;  4AV7 A;  1MVX A;  4FU3 A;  3ZIM A;  2DIW A;  3FUH A;  5G05 J;  1H0A A;  3JYS A;  2AVP A;  3KD7 A;  1E7U A;  1H19 A;  1TN8 A;  4GB9 A;  1XQH A;  3QNK A;  2P9S G;  5AYF A;  2VSO E;  3U9W A;  3TG5 A;  3RSE G;  4JVS A;  2WXL A;  3D9J A;  3OXG A;  3NOC D;  3ZXP A;  2RFM A;  4N5C A;  3M56 A;  4IRU A;  2F0Y A;  2BF0 X;  2PL2 A;  4IN3 B;  3FH5 A;  3GYZ A;  3FTZ A;  3FUI A;  3KMT A;  2C0M A;  3QWP A;  2WVI A;  5FQ8 A;  3PNT B;  4G11 A;  3T5X A;  1PC2 A;  3VLE A;  3LVR E;  4URK A;  5IY5 E;  3DB5 A;  1TN6 A;  3QC1 A;  5JHB A;  3PZ3 A;  3NZU A;  2WXN A;  4YPU A;  3EP0 A;  1JPL A;  4XIF A;  2W5Z A;  4RZ0 A;  1OCC E;  2EQX A;  3PEU B;  5T0M A;  4C48 B;  3HDX A;  2P9P G;  4GPK A;  4ZFH A;  2YHC A;  1Z6T A;  3OXL A;  3BQO A;  2FBN A;  1FVF A;  4RVB A;  4YDY A;  3AG1 E;  3TWX A;  4WWP A;  3U66 A;  1N3J A;  4NVQ A;  5FTP A;  1KZO A;  5EYL A;  3ZFW A;  2LUH A;  3E30 A;  3JXI A;  1SA5 A;  1K8K G;  5CRU A;  2A5E A;  1E8Y A;  2M63 A;  4J0U A;  3LY9 A;  5AN8 A;  5A7D B;  4RLY A;  4GA2 A;  1PAQ A;  3CEQ A;  4BEP A;  5AAR A;  1MX2 A;  4EQF A;  4RG9 A;  1LF8 A;  3LKU A;  1N0Q A;  4JD2 G;  3CKB A;  4JZY A;  3I5P A;  3ASG A;  3J5P A;  3DEP A;  2JEK A;  3IBE A;  2LNI A;  4O6F A;  3CV0 A;  1IXV A;  1DC2 A;  3FPD A;  3UIO C;  5AAO A;  3SFX A;  3Q47 B;  1X81 A;  1DCE A;  3CLJ A;  3ABM E;  2YNQ A;  4ANX A;  2X6I A;  3KEZ A;  1WAO 1;  4QQI A;  3LY8 A;  3Q7A A;  5HQ8 A;  2IGQ A;  4I6E A;  3OTN A;  4UWG A;  5JJ6 A;  4N2S A;  4C1Q A;  3CSF A;  2P9K G;  4M7C A;  5TEG A;  5FQ4 A;  4J8E A;  5KNH D;  5KJK A;  3NQP A;  5FZQ A;  4UQX A;  1TN7 A;  4GTQ A;  1H2V C;  3F9W A;  1KLX A;  1MX6 A;  3I4R B;  4X8Q A;  3SBS A;  2DWZ A;  3DXM G;  4PS3 A;  4GTS A;  3ZYL A;  4UWL A;  5KBA A;  4J8Y A;  4ATZ D;  3VV0 A;  3EHQ A;  1N6C A;  2Y3A A;  2PM6 A;  4HRN A;  3IKO B;  3CVU A;  2ZIS A;  2RFI A;  4WWO A;  4FJY A;  4YDO A;  3QOU A;  3CHR A;  2X3M A;  4WND A;  3SY2 A;  1Q2Z A;  4AM9 A;  4APO A;  3HHM A;  4JPS A;  3Q15 A;  3HXF A;  1U3C A;  3L6A A;  4LNU D;  1NI1 A;  2HE0 A;  4U8H A;  2EIK E;  2FEZ A;  1O1S A;  2IOL A;  2Y1L E;  3TJP A;  2WXP A;  5T3R A;  2WB2 A;  1ZU2 A;  1IHB A;  2Y4U A;  4DX7 D;  3Q7F A;  3HRA A;  1UN8 A;  3QDN A;  5BXU A;  4AOF A;  4J8D A;  2LXL A;  2A4Z A;  1S0P A;  2VYI A;  2B0O E;  3ABL E;  3CGH A;  3I3N A;  1QQE A;  1OCR E;  2NXP A;  2J4D A;  3SF4 A;  4BSX A;  2VGY A;  3LJ3 A;  3T8M A;  5BV1 A;  3S2A A;  2R03 A;  2FF4 A;  3DBS A;  3RJV A;  3RU0 A;  4YDW A;  2I9C A;  5T0K A;  2WXF A;  5EX3 A;  2I2O A;  5HI7 A;  4A1S A;  1K1B A;  3TWT A;  3GZS A;  3M54 A;  1MT6 A;  1N52 A;  4CDN A;  2WPV A;  4HNA D;  2MOW A;  2VGX A;  1N4Q A;  3F9X A;  3MKQ A;  3C3Q A;  1TR4 A;  3CHQ A;  2GGF A;  4EBA A;  3E4B A;  