3QWWA

Crystal structure of histone lysine methyltransferase smyd2 in complex with the methyltransferase inhibitor sinefungin
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
430
structure length
430
Chain Sequence
AEARGGLERFCSAGKGRGLRALRPFHVGDLLFSCPAYACVLTVGERGHHCECCFARKEGLSKCGRCKQAFYCDVECQKEDWPLHKLECSSMVVLGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVREFESHLDKLDNEKKDLIQSDIAALHQFYSKYLEFPDHSSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGDEVFTSYIDLLYPTEDRNDRLRDSYFFTCECRECTTKDKDKAKVEVRKLSSPPQAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALKYGQKIIKPYSKHYPVYSLNVASMWLKLGRLYMGLENKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SET and MYND domain-containing protein 2
publication title Crystal structures of histone and p53 methyltransferase SmyD2 reveal a conformational flexibility of the autoinhibitory C-terminal domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 150
structure length 430
sequence length 430
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3qwwA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3qwwA01
4GZ5A 4U0ZA 3TG5A 4U0UA 4J7FA 2UY1A 2FI7A 4WNGA 3QOUA 5ARGA 3ZHEA 1KT0A 3BEEA 3Q47B 3KMJA 4QEOA 1MT6A 3U3WA 3CKBA 2FF4A 3VTXA 4BWRA 5T0MA 3ZPJA 2VGXB 5LCWJ 2KATA 1NZNA 3CVQA 5FZRA 3DALA 4NJ5A 2XEVA 4I17A 4N3CA 5D0OD 5D0QD 4ABNA 4UQXA 5G04J 5JHNA 4JA7A 2VGYA 4I1AA 2C0LA 3N71A 4C1QA 3RU0A 2XGMA 3M55A 3CK8A 2XPIA 3M5AA 2IF4A 3ZN3A 3VV0A 3MKRA 4YPUA 4KBQA 3QWWA 1KT1A 4ME2A 4IJDA 1Y8MA 2IFUA 3CV0A 2F69A 5CHEE 5HQ8A 1NA3A 4XIFA 3EP0A 1NA0A 3LKUA 5FZQA 3O48A 3ZGQA 4I2WA 3RJVA 4CGVA 4WNDA 3F9XA 1FCHA 3RKVA 3CVLA 3UUXA 5EX3A 4G24A 3Q49B 3R9AB 3KD7A 4LEUA 5EKQD 3M53A 1ZBPA 4J8OA 1A17A 3FP3A 3CVNA 4HORA 2VQ2A 2QFCA 1ML9A 3FPDA 2VSYA 3CKCA 3F9ZA 2AVPA 4JA9A 4J0UA 3KMTA 3TG4A 5HI7A 3TGOA 5TEGA 2G46A 5ARFA 5JINA 1QQEA 2HO1A 3SWCA 3ASDA 4JHRA 5JIYA 4AM9A 5C1DA 1H3IA 3S7FA 5DBKA 3BO5A 3PE4A 5M72A 4A1SA 4GA1A 2PL2A 4YVOA 4F3VA 3S8PA 4LDGA 3RIBA 5F6KC 3CEQA 4APOA 1TJCA 3KS2A 3UQ3A 1O9SA 2BQZA 3IEGA 4HOUA 4B94A 4YNDA 5T5GA 2PZIA 4J8FA 4GCOA 4W9RA 4Z4PA 4I2ZA 3HYMB 4XI0A 5KJLA 1HH8A 1ZKKA 1HZ4A 2O8JA 3CBMA 4WNFA 4WNEA 2XCBA 3OXFA 3MV2B 3IHXA 3GZ1A 2YQ8A 4O6FA 3QDNA 5BNWA 1W3BA 1XNFA 5CCLA 4G25A 4JDSA 5CPRB 1YA0A 1P5QA 3AS5A 4N2SA 3GZ2A 1N6AA 5TTFA 2Q7FA 1MVXA 2GW1A 2L6JA 4YPAA 4AU7A 4AY5A 5JJ0A 2C2LA 3RO3A 2VYIA 3NF1A 4YVQC 4G26A 2VSNA 1ZU2A 2E2EA 3ESKA 4YPEA 4RG6A 3RAYA 5LCWC 1HXIA 2P58C 2R3AA 4N2QA 4BT9A 2LNIA 4GZ6A 4N3BA 2W5ZA 3OXLA 5EG2A 3RJWA 2UY1B 3QWPA 3MO0A 3ZFWA 3ZHEB 5F59A 4J8DA 2XGSA 4U07A 3TAXA 5KJKA 3FFLA 4AY6A 3URZA 3Q4AB 4HOQA 3CK7A 1WM5A 4NRHB 5FZSA 4CGWA 4RZ0A 3OS5A 2KCKA 4JLGA 4Y6CA 3HNAA 3M57A 4H7XA 3MEKA 3SZ7A 2KCLA 4GZ3A 3F9YA 4GYOA 2PQNA 2J9QA 4UI9C 3F9WA 3U4TA 3OPEA 5G05C 2LSUA 5A6CA 3RQ4A 4IJ8A 4J7IA 5FT9A 4MI5A 2C0MA 3KAEA 5A7DB 4G2VA 2XGOA 4GYYA 4J8EA 5T0KA 5EX0A 2RFIA 1IHGA 5F5EA 5LSXA 3PE3A 2KC7A 3PDNA 5AYFA 3GYZA 2VGXA 3LY8A 4CDRA 2R5SA 3M58A 4GPKA 5TH7A 3CBOA 2DBAA 2NC9A 1E96B 5BW8C 3JYSA 3FWVA 4HOTA 5LSZA 3S7BA 3GW4A 2JV0A 2QPWA 4H7YA 2KCVA 4BTBA 5JJTA 3MA5A 1N6CA 4FMUA 1PC2A 3M54A 3LYAA 1KLXA 4N5CA 4Y6WA 5CCMA 4UQZA 4I9CA 2Y4UA 5KJMA 3UPVA 2FBNA 4I51A 5FTPA 3ASGA 3MV3B 4E47A 3CBPA 3ULQA 2WQHA 4EQFA 2MHKA 4YNMA 4WUYA 1ELWA 4U04A 3ASHA 2ONDA 5BT1A 3S7JA 5JJ7A 2IGQA 4MI0A 3LPZA 3QWVA 4GA0A 3DB5A 2UWJG 3LCAA 2JLBA 2FO7A 4IN3B 2HYZA 2HR2A 3M56A 4O30A 3LY9A 4H12A 3OXGA 1XQHA 2BUGA 3EDTB 3MO5A 5G04C 3WXXA 3OOIA 4HOSA 3SF4A 5KJNA 1B89A 1OUVA 2PQRA 4GCNA 4N39A 2YHCA 5AYWD 4BT8A 2V5FA 4UQYA 2W5YA 2XCCA 3Q5MA 4I9EA 5F6LA 4YNPA 3VTYA 2LSVA 5FJYA 4UI9J 5G05J 4N3AA 1QZ2A 1WAO1 3E4BA 3M59A 3VUZA 4XI9A 3KMAA 3AS8A 2OOEA 1PEGA 1MUFA 2Y4TA 4J83A 4BUPA 4UI9K 5JJ6A 4NVQA 3QKYA 4G1TA 4AIFA 3Q15A 3CK9A 3K5KA 1N3JA 2FEZA 2WPVA 4JL0A 4NQ0A 4BTAA 5DIZA 4U0SA 4KXKB 1MVHA 3ASFA 4GYWA 1ELRA 4QENA 3MO2A 3SW9A 2I6HA 4GA2A 4QEPA 4G23A 1IYGA 3RO2A 3AS4A 3S7DA 4KYOB 3LY7A 4RG9A 3CVPA 3K9IA