4H7X A;  2MHK A;  2PQN A;  4C0E A;  1YMP A;  2XGO A;  3KS2 A;  4YND A;  4UQY A;  3UIN C;  2BTD A;  4ANV A;  1YA0 A;  2Q7F A;  4LER A;  5H7P A;  2XEE A;  4JDS A;  3ZRH A;  5LFA A;  3FTW A;  2BUG A;  5M72 A;  1SVX A;  4N2Q A;  2QFC A;  3OAW A;  2WXH A;  4Y6C A;  2J49 A;  5CMW A;  4D10 C;  2UY1 B;  3HXE A;  3AS5 A;  2G46 A;  4XKC A;  4AU7 A;  2CFZ A;  3ESK A;  4LNB A;  5KCM A;  3JQ1 A;  1BU9 A;  1S64 A;  1ELW A;  2V0P A;  3D9H A;  4U63 A;  4JEH A;  4FP7 A;  5DIZ A;  2QY7 A;  2OCC E;  3CK9 A;  1MQS A;  3TXM A;  1K1A A;  3D3M A;  4IUL A;  5AQ7 A;  4K5A B;  1RW2 A;  4J7W A;  4FHK A;  3PZ1 A;  2DBA A;  5AQ9 A;  4UQZ A;  3LCA A;  5CHE E;  2CG3 A;  1N11 A;  2KBX A;  2XRZ A;  1N94 A;  1NZN A;  3ZU7 B;  3Q79 A;  1OXJ A;  2XEV A;  3CHM A;  3MO2 A;  5G2N A;  2JLB A;  4F1S A;  3FTV A;  3L16 A;  4XE0 A;  2R05 A;  4O1P A;  4HS2 A;  5TH7 A;  3C3O A;  4ME2 A;  2L6B A;  2LSU A;  4J83 A;  4Z4P A;  4KVO A;  3V2O A;  1SZA A;  1JWF A;  3FU6 A;  2NSZ A;  2J8S D;  3D9M A;  3S7F A;  4L9P A;  1O1R A;  3SNX A;  3QJZ A;  3DSS A;  4DX1 A;  4XKB A;  3UXG A;  4DLO A;  4JL0 A;  4UWH A;  3RO3 A;  4MBG A;  4F53 A;  3PRZ A;  3URZ A;  4KZ0 A;  3VUZ A;  3UKR G;  1UJK A;  3TWV A;  5BV0 A;  3AS8 A;  4GCN A;  5D66 A;  1H3I A;  4U8V D;  1HE8 A;  1Y8M A;  4CRW A;  1HU3 A;  2J9Q A;  3ZYM A;  1HX8 A;  3SHF A;  4JA7 A;  3UT8 A;  5KWD A;  3LEW A;  3B7U X;  4FMU A;  5D0O D;  2XZT G;  5JJT A;  1D8E A;  2W5Y A;  2E2E A;  5F6L A;  1HFA A;  3PVL A;  3FEX A;  3MA5 A;  3ULQ A;  4I1M A;  4MI0 A;  4HOR A;  3TL5 A;  5LSX A;  5EIB E;  4JB8 P;  3B13 A;  3L08 A;  2J09 A;  4FA6 A;  1RZ4 A;  3HXD A;  2HO1 A;  2VSY A;  3PS6 A;  4DX5 D;  4LRZ A;  3EHR A;  5LCW J;  5LCW C;  1IHG A;  2DYS E;  2ZXW E;  1H2U A;  2EIJ E;  1MVH A;  3FH7 A;  4C0M A;  2ZIR A;  3LYA A;  2H6I A;  4N39 A;  4DX6 D;  5EDS A;  2PZI A;  1UOH A;  3E34 A;  2WXQ A;  4GTM A;  2XGS A;  4TXQ A;  5C1D A;  3B95 A;  2E0I A;  3FUJ A;  1H2T C;  5LX8 A;  2CHW A;  3F9Z A;  3ENE A;  4GTT A;  2ILR A;  4GYO A;  4U0Z A;  4AY6 A;  4NUR A;  4CGV A;  3C3R A;  5CER B;  1ZKK A;  2L9B A;  2QZA A;  1D8D A;  3AAA C;  2GRM A;  4ILI A;  4ABN A;  4QEP A;  1EF1 C;  3R7Q A;  3AG4 E;  1BD8 A;  2XS1 A;  4FC8 A;  2KM4 A;  1QNF A;  3TAX A;  5EIL A;  3W9G A;  2ETA A;  4PS8 A;  4N3C A;  2L0T B;  1UG3 A;  2V5F A;  5FQ7 A;  1B89 A;  4CGW A;  4CYM D;  2VSX E;  1FT1 A;  3X2Q E;  3U3W A;  1FCH A;  2KCL A;  4OAU C;  3UT4 A;  3FEY A;  2DYR E;  4I9E A;  1HS6 A;  2R17 C;  3Q4A B;  3AG3 E;  1TNY A;  2FUL A;  5ANL A;  3KMJ A;  3V30 A;  3NF1 A;  2KCV A;  3UIP C;  4ATG A;  2CHZ A;  1OWO A;  4J8O A;  5KJM A;  4RQI A;  4N3A A;  4KXK B;  2R5S A;  2ION A;  2RG8 A;  4JXT A;  3ASO E;  5EX0 A;  1E7V A;  2GW1 A;  