chains in the Genus database with same CATH superfamily
4JHKA 3G2UA 5AQAA 4U0ZA 3PZDA 5KWDA 2UY1A 2FI7A 4WNGA 1Z6TA 3R7QA 5ANRA 3BEEA 1V54E 1UW4B 4HS2A 1NFIE 1BPOA 3DSTA 3Q47B 4FULA 1DCQA 1H2UA 1MT6A 3CKBA 4F1PA 4QQIA 1RZ4A 2OVFA 3L17A 3MZLB 2H6GA 4I6EA 5T0MA 3ZPJA 1V55E 2J4DA 2VGXB 4LERA 2KATA 2XEVA 4GTMA 5D0OD 1YYHA 4J7WA 4GTSA 3DBSA 2OEWA 1JCQA 4OVVA 3DRAA 5ENSD 4C1QA 3RU0A 3I4RB 4ANXA 3QB2A 4DJAA 1OWMA 3MKRA 4YPUA 1KT1A 1K8KG 1JWFA 1WY6A 4Z68A 3WG7E 5CHEE 1D9SA 3TWRA 3ZYQA 3Q7FA 1AWCB 3FU6A 4I2WA 1UN8A 3ISMC 2BKGA 5EX3A 3UUXA 4G24A 3R9AB 5T8IA 1ZBPA 5LP0A 4J8OA 1A17A 3FP3A 3QNKA 3L22A 4HORA 2VSYA 5CMYA 2AVPA 4JPSA 4ANWA 3UM0A 3BUAA 2XZTG 3TGOA 2IU1A 5TEGA 3PEVB 2VTBA 5BPPA 5ARFA 4C9BB 4TXQA 3B95A 3PVLA 3E37A 3GZSA 1TN8A 2CFZA 5T3RA 5DBKA 3C98A 2X6KA 2X38A 3DXMG 4HLEA 2ETAA 2X6IA 3NB2A 1OWPA 3F6QA 4GA1A 2PL2A 4YVOA 3Q73A 3D9NA 4LDGA 3JQ0A 5BXOA 1OWNA 4MKTA 3CEQA 1EF1C 1TJCA 4HBDA 2YNQA 2BEDA 1O9SA 3UX4A 3CSFA 2IQCA 4YNDA 3UM1A 5FQ8A 5AJLA 4RQIA 3ULEG 2H6HA 1WG0A 3P1UA 1DC2A 1MYOA 4W9RA 4Z4PA 4XI0A 3I5PA 1UG3A 1HZ4A 3CBMA 3FH8A 4FHKA 3ASOE 3MV2B 3TWVA 5A23A 5EIDA 4CRWA 3QDNA 4GMRA 3D9KA 4JDSA 2WXOA 5TTFA 1MVXA 4U8YD 4KT6B 3ZVVA 2GGFA 3CGHA 2C2LA 3CVWA 3RO3A 2LXLA 2RG8A 2VYIA 3UT4A 3Q9NC 4GU5A 4U95D 2R3AA 4LRZA 4FADA 3D9MA 5CBOA 4FLHA 3QWPA 4GMLA 3ZFWA 4FJZA 2ZIRA 1N9AA 3URZA 3Q4AB 4HOQA 3T5XA 2A4ZA 2B6CA 1H2VC 2KCKA 2IY0C 2WMNA 3LXUX 5B1BE 3V2XA 4FLBA 4UI9C 3RQ4A 5A6CA 5LX8A 4TV3A 4J7IA 2WXPA 3KAEA 2L9BA 2RFIA 1X5BA 3PDNA 1OCRE 4OYSA 4AXHA 3SNXA 3SO8A 5ANLA 4EZJA 4GTVA 3M58A 2HE0A 4EPZA 1TEZA 3BG0B 2AXVA 5LSZA 5JHBA 2WXLA 2P9NG 3GW4A 3APCA 2QPWA 2V8SE 3MA5A 3C3RA 4V3IA 1PC2A 1YCSB 4LNBA 4A1GA 2Y4UA 5FTPA 3TWTA 1AP7A 4E47A 5E76A 3AG2E 4U7EB 4WWOA 4U63A 3L9TA 4XKCA 4JXTA 2MHKA 5D66A 4U04A 5JMND 1TN7A 2GRNB 4MI0A 4F53A 4GA0A 3ZUVB 1E8YA 2J08A 2HYZA 4O60A 3AG4E 2Y1LE 4U96D 3PNTB 2GRQB 1N4QA 4HNAD 1KZOA 3MO5A 3QJZA 1RW2A 3HVEA 4UWKA 5FQ6A 3ESLA 2AJAA 4B8CB 5KJNA 3UINC 1BI8B 2WXMA 4MLPA 1U3DA 2V5FA 5CEDB 4UQYA 1N0RA 2XCCA 4C0MA 4OAVB 2EIJE 1UJKA 5T4YA 3FHEA 4BSXA 1SVXA 1N94A 4UWFA 1O5MA 2OOEA 1PEGA 1MQSA 4J83A 4HRLA 1TJFA 3RRUA 3QKYA 4LG6A 3L6AA 1JPLA 3Q15A 3FTVA 2I2OA 3ULYA 2FEZA 3Q78A 4NURA 4BTAA 3D9PA 5KNHD 3R7RA 1H19A 3AJIA 1HG5A 1NI1A 1TR4A 3SW9A 3SGHA 4ACLA 3PUKA 2I9CA 3KSQA 4QEPA 1EPUA 4GTQA 2IOSA 1IYGA 2FULA 2RD0A 3S7DA 4EBAA 4KYOB 5EIBE 4NIKA 5ITZF 4K5CA 3CHSA 2WXIA 5FIOA 2X3MA 3VLFA 3PRZA 2MOWA 2IOLA 3OAWA 3QOUA 5LOZA 1ELKA 4C48B 2H6IA 3KMJA 1SQMA 4QEOA 4KMOA 3HG0D 3HXDA 3U3WA 4BSZB 3CQGB 3J5PA 2WXNA 3U64A 3VTXA 4DUIA 3D9JA 3MJWA 2LUHA 3CVQA 3DALA 4I17A 4N3CA 4EZKA 1JWGA 2XENA 2F8XK 5JHNA 4BERA 4I1AA 2P9LG 3N71A 2QY7A 2NYJA 2XGMA 3M55A 3E33A 2XEEA 1MJ0A 3CK8A 2XS8A 4J6IA 4JVSA 2B0OE 2IO3C 1LF8A 2XRYA 3QWWA 1E90A 2IFUA 4L23A 4A3TA 4XX5A 4N5QA 1MZCA 5FZQA 3RJVA 4WNDA 3FUDA 2KZTB 3CVLA 3Q49B 3KD7A 3U66A 3APFA 4TUMA 3SFYA 3R9MA 2VQ2A 2QFCA 3RAUA 2CHXA 4PUCA 3UKRG 4GAAA 3TG4A 5HI7A 2A5EA 3LJ3A 4RLYA 2P9PG 2G46A 2F0YA 4CEMA 3HXFA 3NAWA 2HO1A 3SWCA 4JHRA 3NQPA 2R2LA 3PE4A 3MYVA 4TRQA 4A1SA 4YDWA 2WB2A 4GB9A 5F6KC 2LO6A 4J8YA 3U9WA 3UQ3A 4ILGA 1UJJA 2BQZA 3FUFA 2AW6A 3MKQB 2BF0X 5T5GA 4DLOA 4J8FA 4GCOA 2GRMA 2GRRB 5KJLA 3TWXA 1VDYA 4OVUA 4WNEA 3OXFA 4WWPA 5G2NA 3TJPA 2IEJA 5CCLA 2X6HA 1BD8A 1P5QA 3AAAC 1LD7A 3FH5A 5C2YA 3GZ2A 3JQ1A 1N6AA 2CG3A 4JB8P 2L6JA 3DPYA 3FUJA 3CIAA 4YVQC 2EIME 1IKND 4YPEA 5AQBA 5LCWC 2P58C 4GZ6A 4YDOA 3EUVA 4K03A 2WXHA 2W5ZA 3V30A 3RJWA 4PS8A 3MO0A 4YDYA 3C72A 3ZHEB 4U07A 3C3OA 3FU3A 3C5RA 3CK7A 1TNOA 4LNGA 4APFA 4AJWA 3ASNE 3HNAA 2NXPA 4B89A 2AXZA 4H7XA 3SZ7A 2KCLA 4GZ3A 3QK0A 1OCZE 3FEYA 3IKOB 3ENEA 4GZCA 3U4TA 4IJ8A 2VJ8A 1OT8A 4MI5A 2V4HC 2OVBA 2C0MA 5FQ7A 2JABA 1FT2A 1N4SA 5T0KA 5EX0A 2A5UA 2EINE 3PE3A 2KC7A 2R02A 4LUNU 5AYFA 3GYZA 2VGXA 2CHWA 2YHEA 4CDRA 2R5SA 2ETCA 4GPKA 3CBOA 3EIQC 5BW8C 4ILHB 3JYSA 3FWVA 2J4BA 4HOTA 3S7BA 3W9GA 2Y0BG 4JEHA 4ANUA 4H7YA 1S0PA 4XZ4A 3TWSA 3NOGD 1OCCE 3M54A 4LSZE 3BG1B 3LVQE 3L82A 1KLXA 3SHFA 4Y6WA 3BU8A 5KJMA 3UPVA 2FBNA 4GMJA 2LAIA 3EHRA 4F6RD 3FU5A 5AENA 3EHQA 4F1SA 3Q75A 3ZU7B 4YNMA 5D2MC 3Q9UC 3ML8A 3B7RL 2ONDA 1SZ9A 5J08A 5JJ7A 3Q7AA 3DB5A 4ZFHA 3LCAA 1HS6A 1PAQA 2FO7A 4IN3B 3P2BA 3NZSA 4ZHBA 2HR2A 3LY9A 3UTMA 4H12A 5AJDA 3T9KA 1XQHA 2BUGA 3EDTB 2ZISA 5AARA 3OOIA 4E85A 3PZ2A 1OCOE 4A63B 3D3MA 3FU0A 4N39A 2R59A 4YNPA 1TN6A 4FHJA 2VSOE 4CDMA 4N3AA 1QZ2A 3M59A 4HRNA 1IXVA 2WXFA 4XI9A 4I43A 2QYJA 4DK5A 3CVXA 1MUFA 4JW1A 4E6HA 4RVBA 4K0RA 4G1TA 3OTNA 3IHVA 1N3JA 4HFGA 4IULA 3C3QA 1INZA 4EECA 2WPVA 4AOFA 3PS6A 2DZNA 1MVHA 2GRLA 4FJYA 1X81A 4GYWA 1ELRA 3FTZA 4QENA 3MO2A 3RRNB 3LJNA 2Y69E 3DEOA 5BV0A 4ANVA 3AS4A 1H6KA 4CT4A 3CVPA 1OY3D 3DPDA 3K9IA 3LVRE 4GZ5A 1HFAA 3TG5A 4J7FA 5KCMA 3ZXPA 5ARGA 4OAUC 3L08A 3CHPA 3ZNGA 3DSWA 3CHQA 1MX4A 2QYUA 2BKKB 4BWRA 3APDA 3I4GA 3SFXA 1SA5A 1H6OA 3CHMA 2J8SD 5LCWJ 3HDXA 3PZ4A 1NZNA 2NSZA 4NJ5A 3JUIA 1O1SA 4ABNA 2P9IG 3ABME 5G04J 2KBXA 4JHJA 4P29A 3JUEA 4JA7A 4L2YA 1N0QA 3CQCB 1E8WA 4EZLA 4DX5D 5JHAA 3L16A 1G3NB 4K5AB 4JD2G 2XPIA 3S2AA 3M5AA 3ZN3A 4WWNA 3VV0A 3ZKJA 4ME2A 1E8XA 3AU5A 2WXGA 1Y8MA 3DSUA 1SA4A 4TXPA 3KSLA 3G2VA 4XIFA 3PREA 3ZGQA 3ZIMA 5LFAA 5EILA 1FCHA 5KNGA 3RKVA 3UI2A 1H6PA 4A55A 4LEUA 5EKQD 5CBNA 5HRYA 3FTSA 1ML9A 4DX2A 3FPDA 3CKCA 3F9ZA 1FT1A 4JA9A 4J0UA 3KMTA 3SBSA 1EYHA 4XKBA 3G2SA 2QZAA 1S64A 3UMVA 5JINA 3LEWA 3ASDA 5JIYA 2XEHA 4AM9A 1H3IA 4GTOA 3QC1A 3FUHA 3FEXA 3PH0C 2M63A 5EN5D 4F3VA 3RIBA 5ENQD 3E30A 2R05A 3ZW3A 1MHQA 3PUJA 1LD8A 4C0EA 2WMOA 5CEAA 3IEGA 4B94A 5HS0A 2PZIA 1N11A 3ONLA 5BV1A 1IHBA 3NBNB 4I2ZA 3AG1E 1HH8A 2O8JA 2ZU6B 3UT7A 2LAHA 5AN8A 4L1BA 2XCBA 5E75A 1K1AA 3IHXA 2P9SG 2YQ8A 4O6FA 1TYQG 4CDNA 1W3BA 1XNFA 5CPRB 3E34A 1YA0A 4N2SA 2Q7FA 2GW1A 3E32A 3JXIA 3ZYMA 4D10C 4GTPA 4AY5A 3RRMB 4URKA 3NF1A 5KBAA 2VSNA 1L5JA 1ZU2A 3ESKA 3RAYA 3Q79A 1HF8A 1HXIA 3FTUA 3MCXA 3SY2A 2LXMA 2LNIA 4N3BA 4DI3A 3RSEG 4BEPA 4ILIA 1K3ZD 4L9PA 5EG2A 2UY1B 5F59A 4J8DA 3ZXSA 2XGSA 3FFLA 4AY6A 4U8HA 4ATGA 4O1OA 4FU3A 4JLGA 4Y6CA 3DEPA 3M57A 2YINA 2IONA 3MEKA 4ACKA 5HKPA 2DZOA 2H6FA 3ABLE 3T8KA 2IJGX 5B3SE 2PQNA 4DPRA 2J9QA 1WDYA 3FTYA 3F9WA 3OPEA 1IQRA 2LSUA 4EHMA 5FT9A 3UKUG 4HVBA 1JCRA 3DSVA 2XGOA 4G2VA 5A7DB 3FUIA 1IQUA 5ENPD 3UXGA 1JUQA 1IHGA 5FQ4A 4MBGA 3QARA 5FINA 3AG3E 4KVOA 2DBAA 3KEZA 2NC9A 3FULA 2XZDG 5AQ9A 1Z3XA 3SD5A 3V79K 4L2LA 3IBEA 4BTBA 1N6CA 3UIOC 3UIPC 3FDHA 1QYMA 3LYAA 2CHZA 2BTDA 2ETBA 4N5CA 4FP7A 5CCMA 4I9CA 2KM4A 4R7LA 4I51A 3ASGA 5ENNA 3CBPA 3V31A 5IY5E 3NZUA 2VTBB 2KZTA 2WQHA 3EIJA 1NP7A 4LCTA 4EQFA 2WXKA 4YDEA 2MRIA 1D8EA 4WUYA 4TXRA 1ELWA 1MX6A 3ASHA 3S7JA 3CVUA 2IGQA 3QWVA 2P9UG 2JLBA 4M7CA 1N95A 4MS6A 4PH4B 3ZRHA 3O4ZA 3VLEA 3OXGA 5ENTD 4WAFA 4BESA 1PY1A 3B7UX 2WQ7A 2XHEA 5G04C 3WXXA 2F8YA 4HOSA 1E7VA 3SF4A 2RFMA 4JEUA 2PM6A 2XQ0A 1XGWA 4GCNA 2WXQA 4BT8A 4CCAA 3G2WA 2W5YA 3Q5MA 5F6LA 3VTYA 4B0ZA 2LSVA 5FJYA 4AEZC 5G05J 2CG2A 1A5EA 4HI9A 3E4BA 2GRPB 4HXIA 4UUCA 3MKQA 3B13A 3KMAA 5EYPF 3HXCA 4UI9K 4NVQA 1O1TA 3AU4A 3TXMA 3CK9A 1QNFA 3K5KA 4JZYA 2WVIA 2J49A 4B8AA 4NQ0A 5DIZA 4KXKB 3EU9A 1N54A 1Y6IA 5CRVA 2Y3AA 1QBQA 2I6HA 4GA2A 2AXUA 3TWWA 4Q94A 1FVFA 2L6BA 3I3NA 4O1PA 3LY7A 4RG9A 5CMWA 2RKKA 1MX2A 4DLQA 4U0UA 2KXPC 3HXEA 4LNUD 3ZHEA 2OV8A 1KT0A 3KEAA 4DX6D 4DX1A 5AQ7A 5AAOA 2FF4A 1GW6A 3EU5A 3UM3A 3BQOA 2L0TB 1JCSA 5FZRA 3FUMA 3D9IA 5D0QD 4UQXA 2P2CP 1H2TC 2VGYA 2C0LA 3EJNA 5FWQA 3MX3A 4AV7A 3FTXA 4J8SA 5G55A 2IF4A 4DX7D 4U8VD 2P9KG 4KBQA 1UN9A 2DYSE 1O1RA 4IJDA 3T5VA 3CV0A 5B1AE 