5AIJ A;  4PS7 A;  4APF A;  2VJ8 A;  4E85 A;  2BED A;  1KT1 A;  3U4T A;  5JMN D;  3ASF A;  3UKU G;  3R7R A;  4B8C B;  5EN5 D;  4GMR A;  4GTO A;  3B7R L;  5ENR D;  3ZVV A;  3HIZ A;  2BQZ A;  4GA0 A;  1JWG A;  3FY4 A;  4Z68 A;  1MJ0 A;  5ANR A;  1TYQ G;  2ZGG A;  1OWM A;  1V54 E;  4Q96 A;  3FWV A;  2XQ0 A;  3EHN A;  1UN9 A;  4UI9 K;  3FTS A;  3UI2 A;  5AQB A;  5ARG A;  4UUC A;  3M58 A;  2XZD G;  2J07 A;  3P2B A;  2ZU6 B;  2AXV A;  5FWQ A;  1OCO E;  4NIK A;  4CT4 A;  2H6H A;  4I43 A;  1TJC A;  4G26 A;  3EHM A;  3TWU A;  2XS8 A;  4QEN A;  1PEG A;  4HB5 A;  3P1U A;  4GU5 A;  3IV0 A;  1O5M A;  3ML8 A;  3JCK C;  3Q73 A;  3DSV A;  3ZYK A;  3L54 A;  4ACK A;  3J5Q B;  2AXU A;  2HR2 A;  4WAF A;  3ZNG A;  3PZ2 A;  4TV3 A;  1SQM A;  3DAL A;  2KZT A;  3DRA A;  3MKR A;  4JHK A;  3CVP A;  3ZPJ A;  3OOI A;  3BG0 B;  5JJ7 A;  2R2L A;  3ASH A;  3RAU A;  4K5C A;  4HI9 A;  4ILG A;  4GTP A;  5AJD A;  3FU3 A;  2FI7 A;  2VGX B;  4NQ0 A;  3IHY A;  3ZN3 A;  3MKQ B;  4DJA A;  2CHX A;  3CQC B;  1E96 B;  2B6C A;  3L22 A;  3NAW A;  4B0Z A;  5CBO A;  3CHO A;  3ONK A;  4KZC A;  1O9S A;  4LDG A;  1IQU A;  3VLF A;  3D9I A;  3BUA A;  5CCL A;  2PQR A;  4BSZ B;  2X38 A;  2X6J A;  1ML9 A;  3R9A B;  3VLD A;  3EDT B;  3B7T A;  2XEN A;  3ML9 A;  3CHS A;  3R9M A;  2QC9 A;  4G1T A;  1E8W A;  2IU1 A;  3M59 A;  1TEZ A;  3ZHE A;  4BX8 A;  2NYJ A;  5TTF A;  1X5B A;  4DRX E;  1H6O A;  1KPS B;  4BTA A;  3ZXS A;  4F6R D;  2DCP A;  3UM1 A;  5JIY A;  5CED B;  4I6J A;  3Q75 A;  4FJZ A;  3U64 A;  2P9I G;  1ELR A;  3RK6 A;  3AG2 E;  1HZ4 A;  3EIJ A;  4OVV A;  3CQG B;  2QYU A;  3CIA A;  1Z5S C;  1KT0 A;  3DPY A;  2X6K A;  4Q94 A;  5FZS A;  3FUK A;  3L82 A;  2JV0 A;  2WXR A;  2XPZ A;  4LNG A;  4J6I A;  4J7F A;  2RFA A;  1JCR A;  4CDM A;  4F1P A;  1YYH A;  5KJN A;  5KJL A;  5HS0 A;  4EZL A;  5JHN A;  3G2V A;  3NOG D;  4TRQ A;  1KZP A;  4DLQ A;  2VTB A;  2Y0B G;  3QWW A;  3HVE A;  4R7L A;  3M5A A;  2IF4 A;  4J7I A;  4KVM A;  3SBT B;  4KT6 B;  1ELK A;  3CVV A;  5BPP A;  4ACL A;  4KYO B;  4A3V A;  3FUL A;  4CT0 A;  2AXZ A;  1BLX B;  1TJF A;  5ENS D;  4IJD A;  4L1B A;  4NJ5 A;  1N9A A;  4HBD A;  4W9R A;  5AEN A;  4O30 A;  1OCZ E;  2QPW A;  3OXF A;  3MX3 A;  3PZ4 A;  4BES A;  4FLH A;  3C5R A;  4PH4 B;  1E8X A;  1N4S A;  4YVQ C;  4EPZ A;  4GYY A;  2VGE A;  4O1O A;  4G23 A;  3ZYQ A;  1WM5 A;  1FVH A;  1BPO A;  2WXO A;  4HVB A;  1IKN D;  3DPD A;  3AU4 A;  3SFY A;  4G8L A;  4B94 A;  3DEO A;  5AQA A;  2FO1 E;  1N4P A;  2KXP C;  3C72 A;  3Q49 B;  4I51 A;  1TNB A;  1A5E A;  4YPA A;  3TWW A;  4F7A A;  4HLL A;  3EU9 A;  2Y69 E;  3PUJ A;  4AJW A;  2R02 A;  3CST A;  2BKG A;  4L23 A;  3UUX A;  3LY7 A;  2OV8 A;  4XI9 A;  2XEH A;  1GW6 A;  3ULY A;  1G3N B;  1Z3X A;  3ASN E;  1Z3Y A;  5CEA A;  1N4R A;  4GAA A;  3APC A;  2NC9 A;  1SW6 A;  3D9N A;  5JJ0 A;  5FIO A;  1HH8 A;  2OVF A;  4YNM A;  2MRI A;  4GZ3 A;  1XNF A;  4E47 A;  3PDN A;  2P9U G;  5CEC B;  3PEV B;  5ITZ F;  1H6K A;  2X6F A;  3ESL A;  3GZ1 A;  3KSL A;  3M57 A;  2AWI A;  3FH8 A;  4AVX A;  1O1T A;  2GRQ B;  4FAD A;  1JUQ A;  2IO3 C;  3T8K A;  2GRL A;  2P9L G;  3APD A;  1H6P A;  5CBN A;  5BUZ A;  3ZUV B;  1EYH A;  3RQ4 A;  3QAQ A;  5LP0 A;  1BI8 B;  4K5B A;  4XZ4 A;  5FJY A;  4K03 A;  3ONL A;  4GZD A;  1UW4 B;  4MS6 A;  2VSN A;  3UM3 A;  3RO2 A;  3CVX A;  4UWF A;  1HG2 A;  2BKK B;  4Q69 A;  4JHR A;  3ABK E;  4I6G A;  5T8I A;  4QEO A;  4RSY A;  5CMY A;  3NBN B;  4YPE A;  4I2W A;  3BG1 B;  2KCK A;  4QFV A;  4GTR A;  1VDY A;  5E75 A;  1ZB1 A;  3M53 A;  3JXJ A;  3D9L A;  3TG4 A;  2IQC A;  4BT8 A;  2J4B A;  2IFU A;  3K9I A;  4JW1 A;  4DPR A;  3ISM C;  3UTM A;  3FUF A;  1INZ A;  3SFZ A;  4GZ5 A;  3QAR A;  5ENP D;  3WXX A;  4GML A;  5ENT D;  1WG0 A;  4LEU A;  1FT2 A;  1U2V G;  5EKQ D;  2J08 A;  2CFU A;  4GTV A;  3LS8 A;  1PY1 A;  3UM0 A;  1MYO A;  2F8Y A;  4LUN U;  2LAH A;  3VTX A;  5G55 A;  2V5Q C;  5EID A;  3LPZ A;  2R3A A;  1K3Z D;  2WMN A;  3MYV A;  3DST A;  3PE4 A;  5F5E A;  2F8X K;  1N6A A;  2GRN B;  2LXM A;  3HXB A;  3EIQ C;  4ANW A;  5F59 A;  5G05 C;  4V3I A;  2GRR B;  1UJJ A;  4PUC A;  2Y4T A;  3IHX A;  2AW6 A;  3NB2 A;  3VTY A;  3G2S A;  1MZC A;  3DSX A;  2P2C P;  3AJI A;  4K0R A;  2XHE A;  4HOT A;  4XX5 A;  3CVQ A;  2C0L A;  4HOU A;  4HXI A;  4AP2 A;  2IEJ A;  2WQ6 A;  4ILH B;  3FTX A;  1DVP A;  3JQ0 A;  4ZHB A;  5J90 A;  4DI3 A;  3PRE A;  3JUI A;  3S7J A;  3F6Q A;  4J8S A;  2WQH A;  3SGH A;  2EIM E;  4B93 B;  4HOS A;  1N95 A;  3D9O A;  4AEZ C;  2C2L A;  3CBP A;  3FU5 A;  4RG6 A;  3TWS A;  2YQ8 A;  2KZT B;  5E76 A;  3SO8 A;  3CVL A;  4IJ8 A;  2H6F A;  4WNF A;  1HF8 A;  2JAB A;  5HKP A;  4F3V A;  4C9B B;  3DWL G;  4UI9 J;  2UWJ G;  4UI9 C;  1TNO A;  3CVW A;  3MO0 A;  1OWP A;  3UPV A;  3SQV A;  4CDR A;  1ZBP A;  2OEV A;  3FU0 A;  2RKK A;  2PM7 A;  3Q78 A;  1AWC B;  2YHE A;  3RAY A;  3ZW3 A;  5KNG A;  3N71 A;  4YVO A;  5D0Q D;  5D2M C;  3M55 A;  3CVN A;  5FQ6 A;  2XPY A;  4P29 A;  1LD8 A;  3MEK A;  1OY3 D;  3RRU A;  2A5U A;  5AJL A;  3PUK A;  5F6K C;  4DX2 A;  4MRU A;  3CR3 A;  5CRV A;  3SZ7 A;  3HXC A;  3FDH A;  4EZK A;  3WG7 E;  4BY6 A;  3FTU A;  1OUV A;  3LXU X;  4A63 B;  2X6H A;  4WNE A;  4TXR A;  3Q9U C;  2XCB A;  2AJA A;  3T5V A;  3V31 A;  4U8Y D;  4I1A A;  5LOZ A;  3FUM A;  2LSV A;  3ZHE B;  3K5K A;  3D9K A;  4GCO A;  2I6H A;  4A1G A;  4CCA A;  4MI5 A;  3SI5 A;  3GW4 A;  2DZN A;  3PZD A;  4EZJ A;  3W9F A;  2XPI A;  4HQD A;  3ZKJ A;  