2F69A 5HQ8A 1NA3A 2XS1A 4HB5A 1NA0A 3EP0A 3LKUA 3O48A 1OXJA 4CGVA 3F9XA 2F37A 4UWHA 4DRXE 3M53A 1U2VG 4UWGA 2DCPA 3CVNA 1UOHA 2PM7A 4XEIG 3JXJA 1EDUA 3IHYA 4G11A 1E7UA 2J07A 4GPMA 4GTRA 4G8LA 5J90A 2MYOA 1SZAA 1DNPA 1QQEA 3HVEB 4NACA 2DWZA 3CLJA 3FY4A 3SI5A 4BETA 5C1DA 3S7FA 3BO5A 3PEUB 5M72A 3S8PA 1SW6A 4RSYA 1DCEA 1K1BA 4APOA 3B7BA 2XPZA 4I6GA 3KS2A 2ILRA 2QC9A 2J09A 3L13A 2L0IA 4HOUA 1E8ZA 3SQVA 3B7SA 3J5QB 3CVYA 3DSSA 3HHMA 5CECB 4FA6A 3HYMB 4L7TA 1ZKKA 3W9FA 3SFZA 4PS3A 4WNFA 5BUZA 3RK6A 5EYLA 5AIJA 3GZ1A 5H7PA 1TNUA 4A3VA 3FUEA 5BNWA 1ZB1A 4G25A 3FTWA 3AS5A 4X8QA 4ATZD 1BLXB 4Q96A 2WXJA 3HIZA 4YPAA 4AU7A 3ZYLA 5JJ0A 2CFUA 5BXUA 2VGEA 2EQXA 3IXEA 5JA4D 4G26A 3UM2A 1LTXA 1HE8A 2E2EA 4MRUA 4IRUA 4RG6A 3D9LA 2V5QC 4BT9A 4N2QA 2ZGGA 1S63A 5ENRD 3D9OA 3OXLA 4HRMB 4HQDA 1H0AA 3TAXA 5KJKA 3EHMA 2X6JA 1HX8A 2OCCE 3VLDA 1WM5A 4NRHB 4TUUA 5FZSA 2R17C 1N4RA 3ABKE 4CGWA 4RZ0A 3OS5A 4I1OB 1TNBA 2WQ6A 1OWLA 3F9YA 3G2TA 4GYOA 3JCKC 4M3OA 4GTTA 5G05C 4I6JA 1Z5SC 4AP2A 3FUKA 4GYYA 2XPYA 4J8EA 5F5EA 5LSXA 2FO1E 1OWOA 2GROB 4F7AA 3IV0A 1BU9A 4G8KA 3LY8A 3LDZA 3DSXA 5TH7A 1TNYA 5CERB 1E96B 4PDXA 3TL5A 3MGBA 3PZ3A 2JV0A 4K5BA 2WXRA 4CT0A 2DYRE 2KCVA 2X6FA 5JJTA 3ML9A 4FMUA 2WM9A 4GZDA 4BFRA 2I1JA 1YMPA 4BX8A 1N52A 2ZXWE 4UQZA 1DVPA 3V2OA 3CHOA 1S70B 1N4PA 1D8DA 3MV3B 3TXNA 4QFVA 3ULQA 2DIWA 5CRUA 3D9HA 4AVXA 2VSXE 4HI8A 5BT1A 1TNZA 3LPZA 2V0PA 2ZGDA 2UWJG 4XE0A 3M56A 4O30A 3FH7A 4DI4A 4BY6A 2AWIA 4BX9A 2EILE 1Q2ZA 2PNNA 3HXBA 4B93B 4CZ2D 3X2QE 4PS7A 2E0IA 3PNLB 3ONKA 4CYMD 3UT8A 1B89A 1OUVA 2PQRA 3L54A 2YHCA 3DXKG 1KPSB 5AYWD 4I9EA 2XRZA 2RFAA 4UWLA 4UI9J 3T8MA 4KVMA 1WAO1 3VUZA 4Q69A 3CSTA 2OEVA 4IYPA 1HU3A 3AS8A 3CHRA 3SBTB 1FVHA 2Y4TA 4BUPA 1U3CA 5JJ6A 4EBAG 4AIFA 3QAQA 2R03A 3FUNA 2IO2C 3CR3A 4JL0A 3CVVA 4U0SA 3ZYKA 4KZCA 1HO8A 2I1KA 1HG2A 2JEKA 3NOCD 3TWQA 3ASFA 1FPPA 1Z3YA 5ENOD 2V4LA 5EDSA 3DWLG 1NL4A 2HM8A 3B7TA 1BI7B 4G23A 3RO2A 2DVWA 3PZ1A 4FC8A 4JC8A 3LS8A 2EIKE 3HRAA 4I1MA 1KZPA 4HLLA 3EHNA 3TWUA 3ZEFA 4KZ0A
chains in the Genus database with same CATH topology
4DLQA 4JHKA 3LVRE 3G2UA 4GZ5A 4U0ZA 1HFAA 3TG5A 3PZDA 4U0UA 2X3MA 4J7FA 3VLFA 3PRZA 5KCMA 2MOWA 2IOLA 2UY1A 2FI7A 4WNGA 3OAWA 1Z6TA 3QOUA 5ARGA 5LOZA 3R7QA 3ZHEA 1ELKA 3L08A 2OV8A 1KT0A 3BEEA 5ANRA 1UW4B 4HS2A 1BPOA 3CHPA 3Q47B 3KMJA 4FULA 1SQMA 4QEOA 4KMOA 1H2UA 1MT6A 3U3WA 3CKBA 3CHQA 3CQGB 2WXNA 3U64A 2FF4A 2OVFA 3VTXA 4BWRA 3APDA 3L17A 3MZLB 1GW6A 3D9JA 4I6EA 3ZPJA 3I4GA 3MJWA 5T0MA 2J4DA 2VGXB 3CHMA 4LERA 2L0TB 5LCWJ 2KATA 3HDXA 1NZNA 3CVQA 2NSZA 5FZRA 3DALA 2XEVA 3FUMA 3JUIA 4NJ5A 4I17A 4N3CA 3D9IA 5D0OD 5D0QD 4ABNA 4EZKA 1JWGA 4UQXA 5G04J 4JHJA 4P29A 5JHNA 3DBSA 1H2TC 4JA7A 4L2YA 3OPEA 2VGYA 4I1AA 2C0LA 3CQCB 1E8WA 3EJNA 5FWQA 4EZLA 4OVVA 3MX3A 3N71A 5JHAA 2QY7A 4C1QA 3L16A 3RU0A 2XGMA 3I4RB 4AV7A 3M55A 3CK8A 4ANXA 3FTXA 4J8SA 5G55A 2XPIA 3S2AA 3QB2A 4J6IA 4JVSA 3M5AA 2IF4A 3ZN3A 4WWNA 4DJAA 1OWMA 3VV0A 1LF8A 3MKRA 2XRYA 4YPUA 4KBQA 3QWWA 1KT1A 1UN9A 4ME2A 1JWFA 1E8XA 1WY6A 1E90A 3AU5A 2WXGA 4IJDA 1Y8MA 2IFUA 3CV0A 4L23A 3T5VA 4A3TA 4XX5A 2F69A 5CHEE 3G2VA 5HQ8A 1NA3A 4XIFA 3EP0A 1NA0A 3ZYQA 3PREA 3LKUA 5FZQA 3O48A 3ZGQA 3FU6A 4I2WA 3RJVA 3ZIMA 5LFAA 4CGVA 4WNDA 3F9XA 1UN8A 3FUDA 1FCHA 2KZTB 3RKVA 3CVLA 5EX3A 3UUXA 4G24A 4A55A 3Q49B 4UWHA 3R9AB 3KD7A 5T8IA 4LEUA 5EKQD 3U66A 3M53A 1ZBPA 5LP0A 4UWGA 3APFA 4J8OA 1A17A 2DCPA 3FP3A 3QNKA 3L22A 3CVNA 3FTSA 2PM7A 2VQ2A 2QFCA 4HORA 1ML9A 2CHXA 4PUCA 3FPDA 2VSYA 1EDUA 3CKCA 4CT0A 3F9ZA 5CMYA 2AVPA 3IHYA 4JA9A 4JPSA 4J0UA 4ANWA 3KMTA 4G11A 4GAAA 3TG4A 1E7UA 2J07A 5HI7A 3SBSA 1EYHA 3TGOA 2IU1A 3LJ3A 4XKBA 5TEGA 3G2SA 3PEVB 5J90A 2G46A 2VTBA 1SZAA 3UMVA 5ARFA 1DNPA 5BPPA 5JINA 4C9BB 1QQEA 4CEMA 3HVEB 3PVLA 4NACA 2HO1A 3CLJA 3SWCA 3LEWA 3FY4A 3ASDA 3GZSA 4JHRA 5JIYA 4AM9A 3SI5A 5C1DA 1H3IA 2CFZA 5T3RA 3S7FA 1TEZA 3QC1A 3FUHA 5DBKA 3BO5A 3NQPA 3C98A 3PE4A 2X6KA 2X38A 4HLEA 3MYVA 3PEUB 3FEXA 3PH0C 2X6IA 4TRQA 2M63A 5M72A 4A1SA 1OWPA 4GA1A 2WB2A 2PL2A 4YVOA 4F3VA 3S8PA 3D9NA 4LDGA 3JQ0A 1OWNA 3RIBA 4MKTA 4RSYA 4GB9A 5F6KC 2LO6A 3CEQA 4APOA 3ZW3A 1MHQA 1EF1C 1TJCA 2XPZA 4I6GA 3PUJA 3U9WA 3KS2A 4C0EA 2YNQA 3UQ3A 2WMOA 4ILGA 2ILRA 1UJJA 1O9SA 2BQZA 3UX4A 2J09A 3IEGA 3L13A 3CSFA 3FUFA 2L0IA 4HOUA 2IQCA 2AW6A 1E8ZA 3MKQB 4YNDA 2BF0X 3B7SA 5AJLA 5FQ8A 4B94A 5T5GA 3CVYA 2PZIA 3ONLA 4J8FA 4DLOA 3P1UA 4GCOA 3HHMA 5BV1A 2GRMA 4W9RA 4FA6A 4I2ZA 3HYMB 4L7TA 4XI0A 3I5PA 5KJLA 4Z4PA 1HH8A 1UG3A 1ZKKA 1HZ4A 2O8JA 3SFZA 2ZU6B 4PS3A 1VDYA 3CBMA 4WNFA 4OVUA 3UT7A 5BUZA 4WNEA 3FH8A 2LAHA 4FHKA 3RK6A 4L1BA 2XCBA 3OXFA 4WWPA 5E75A 3MV2B 3IHXA 5AIJA 3GZ1A 5A23A 5G2NA 3TJPA 2YQ8A 4O6FA 4A3VA 3FUEA 3QDNA 4CRWA 5BNWA 4CDNA 1W3BA 1XNFA 3D9KA 4G25A 5CCLA 4JDSA 5CPRB 2X6HA 1YA0A 3FTWA 1P5QA 3AS5A 4N2SA 2WXOA 3FH5A 5C2YA 3GZ2A 3JQ1A 1N6AA 2Q7FA 2CG3A 1MVXA 2GW1A 5TTFA 4KT6B 2L6JA 2WXJA 4Q96A 3HIZA 4YPAA 3ZYMA 4AU7A 3ZVVA 2GGFA 3ZYLA 4D10C 4AY5A 5JJ0A 3CGHA 3RRMB 2C2LA 2CFUA 3RO3A 3CVWA 3FUJA 2RG8A 4URKA 3CIAA 2VYIA 3NF1A 2EQXA 4YVQC 4G26A 2VSNA 3UT4A 1L5JA 1ZU2A 1HE8A 2E2EA 4MRUA 3ESKA 4IRUA 4YPEA 4RG6A 4GU5A 3D9LA 3RAYA 5LCWC 1HF8A 1HXIA 2P58C 3FTUA 4LRZA 4N2QA 4BT9A 3MCXA 2R3AA 2LNIA 4FADA 4GZ6A 4N3BA 4DI3A 3D9MA 4K03A 4ILIA 2WXHA 2W5ZA 3F9WA 4FLHA 3D9OA 3OXLA 5EG2A 3RJWA 4PS8A 2UY1B 3QWPA 4GMLA 3MO0A 3ZFWA 4FJZA 3ZHEB 5F59A 4J8DA 3ZXSA 2XGSA 1H0AA 4U07A 3TAXA 5KJKA 3EHMA 3FFLA 4AY6A 2X6JA 3FU3A 1HX8A 4U8HA 3URZA 3Q4AB 4ATGA 4HOQA 3T5XA 3CK7A 4FU3A 3VLDA 2A4ZA 1WM5A 4NRHB 4TUUA 5FZSA 2R17C 4CGWA 4RZ0A 4APFA 4AJWA 1H2VC 3OS5A 2KCKA 4JLGA 4Y6CA 2NXPA 4I1OB 2AXZA 4B89A 3HNAA 3M57A 4H7XA 2YINA 2IONA 2WMNA 3MEKA 3LXUX 3SZ7A 2WQ6A 4ACKA 2KCLA 4GZ3A 3QK0A 1OWLA 3F9YA 3FEYA 3G2TA 3IKOB 4FLBA 4GYOA 2IJGX 3ENEA 2PQNA 4DPRA 2J9QA 4UI9C 3FTYA 4GZCA 3JCKC 1IQRA 4M3OA 5G05C 2LSUA 4I6JA 3U4TA 5A6CA 5LX8A 4IJ8A 3RQ4A 2VJ8A 4TV3A 4J7IA 5FT9A 4AP2A 4MI5A 2OVBA 2WXPA 2C0MA 5FQ7A 3KAEA 2L9BA 4HVBA 3FUKA 4G2VA 2XGOA 5A7DB 4GYYA 3FUIA 2XPYA 1IQUA 4J8EA 1JUQA 5T0KA 5EX0A 2A5UA 1IHGA 1X5BA 5FQ4A 2RFIA 5F5EA 5LSXA 3PE3A 2KC7A 3PDNA 1OWOA 4OYSA 4AXHA 4LUNU 5AYFA 3GYZA 3SNXA 2VGXA 4F7AA 5ANLA 3IV0A 2CHWA 2YHEA 3LY8A 4CDRA 2R5SA 3LDZA 4EZJA 3M58A 3QARA 4GPKA 5TH7A 3CBOA 4KVOA 2DBAA 3KEZA 3EIQC 2NC9A 4EPZA 1E96B 3BG0B 4PDXA 4ILHB 5BW8C 3JYSA 3FULA 3FWVA 2J4BA 2AXVA 4HOTA 3S7BA 5LSZA 5JHBA 3TL5A 2WXLA 3MGBA 1Z3XA 3SD5A 3GW4A 4JEHA 4ANUA 3APCA 2JV0A 2QPWA 2WXRA 4H7YA 2V8SE 2KCVA 1S0PA 2X6FA 3IBEA 3MA5A 3ML9A 4L2LA 4XZ4A 4BTBA 5JJTA 1N6CA 2WM9A 3FDHA 4FMUA 4V3IA 1PC2A 4GZDA 3M54A 4BFRA 3BG1B 2I1JA 3LYAA 2CHZA 4BX8A 1N52A 2BTDA 3LVQE 4A1GA 1KLXA 3SHFA 4N5CA 4Y6WA 4FP7A 4UQZA 4I9CA 5CCMA 1DVPA 2KM4A 2Y4UA 3CHOA 4R7LA 5KJMA 2FBNA 3UPVA 5FTPA 4I51A 3ASGA 4GMJA 3MV3B 5ENNA 2LAIA 4E47A 3CBPA 5E76A 3TXNA 3NZUA 4QFVA 2VTBB 4WWOA 3ULQA 3FU5A 2DIWA 2KZTA 2WQHA 4U63A 3EIJA 1NP7A 5AENA 4LCTA 4EQFA 2WXKA 4F1SA 4XKCA 2MRIA 2MHKA 4JXTA 4YNMA 4WUYA 4AVXA 1ELWA 3ML8A 4U04A 2VSXE 3B7RL 3ASHA 2ONDA 1SZ9A 5BT1A 3S7JA 5J08A 5JJ7A 3CVUA 2IGQA 4MI0A 3LPZA 3QWVA 4F53A 4GA0A 2V0PA 3DB5A 2UWJG 3LCAA 1E8YA 2J08A 2JLBA 1PAQA 1HS6A 2FO7A 4IN3B 3P2BA 2HYZA 3NZSA 2HR2A 4MS6A 4XE0A 3M56A 4O30A 4PH4B 3LY9A 3ZRHA 3O4ZA 3FH7A 3VLEA 4DI4A 3OXGA 4H12A 3PNTB 4WAFA 4BY6A 5AJDA 1PY1A 2AWIA 4BX9A 1XQHA 2BUGA 3EDTB 3B7UX 2WQ7A 3MO5A 3QJZA 2XHEA 5G04C 3HVEA 3WXXA 4UWKA 3OOIA 4HOSA 5FQ6A 3ESLA 1E7VA 4PS7A 3SF4A 4B8CB 4E85A 2E0IA 3PNLB 3ONKA 5KJNA 4JEUA 3UT8A 2PM6A 2XQ0A 1B89A 1XGWA 1OUVA 3D3MA 2PQRA 3FU0A 2WXQA 4GCNA 2WXMA 3L54A 4N39A 2YHCA 4MLPA 1U3DA 5AYWD 3G2WA 4BT8A 4CCAA 2V5FA 4UQYA 2W5YA 2XCCA 2R59A 4C0MA 3Q5MA 4I9EA 5F6LA 4YNPA 3VTYA 4B0ZA 2XRZA 2LSVA 1UJKA 