2PNN A;  3EJN A;  4Y6W A;  4NAC A;  4BWR A;  1LD7 A;  1XGW A;  2YIN A;  3IHV A;  5CPR B;  2L6J A;  2EIN E;  4L2L A;  2F69 A;  2WM9 A;  2WXJ A;  4G2V A;  3KEA A;  2LO6 A;  3Q5M A;  3V79 K;  3O48 A;  3KSQ A;  3HNA A;  3IEG A;  3RRM B;  3UT7 A;  5LSZ A;  1EPU A;  4UWK A;  2WXG A;  3F9Y A;  1U3D A;  1AP7 A;  2WMO A;  4DK5 A;  4I17 A;  1QZ2 A;  4BX9 A;  4MLP A;  4FHJ A;  3FFL A;  2OOE A;  2MYO A;  4GA1 A;  3UM2 A;  4IYP A;  1S70 B;  3G2T A;  2VTB B;  1DCQ A;  3HVE B;  3SW9 A;  5JIN A;  1N54 A;  4YNP A;  1WY6 A;  4HOQ A;  3CBM A;  2V8S E;  3QKY A;  2IY0 C;  2HYZ A;  3B7S A;  4U04 A;  2ETB A;  4AXH A;  3PNL B;  3UMV A;  3DSU A;  1YCS B;  5BW8 C;  1NFI E;  3AS4 A;  4FLB A;  1SA4 A;  1NL4 A;  3S7D A;  1TNZ A;  2CG2 A;  2R59 A;  3DSW A;  1P5Q A;  4H12 A;  5ENO D;  4EEC A;  4FUL A;  3MV3 B;  4BER A;  5BXO A;  1S63 A;  4LCT A;  3Q9N C;  2DVW A;  3AU5 A;  4XEI G;  4A55 A;  5FIN A;  3I4G A;  5EYP F; 
#chains in the Genus database with same CATH homology
 2OV8 A;  2XGS A;  4XI9 A;  1E8Y A;  5C1D A;  2M63 A;  2E0I A;  3FUJ A;  1GW6 A;  5G04 J;  5G04 C;  2IJG X;  4J0U A;  1H2T C;  3LY9 A;  5A7D B;  4M3O A;  3MJW A;  5LX8 A;  1Z3X A;  2CHW A;  3ENE A;  3F9Z A;  4GA2 A;  1PAQ A;  3CEQ A;  1MHQ A;  1Z3Y A;  4WNG A;  2ILR A;  2XGM A;  4GYO A;  4U0Z A;  4AY6 A;  4EQF A;  2L0I A;  4NUR A;  2OND A;  4RG9 A;  1LF8 A;  3LKU A;  4CGV A;  1ZKK A;  5T4Y A;  3CKB A;  4JZY A;  2L9B A;  3GZ2 A;  3I5P A;  4NRH B;  4JEU A;  3ASG A;  3RJW A;  4GAA A;  2GRM A;  3APC A;  3BEE A;  4ILI A;  4ABN A;  2JEK A;  4G24 A;  3IBE A;  3C98 A;  4QEP A;  1EF1 C;  2NC9 A;  3D9N A;  5JJ0 A;  2LNI A;  4O6F A;  3CV0 A;  3R7Q A;  1HH8 A;  2OVF A;  4YNM A;  2MRI A;  4FC8 A;  2KM4 A;  4GZ3 A;  1QNF A;  3TAX A;  3FPD A;  1XNF A;  4E47 A;  3PDN A;  3Q47 B;  4PS8 A;  5DBK A;  4N3C A;  3PEV B;  4WUY A;  3LDZ A;  1H6K A;  2LAI A;  2X6F A;  2L0T B;  3ESL A;  3GZ1 A;  1OWN A;  1UG3 A;  4HFG A;  3CLJ A;  4U0U A;  4GYW A;  2AWI A;  1L5J A;  4B8A A;  2V5F A;  5FQ7 A;  1B89 A;  2YNQ A;  3TXN A;  2X6I A;  3KEZ A;  4ANX A;  4CGW A;  3FH8 A;  4AVX A;  2VSX E;  3CVY A;  1WAO 1;  3U3W A;  4FAD A;  1FCH A;  3LY8 A;  5HQ8 A;  2IGQ A;  2KCL A;  1JUQ A;  4I6E A;  5BT1 A;  3OTN A;  2GRL A;  2P58 C;  3D9P A;  3RKV A;  3UT4 A;  3APD A;  4UWG A;  3FEY A;  5JJ6 A;  4N2S A;  4I9E A;  5BUZ A;  4C1Q A;  1EYH A;  3CSF A;  1HS6 A;  2R17 C;  3Q4A B;  4JC8 A;  4L2Y A;  3RQ4 A;  3S8P A;  2FUL A;  3QAQ A;  5TEG A;  5LP0 A;  3G2W A;  5ANL A;  5FQ4 A;  3KMJ A;  3NF1 A;  4J8E A;  3SWC A;  3LVQ E;  5KJK A;  4XZ4 A;  5FJY A;  2KCV A;  4K03 A;  3NQP A;  3ONL A;  3FUD A;  4GZD A;  2VQ2 A;  4UQX A;  5FZQ A;  4ATG A;  2CHZ A;  1OWO A;  3S7B A;  1H2V C;  4J8O A;  