5FJYA 5T4YA 3FHEA 4UWLA 4BSXA 4UI9J 3T8MA 4AEZC 4KVMA 4FHJA 5G05J 2CG2A 2VSOE 4CDMA 4N3AA 1QZ2A 1WAO1 3E4BA 3M59A 4HXIA 3VUZA 4Q69A 3CSTA 4IYPA 3MKQA 3B13A 4UWFA 2WXFA 4XI9A 4I43A 3KMAA 1HU3A 3AS8A 2OOEA 3CHRA 1PEGA 1MQSA 4DK5A 3CVXA 3SBTB 1MUFA 1FVHA 2Y4TA 4J83A 4BUPA 1U3CA 4UI9K 5JJ6A 4NVQA 1TJFA 3RRUA 4JW1A 3QKYA 4E6HA 4RVBA 4K0RA 4G1TA 4EBAG 4AIFA 3AU4A 3L6AA 1JPLA 3OTNA 3Q15A 3TXMA 3CK9A 1QNFA 3K5KA 3IHVA 1N3JA 3FTVA 3QAQA 2I2OA 4HFGA 3FUNA 4IULA 2FEZA 3CR3A 1INZA 4JZYA 4EECA 2WPVA 2WVIA 2J49A 4AOFA 4NURA 4JL0A 4B8AA 3PS6A 4NQ0A 3CVVA 4BTAA 5DIZA 3D9PA 4U0SA 3ZYKA 4KXKB 4KZCA 1MVHA 1HO8A 2GRLA 4FJYA 1HG2A 2I1KA 2JEKA 1N54A 3ASFA 4GYWA 1ELRA 1H19A 3FTZA 3R7RA 1Y6IA 4QENA 3MO2A 1HG5A 3RRNB 1Z3YA 3SW9A 2Y3AA 3SGHA 4ACLA 2V4LA 5EDSA 2I6HA 4GA2A 2HM8A 3PUKA 2AXUA 2I9CA 3B7TA 5BV0A 4QEPA 1EPUA 4G23A 2IOSA 1IYGA 3RO2A 1FVFA 4Q94A 2FULA 3I3NA 3AS4A 4FC8A 2RD0A 4ANVA 3S7DA 4JC8A 3LS8A 4EBAA 4KYOB 1H6KA 3LY7A 4RG9A 5CMWA 4I1MA 4CT4A 3CVPA 3EHNA 3CHSA 3ZEFA 4KZ0A 2WXIA 3DPDA 3K9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZ5 A;  4U0Z A;  3TG5 A;  4U0U A;  4J7F A;  2UY1 A;  2FI7 A;  4WNG A;  3QOU A;  5ARG A;  3ZHE A;  1KT0 A;  3BEE A;  3Q47 B;  3KMJ A;  4QEO A;  1MT6 A;  3U3W A;  3CKB A;  2FF4 A;  3VTX A;  4BWR A;  5T0M A;  3ZPJ A;  2VGX B;  5LCW J;  2KAT A;  1NZN A;  3CVQ A;  5FZR A;  3DAL A;  4NJ5 A;  2XEV A;  4I17 A;  4N3C A;  5D0O D;  5D0Q D;  4ABN A;  4UQX A;  5G04 J;  5JHN A;  4JA7 A;  2VGY A;  4I1A A;  2C0L A;  3N71 A;  4C1Q A;  3RU0 A;  2XGM A;  3M55 A;  3CK8 A;  2XPI A;  3M5A A;  2IF4 A;  3ZN3 A;  3VV0 A;  3MKR A;  4YPU A;  4KBQ A;  3QWW A;  1KT1 A;  4ME2 A;  4IJD A;  1Y8M A;  2IFU A;  3CV0 A;  2F69 A;  5CHE E;  5HQ8 A;  1NA3 A;  4XIF A;  3EP0 A;  1NA0 A;  3LKU A;  5FZQ A;  3O48 A;  3ZGQ A;  4I2W A;  3RJV A;  4CGV A;  4WND A;  3F9X A;  1FCH A;  3RKV A;  3CVL A;  3UUX A;  5EX3 A;  4G24 A;  3Q49 B;  3R9A B;  3KD7 A;  4LEU A;  5EKQ D;  3M53 A;  1ZBP A;  4J8O A;  1A17 A;  3FP3 A;  3CVN A;  4HOR A;  2VQ2 A;  2QFC A;  1ML9 A;  3FPD A;  2VSY A;  3CKC A;  3F9Z A;  2AVP A;  4JA9 A;  4J0U A;  3KMT A;  3TG4 A;  5HI7 A;  3TGO A;  5TEG A;  2G46 A;  5ARF A;  5JIN A;  1QQE A;  2HO1 A;  3SWC A;  3ASD A;  4JHR A;  5JIY A;  4AM9 A;  5C1D A;  1H3I A;  3S7F A;  5DBK A;  3BO5 A;  3PE4 A;  5M72 A;  4A1S A;  4GA1 A;  2PL2 A;  4YVO A;  4F3V A;  3S8P A;  4LDG A;  3RIB A;  5F6K C;  3CEQ A;  4APO A;  1TJC A;  3KS2 A;  3UQ3 A;  1O9S A;  2BQZ A;  3IEG A;  4HOU A;  4B94 A;  4YND A;  5T5G A;  2PZI A;  4J8F A;  4GCO A;  4W9R A;  4Z4P A;  4I2Z A;  3HYM B;  4XI0 A;  5KJL A;  1HH8 A;  1ZKK A;  1HZ4 A;  2O8J A;  3CBM A;  4WNF A;  4WNE A;  2XCB A;  3OXF A;  3MV2 B;  3IHX A;  3GZ1 A;  2YQ8 A;  4O6F A;  3QDN A;  5BNW A;  1W3B A;  1XNF A;  5CCL A;  4G25 A;  4JDS A;  5CPR B;  1YA0 A;  1P5Q A;  3AS5 A;  4N2S A;  3GZ2 A;  1N6A A;  5TTF A;  2Q7F A;  1MVX A;  2GW1 A;  2L6J A;  4YPA A;  4AU7 A;  4AY5 A;  5JJ0 A;  2C2L A;  3RO3 A;  2VYI A;  3NF1 A;  4YVQ C;  4G26 A;  2VSN A;  1ZU2 A;  2E2E A;  3ESK A;  4YPE A;  4RG6 A;  3RAY A;  5LCW C;  1HXI A;  2P58 C;  2R3A A;  4N2Q A;  4BT9 A;  2LNI A;  4GZ6 A;  4N3B A;  2W5Z A;  3OXL A;  5EG2 A;  3RJW A;  2UY1 B;  3QWP A;  3MO0 A;  3ZFW A;  3ZHE B;  5F59 A;  4J8D A;  2XGS A;  4U07 A;  3TAX A;  5KJK A;  3FFL A;  4AY6 A;  3URZ A;  3Q4A B;  4HOQ A;  3CK7 A;  1WM5 A;  4NRH B;  5FZS A;  4CGW A;  4RZ0 A;  3OS5 A;  2KCK A;  4JLG A;  4Y6C A;  3HNA A;  3M57 A;  4H7X A;  3MEK A;  3SZ7 A;  2KCL A;  4GZ3 A;  3F9Y A;  4GYO A;  2PQN A;  2J9Q A;  4UI9 C;  3F9W A;  3U4T A;  3OPE A;  5G05 C;  2LSU A;  5A6C A;  3RQ4 A;  4IJ8 A;  4J7I A;  5FT9 A;  4MI5 A;  2C0M A;  3KAE A;  5A7D B;  4G2V A;  2XGO A;  4GYY A;  4J8E A;  5T0K A;  5EX0 A;  2RFI A;  1IHG A;  5F5E A;  5LSX A;  3PE3 A;  2KC7 A;  3PDN A;  5AYF A;  3GYZ A;  2VGX A;  3LY8 A;  4CDR A;  2R5S A;  3M58 A;  4GPK A;  5TH7 A;  3CBO A;  2DBA A;  2NC9 A;  1E96 B;  5BW8 C;  3JYS A;  3FWV A;  4HOT A;  5LSZ A;  3S7B A;  3GW4 A;  2JV0 A;  2QPW A;  4H7Y A;  2KCV A;  4BTB A;  5JJT A;  3MA5 A;  1N6C A;  4FMU A;  1PC2 A;  3M54 A;  3LYA A;  1KLX A;  4N5C A;  4Y6W A;  5CCM A;  4UQZ A;  4I9C A;  2Y4U A;  5KJM A;  3UPV A;  2FBN A;  4I51 A;  5FTP A;  3ASG A;  3MV3 B;  4E47 A;  3CBP A;  3ULQ A;  2WQH A;  4EQF A;  2MHK A;  4YNM A;  4WUY A;  1ELW A;  4U04 A;  3ASH A;  2OND A;  5BT1 A;  3S7J A;  5JJ7 A;  2IGQ A;  4MI0 A;  3LPZ A;  3QWV A;  4GA0 A;  3DB5 A;  2UWJ G;  3LCA A;  2JLB A;  2FO7 A;  4IN3 B;  2HYZ A;  2HR2 A;  3M56 A;  4O30 A;  3LY9 A;  4H12 A;  3OXG A;  1XQH A;  2BUG A;  3EDT B;  3MO5 A;  5G04 C;  3WXX A;  3OOI A;  4HOS A;  3SF4 A;  5KJN A;  1B89 A;  1OUV A;  2PQR A;  4GCN A;  4N39 A;  2YHC A;  5AYW D;  4BT8 A;  2V5F A;  4UQY A;  2W5Y A;  2XCC A;  3Q5M A;  4I9E A;  5F6L A;  4YNP A;  3VTY A;  2LSV A;  5FJY A;  4UI9 J;  5G05 J;  4N3A A;  1QZ2 A;  1WAO 1;  3E4B A;  3M59 A;  3VUZ A;  4XI9 A;  3KMA A;  3AS8 A;  2OOE A;  1PEG A;  1MUF A;  2Y4T A;  4J83 A;  4BUP A;  4UI9 K;  5JJ6 A;  4NVQ A;  3QKY A;  4G1T A;  4AIF A;  3Q15 A;  3CK9 A;  3K5K A;  1N3J A;  2FEZ A;  2WPV A;  4JL0 A;  4NQ0 A;  4BTA A;  5DIZ A;  4U0S A;  4KXK B;  1MVH A;  3ASF A;  4GYW A;  1ELR A;  4QEN A;  3MO2 A;  3SW9 A;  2I6H A;  4GA2 A;  4QEP A;  4G23 A;  1IYG A;  3RO2 A;  3AS4 A;  3S7D A;  4KYO B;  3LY7 A;  4RG9 A;  3CVP A;  3K9I A; 
#chains in the Genus database with same CATH topology
 4JHK A;  3G2U A;  5AQA A;  4U0Z A;  3PZD A;  5KWD A;  2UY1 A;  2FI7 A;  4WNG A;  1Z6T A;  3R7Q A;  5ANR A;  3BEE A;  1V54 E;  1UW4 B;  4HS2 A;  1NFI E;  1BPO A;  3DST A;  3Q47 B;  4FUL A;  1DCQ A;  1H2U A;  1MT6 A;  3CKB A;  4F1P A;  4QQI A;  1RZ4 A;  2OVF A;  3L17 A;  3MZL B;  2H6G A;  4I6E A;  5T0M A;  3ZPJ A;  1V55 E;  2J4D A;  2VGX B;  4LER A;  2KAT A;  2XEV A;  4GTM A;  5D0O D;  1YYH A;  4J7W A;  4GTS A;  3DBS A;  2OEW A;  1JCQ A;  4OVV A;  3DRA A;  5ENS D;  4C1Q A;  3RU0 A;  3I4R B;  4ANX A;  3QB2 A;  4DJA A;  1OWM A;  3MKR A;  4YPU A;  1KT1 A;  1K8K G;  1JWF A;  1WY6 A;  4Z68 A;  3WG7 E;  5CHE E;  1D9S A;  3TWR A;  3ZYQ A;  3Q7F A;  1AWC B;  3FU6 A;  4I2W A;  1UN8 A;  3ISM C;  2BKG A;  5EX3 A;  3UUX A;  4G24 A;  3R9A B;  5T8I A;  1ZBP A;  5LP0 A;  4J8O A;  1A17 A;  3FP3 A;  3QNK A;  3L22 A;  4HOR A;  2VSY A;  5CMY A;  2AVP A;  4JPS A;  4ANW A;  3UM0 A;  3BUA A;  2XZT G;  3TGO A;  2IU1 A;  5TEG A;  3PEV B;  2VTB A;  5BPP A;  5ARF A;  4C9B B;  4TXQ A;  3B95 A;  3PVL A;  3E37 A;  3GZS A;  1TN8 A;  2CFZ A;  5T3R A;  5DBK A;  3C98 A;  2X6K A;  2X38 A;  3DXM G;  4HLE A;  2ETA A;  2X6I A;  3NB2 A;  1OWP A;  3F6Q A;  4GA1 A;  2PL2 A;  4YVO A;  3Q73 A;  3D9N A;  4LDG A;  3JQ0 A;  5BXO A;  1OWN A;  4MKT A;  3CEQ A;  1EF1 C;  1TJC A;  4HBD A;  2YNQ A;  2BED A;  1O9S A;  3UX4 A;  3CSF A;  2IQC A;  4YND A;  3UM1 A;  5FQ8 A;  5AJL A;  4RQI A;  3ULE G;  2H6H A;  1WG0 A;  3P1U A;  1DC2 A;  1MYO A;  4W9R A;  4Z4P A;  4XI0 A;  3I5P A;  1UG3 A;  1HZ4 A;  3CBM A;  3FH8 A;  4FHK A;  3ASO E;  3MV2 B;  3TWV A;  5A23 A;  5EID A;  4CRW A;  3QDN A;  4GMR A;  3D9K A;  4JDS A;  2WXO A;  5TTF A;  1MVX A;  4U8Y D;  4KT6 B;  3ZVV A;  2GGF A;  3CGH A;  2C2L A;  3CVW A;  3RO3 A;  2LXL A;  2RG8 A;  2VYI A;  3UT4 A;  3Q9N C;  4GU5 A;  4U95 D;  2R3A A;  4LRZ A;  4FAD A;  3D9M A;  5CBO A;  4FLH A;  3QWP A;  4GML A;  3ZFW A;  4FJZ A;  2ZIR A;  1N9A A;  3URZ A;  3Q4A B;  4HOQ A;  3T5X A;  2A4Z A;  2B6C A;  1H2V C;  2KCK A;  2IY0 C;  2WMN A;  3LXU X;  5B1B E;  3V2X A;  4FLB A;  4UI9 C;  3RQ4 A;  5A6C A;  5LX8 A;  4TV3 A;  4J7I A;  2WXP A;  3KAE A;  2L9B A;  2RFI A;  1X5B A;  3PDN A;  1OCR E;  4OYS A;  4AXH A;  3SNX