1UW4 B;  4MS6 A;  2VSN A;  4GMJ A;  3MCX A;  5KJM A;  3F9W A;  4N3A A;  3RO2 A;  1KLX A;  3CVX A;  2RD0 A;  3I4R B;  4UWF A;  4KXK B;  3SBS A;  3M57 A;  2R5S A;  4GZC A;  1HG2 A;  2ION A;  4PS3 A;  2RG8 A;  4BTB A;  4JHJ A;  4JXT A;  2WXM A;  3ZYL A;  4Q69 A;  4JHR A;  5EX0 A;  3ASD A;  3QWV A;  4UWL A;  4I6G A;  5T8I A;  4QEO A;  3FP3 A;  3VV0 A;  4RSY A;  3UX4 A;  1E7V A;  1N6C A;  3PH0 C;  2GW1 A;  5AIJ A;  5CMY A;  2Y3A A;  4PS7 A;  4APF A;  2VJ8 A;  4YPE A;  4E85 A;  2PM6 A;  3IKO B;  1KT1 A;  3FUE A;  3MV2 B;  3U4T A;  2O8J A;  4I2W A;  3BG1 B;  3CVU A;  3ASF A;  2KCK A;  4JA9 A;  5ENN A;  2RFI A;  4WWO A;  4G25 A;  3R7R A;  4QFV A;  3G2U A;  1VDY A;  4A3T A;  4B8C B;  1NP7 A;  4FJY A;  4BT9 A;  5EG2 A;  5E75 A;  3ZGQ A;  3QOU A;  3CHR A;  3M53 A;  4AY5 A;  3B7R L;  3D9L A;  3TG4 A;  2X3M A;  2IQC A;  4WND A;  5FZR A;  4BT8 A;  2J4B A;  4AM9 A;  4APO A;  3HHM A;  4JPS A;  5BNW A;  3Q15 A;  3ZVV A;  3HIZ A;  2IFU A;  1SZ9 A;  3K9I A;  4HLE A;  4JW1 A;  4DPR A;  1NA3 A;  1U3C A;  3L6A A;  2BQZ A;  4GA0 A;  3FUF A;  1JWG A;  3FY4 A;  1INZ A;  4U8H A;  3SD5 A;  1OWL A;  3SFZ A;  4GZ5 A;  5ANR A;  3CKC A;  3QAR A;  3QK0 A;  1EDU A;  3WXX A;  2FEZ A;  3CHP A;  4GML A;  2IOL A;  3UQ3 A;  2FO7 A;  4LEU A;  1OWM A;  3TJP A;  2WXP A;  4Q96 A;  1HXI A;  3FWV A;  5T3R A;  2WB2 A;  5EKQ D;  1ZU2 A;  2XQ0 A;  3EHN A;  2J08 A;  1UN9 A;  1HO8 A;  4UI9 K;  4CEM A;  3KMA A;  2CFU A;  2Y4U A;  3ZEF A;  3FTS A;  1UN8 A;  3LS8 A;  5ARG A;  3KAE A;  3QDN A;  1PY1 A;  4AOF A;  3M58 A;  3TGO A;  4J8D A;  2J07 A;  4LUN U;  3P2B A;  2ZU6 B;  2LAH A;  2AXV A;  3VTX A;  5FWQ A;  2A4Z A;  5G55 A;  4AIF A;  4CT4 A;  1S0P A;  2VYI A;  3LPZ A;  3O4Z A;  3CGH A;  3I3N A;  2R3A A;  1QQE A;  4I43 A;  3L17 A;  1TJC A;  2NXP A;  2WMN A;  3MYV A;  2J4D A;  4PDX A;  3PE4 A;  3EHM A;  4G26 A;  5F5E A;  3SF4 A;  4BSX A;  2WXI A;  2VGY A;  1N6A A;  3CK7 A;  3LJ3 A;  5AYW D;  3MGB A;  3T8M A;  5BV1 A;  1IQR A;  3EIQ C;  1PEG A;  4QEN A;  1E8Z A;  4ANW A;  1NA0 A;  3P1U A;  5F59 A;  3S2A A;  3MZL B;  1W3B A;  2FF4 A;  3DBS A;  5G05 C;  3RJV A;  4GU5 A;  3IV0 A;  4V3I A;  5T5G A;  3RU0 A;  2I9C A;  1E90 A;  3ML8 A;  5T0K A;  1UJJ A;  2WXF A;  3JCK C;  4PUC A;  5EX3 A;  2I2O A;  2Y4T A;  3L54 A;  5HI7 A;  3ZYK A;  4ACK A;  3IHX A;  2AW6 A;  4A1S A;  4E6H A;  2I1K A;  3VTY A;  3G2S A;  3CBP A;  2AXU A;  2HR2 A;  3GZS A;  4WAF A;  3M54 A;  4I2Z A;  1MT6 A;  1N52 A;  4CDN A;  2WPV A;  4K0R A;  3UUX A;  2XHE A;  4U07 A;  4HOT A;  4TV3 A;  2I1J A;  1SQM A;  2MOW A;  4XX5 A;  2VGX A;  3CVQ A;  3DAL A;  3RIB A;  4ANU A;  3F9X A;  3BO5 A;  2KZT A;  3MKQ A;  3OPE A;  2C0L A;  3CHQ A;  4HOU A;  2GGF A;  4HXI A;  3FUN A;  3MKR A;  4AP2 A;  4JHK A;  4EBA A;  2UY1 A;  3QB2 A;  3E4B A;  4H7X A;  2MHK A;  2WQ6 A;  4ILH B;  2PQN A;  4C0E A;  3CVP A;  3KS2 A;  2XGO A;  3ZPJ A;  3OOI A;  2OVB A;  4YND A;  3BG0 B;  3FTX A;  4UQY A;  5A6C A;  1DVP A;  2XCC A;  2KAT A;  5JJ7 A;  2WXK A;  3JQ0 A;  3ASH A;  2BTD A;  4WWN A;  5J90 A;  3OS5 A;  5JHA A;  4ANV A;  4DI3 A;  4U0S A;  3PRE A;  3JUI A;  2HM8 A;  3S7J A;  1YA0 A;  2Q7F A;  1DNP A;  4J8S A;  3L13 A;  4LER A;  2WQH A;  4JDS A;  3SGH A;  4ILG A;  3ZRH A;  5LFA A;  3FTW A;  2BUG A;  4HOS A;  5AJD A;  3FU3 A;  4EBA G;  3D9O A;  2FI7 A;  5J08 A;  4AEZ C;  5M72 A;  2VGX B;  2C2L A;  4NQ0 A;  4BUP A;  3IHY A;  4GZ6 A;  3FU5 A;  4RG6 A;  3ZN3 A;  2QFC A;  3RRN B;  4N2Q A;  2YQ8 A;  3APF A;  3OAW A;  2KZT B;  3MKQ B;  5E76 A;  4DJA A;  3CVL A;  2WXH A;  4IJ8 A;  4I1O B;  4Y6C A;  2J49 A;  2CHX A;  4WNF A;  1HF8 A;  3CQC B;  1E96 B;  5CMW A;  4XI0 A;  4D10 C;  3CK8 A;  2UY1 B;  3L22 A;  4B0Z A;  4DI4 A;  4F3V A;  3CHO A;  3ONK A;  4KZC A;  4C9B B;  1O9S A;  4JLG A;  4LDG A;  1HG5 A;  2UWJ G;  4UI9 J;  4UI9 C;  3AS5 A;  2G46 A;  3CVW A;  4H7Y A;  1IQU A;  4BFR A;  3MO0 A;  1OWP A;  2IOS A;  3VLF A;  3UPV A;  4XKC A;  3D9I A;  4CDR A;  1ZBP A;  3FU0 A;  4MKT A;  5CCL A;  3CBO A;  4KMO A;  2PQR A;  4N3B A;  1IYG A;  2X38 A;  2PM7 A;  2X6J A;  4J8F A;  4L7T A;  5CCM A;  5FT9 A;  1ML9 A;  4AU7 A;  5ARF A;  2CFZ A;  3ESK A;  2YHE A;  5KCM A;  3RAY A;  3R9A B;  1A17 A;  1MUF A;  3ZW3 A;  3N71 A;  3JQ1 A;  4YVO A;  5D0Q D;  3VLD A;  1Y6I A;  2XRY A;  3M55 A;  1ELW A;  3CVN A;  2V0P A;  3EDT B;  3FTY A;  4KBQ A;  2XPY A;  4JEH A;  4U63 A;  3B7T A;  3ML9 A;  4P29 A;  5FQ6 A;  2WQ7 A;  5C2Y A;  3CHS A;  4FP7 A;  3MEK A;  3NZS A;  5DIZ A;  2A5U A;  3RRU A;  2QY7 A;  5AJL A;  3PUK A;  3CK9 A;  4G1T A;  1MQS A;  5A23 A;  1E8W A;  5F6K C;  2IU1 A;  4I9C A;  3M59 A;  3TXM A;  2V4L A;  3D3M A;  1TEZ A;  4OVU A;  4IUL A;  4B89 A;  4MRU A;  3ZHE A;  4BX8 A;  3FHE A;  3CR3 A;  3SZ7 A;  5TTF A;  1X5B A;  4FHK A;  4TUU A;  2DBA A;  3FDH A;  3PE3 A;  4UQZ A;  3LCA A;  5CHE E;  4BTA A;  4EZK A;  2CG3 A;  3ZXS A;  4BY6 A;  2DCP A;  2XRZ A;  3FTU A;  5JIY A;  3MO5 A;  1OUV A;  1NZN A;  4OYS A;  4I6J A;  3LXU X;  4FJZ A;  2X6H A;  2XEV A;  4WNE A;  3CHM A;  3U64 A;  3MO2 A;  3HYM B;  1ELR A;  2KC7 A;  3RK6 A;  5G2N A;  2JLB A;  2XCB A;  4F1S A;  3T5V A;  4AV7 A;  1HZ4 A;  3EIJ A;  4OVV A;  3CQG B;  3FTV A;  1MVX A;  3L16 A;  4XE0 A;  4FU3 A;  3CIA A;  3ZIM A;  4HS2 A;  5TH7 A;  1KT0 A;  2X6K A;  4I1A A;  5LOZ A;  2DIW A;  3FUH A;  3FUM A;  2LSV A;  4ME2 A;  4Q94 A;  5FZS A;  5G05 J;  3ZHE B;  2LSU A;  3D9K A;  2I6H A;  3FUK A;  4GCO A;  2JV0 A;  1H0A A;  4J83 A;  4Z4P A;  4A1G A;  4CCA A;  3JYS A;  4KVO A;  2WXR A;  2XPZ A;  4J6I A;  4MI5 A;  2AVP A;  4J7F A;  3SI5 A;  3KD7 A;  1E7U A;  1SZA A;  1JWF A;  3FU6 A;  2NSZ A;  3GW4 A;  3K5K A;  3D9M A;  3S7F A;  4CDM A;  1H19 A;  3PZD A;  3SNX A;  4GB9 A;  1XQH A;  3QJZ A;  5KJN A;  4EZJ A;  4XKB A;  2XPI A;  4DLO A;  5KJL A;  4JL0 A;  3QNK A;  4UWH A;  4EZL A;  3RO3 A;  3EJN A;  4Y6W A;  4F53 A;  5AYF A;  3PRZ A;  5JHN A;  3URZ A;  3G2V A;  4NAC A;  2VSO E;  3U9W A;  4BWR A;  3TG5 A;  4KZ0 A;  4JVS A;  3VUZ A;  1UJK A;  1XGW A;  4TRQ A;  2WXL A;  2YIN A;  3D9J A;  3IHV A;  3OXG A;  5BV0 A;  4DLQ A;  5CPR B;  3AS8 A;  2VTB A;  4GCN A;  2L6J A;  4L2L A;  2F69 A;  1H3I A;  2WM9 A;  3QWW A;  3HVE A;  4R7L A;  4N5C A;  1HE8 A;  1Y8M A;  2WXJ A;  4G2V A;  4CRW A;  3M5A A;  3M56 A;  2IF4 A;  4J7I A;  2LO6 A;  3Q5M A;  1HU3 A;  4IRU A;  3O48 A;  4KVM A;  2BF0 X;  2J9Q A;  3LY7 A;  3SBT B;  3ZYM A;  2PL2 A;  4IN3 B;  1ELK A;  1HX8 A;  3FH5 A;  3GYZ A;  4KT6 B;  3FTZ A;  3IEG A;  3SHF A;  3CVV A;  3HNA A;  5BPP A;  3RRM B;  4ACL A;  4KYO B;  3FUI A;  3UT7 A;  5LSZ A;  1EPU A;  4JA7 A;  3UT8 A;  4UWK A;  4A3V A;  3KMT A;  2C0M A;  3QWP A;  2WXG A;  3FUL A;  3LEW A;  2WVI A;  1U3D A;  4CT0 A;  2AXZ A;  3F9Y A;  5FQ8 A;  2WMO A;  3PNT B;  4DK5 A;  4I17 A;  1QZ2 A;  4BX9 A;  1TJF A;  4MLP A;  4FHJ A;  4G11 A;  4IJD A;  3B7U X;  3FFL A;  2OOE A;  4L1B A;  4FMU A;  4NJ5 A;  3T5X A;  1PC2 A;  4W9R A;  5D0O D;  5AEN A;  4GA1 A;  4O30 A;  3VLE A;  5JJT A;  2QPW A;  3LVR E;  3OXF A;  4IYP A;  4URK A;  3MX3 A;  2W5Y A;  4FLH A;  2E2E A;  4PH4 B;  3G2T A;  1E8X A;  2VTB B;  5F6L A;  1HFA A;  3PVL A;  3DB5 A;  3QC1 A;  4YVQ C;  4EPZ A;  5JHB A;  3HVE B;  4GYY A;  3SW9 A;  5JIN A;  1N54 A;  3FEX A;  3MA5 A;  4G23 A;  3NZU A;  3ULQ A;  3ZYQ A;  4YNP A;  1WM5 A;  2WXN A;  4YPU A;  1WY6 A;  1FVH A;  4HOQ A;  2V8S E;  3QKY A;  3CBM A;  4I1M A;  1BPO A;  2HYZ A;  4MI0 A;  2WXO A;  3EP0 A;  1JPL A;  4HVB A;  4XIF A;  3B7S A;  4U04 A;  4HOR A;  2W5Z A;  3DPD A;  3TL5 A;  4RZ0 A;  5LSX A;  3B13 A;  2EQX A;  3PEU B;  3PNL B;  4AXH A;  3UMV A;  3L08 A;  5T0M A;  2J09 A;  4FA6 A;  2HO1 A;  2VSY A;  3HDX A;  3AU4 A;  3PS6 A;  5BW8 C;  3AS4 A;  4GPK A;  4FLB A;  4B94 A;  2YHC A;  4LRZ A;  1Z6T A;  3Q49 B;  3OXL A;  3S7D A;  2FBN A;  4I51 A;  1FVF A;  5LCW J;  5LCW C;  1IHG A;  4RVB A;  2CG2 A;  2R59 A;  1P5Q A;  4H12 A;  1H2U A;  4YPA A;  4EEC A;  4F7A A;  4FUL A;  3MV3 B;  4WWP A;  1MVH A;  3FH7 A;  3U66 A;  1N3J A;  4C0M A;  4NVQ A;  3LYA A;  5FTP A;  4LCT A;  3PUJ A;  4N39 A;  3ZFW A;  4AJW A;  5EDS A;  3AU5 A;  2PZI A;  3CST A;  4A55 A;  4L23 A;  3I4G A;  2WXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...