A;  3SO8 A;  5ANL A;  4EZJ A;  4GTV A;  3M58 A;  2HE0 A;  4EPZ A;  1TEZ A;  3BG0 B;  2AXV A;  5LSZ A;  5JHB A;  2WXL A;  2P9N G;  3GW4 A;  3APC A;  2QPW A;  2V8S E;  3MA5 A;  3C3R A;  4V3I A;  1PC2 A;  1YCS B;  4LNB A;  4A1G A;  2Y4U A;  5FTP A;  3TWT A;  1AP7 A;  4E47 A;  5E76 A;  3AG2 E;  4U7E B;  4WWO A;  4U63 A;  3L9T A;  4XKC A;  4JXT A;  2MHK A;  5D66 A;  4U04 A;  5JMN D;  1TN7 A;  2GRN B;  4MI0 A;  4F53 A;  4GA0 A;  3ZUV B;  1E8Y A;  2J08 A;  2HYZ A;  4O60 A;  3AG4 E;  2Y1L E;  4U96 D;  3PNT B;  2GRQ B;  1N4Q A;  4HNA D;  1KZO A;  3MO5 A;  3QJZ A;  1RW2 A;  3HVE A;  4UWK A;  5FQ6 A;  3ESL A;  2AJA A;  4B8C B;  5KJN A;  3UIN C;  1BI8 B;  2WXM A;  4MLP A;  1U3D A;  2V5F A;  5CED B;  4UQY A;  1N0R A;  2XCC A;  4C0M A;  4OAV B;  2EIJ E;  1UJK A;  5T4Y A;  3FHE A;  4BSX A;  1SVX A;  1N94 A;  4UWF A;  1O5M A;  2OOE A;  1PEG A;  1MQS A;  4J83 A;  4HRL A;  1TJF A;  3RRU A;  3QKY A;  4LG6 A;  3L6A A;  1JPL A;  3Q15 A;  3FTV A;  2I2O A;  3ULY A;  2FEZ A;  3Q78 A;  4NUR A;  4BTA A;  3D9P A;  5KNH D;  3R7R A;  1H19 A;  3AJI A;  1HG5 A;  1NI1 A;  1TR4 A;  3SW9 A;  3SGH A;  4ACL A;  3PUK A;  2I9C A;  3KSQ A;  4QEP A;  1EPU A;  4GTQ A;  2IOS A;  1IYG A;  2FUL A;  2RD0 A;  3S7D A;  4EBA A;  4KYO B;  5EIB E;  4NIK A;  5ITZ F;  4K5C A;  3CHS A;  2WXI A;  5FIO A;  2X3M A;  3VLF A;  3PRZ A;  2MOW A;  2IOL A;  3OAW A;  3QOU A;  5LOZ A;  1ELK A;  4C48 B;  2H6I A;  3KMJ A;  1SQM A;  4QEO A;  4KMO A;  3HG0 D;  3HXD A;  3U3W A;  4BSZ B;  3CQG B;  3J5P A;  2WXN A;  3U64 A;  3VTX A;  4DUI A;  3D9J A;  3MJW A;  2LUH A;  3CVQ A;  3DAL A;  4I17 A;  4N3C A;  4EZK A;  1JWG A;  2XEN A;  2F8X K;  5JHN A;  4BER A;  4I1A A;  2P9L G;  3N71 A;  2QY7 A;  2NYJ A;  2XGM A;  3M55 A;  3E33 A;  2XEE A;  1MJ0 A;  3CK8 A;  2XS8 A;  4J6I A;  4JVS A;  2B0O E;  2IO3 C;  1LF8 A;  2XRY A;  3QWW A;  1E90 A;  2IFU A;  4L23 A;  4A3T A;  4XX5 A;  4N5Q A;  1MZC A;  5FZQ A;  3RJV A;  4WND A;  3FUD A;  2KZT B;  3CVL A;  3Q49 B;  3KD7 A;  3U66 A;  3APF A;  4TUM A;  3SFY A;  3R9M A;  2VQ2 A;  2QFC A;  3RAU A;  2CHX A;  4PUC A;  3UKR G;  4GAA A;  3TG4 A;  5HI7 A;  2A5E A;  3LJ3 A;  4RLY A;  2P9P G;  2G46 A;  2F0Y A;  4CEM A;  3HXF A;  3NAW A;  2HO1 A;  3SWC A;  4JHR A;  3NQP A;  2R2L A;  3PE4 A;  3MYV A;  4TRQ A;  4A1S A;  4YDW A;  2WB2 A;  4GB9 A;  5F6K C;  2LO6 A;  4J8Y A;  3U9W A;  3UQ3 A;  4ILG A;  1UJJ A;  2BQZ A;  3FUF A;  2AW6 A;  3MKQ B;  2BF0 X;  5T5G A;  4DLO A;  4J8F A;  4GCO A;  2GRM A;  2GRR B;  5KJL A;  3TWX A;  1VDY A;  4OVU A;  4WNE A;  3OXF A;  4WWP A;  5G2N A;  3TJP A;  2IEJ A;  5CCL A;  2X6H A;  1BD8 A;  1P5Q A;  3AAA C;  1LD7 A;  3FH5 A;  5C2Y A;  3GZ2 A;  3JQ1 A;  1N6A A;  2CG3 A;  4JB8 P;  2L6J A;  3DPY A;  3FUJ A;  3CIA A;  4YVQ C;  2EIM E;  1IKN D;  4YPE A;  5AQB A;  5LCW C;  2P58 C;  4GZ6 A;  4YDO A;  3EUV A;  4K03 A;  2WXH A;  2W5Z A;  3V30 A;  3RJW A;  4PS8 A;  3MO0 A;  4YDY A;  3C72 A;  3ZHE B;  4U07 A;  3C3O A;  3FU3 A;  3C5R A;  3CK7 A;  1TNO A;  4LNG A;  4APF A;  4AJW A;  3ASN E;  3HNA A;  2NXP A;  4B89 A;  2AXZ A;  4H7X A;  3SZ7 A;  2KCL A;  4GZ3 A;  3QK0 A;  1OCZ E;  3FEY A;  3IKO B;  3ENE A;  4GZC A;  3U4T A;  4IJ8 A;  2VJ8 A;  1OT8 A;  4MI5 A;  2V4H C;  2OVB A;  2C0M A;  5FQ7 A;  2JAB A;  1FT2 A;  1N4S A;  5T0K A;  5EX0 A;  2A5U A;  2EIN E;  3PE3 A;  2KC7 A;  2R02 A;  4LUN U;  5AYF A;  3GYZ A;  2VGX A;  2CHW A;  2YHE A;  4CDR A;  2R5S A;  2ETC A;  4GPK A;  3CBO A;  3EIQ C;  5BW8 C;  4ILH B;  3JYS A;  3FWV A;  2J4B A;  4HOT A;  3S7B A;  3W9G A;  2Y0B G;  4JEH A;  4ANU A;  4H7Y A;  1S0P A;  4XZ4 A;  3TWS A;  3NOG D;  1OCC E;  3M54 A;  4LSZ E;  3BG1 B;  3LVQ E;  3L82 A;  1KLX A;  3SHF A;  4Y6W A;  3BU8 A;  5KJM A;  3UPV A;  2FBN A;  4GMJ A;  2LAI A;  3EHR A;  4F6R D;  3FU5 A;  5AEN A;  3EHQ A;  4F1S A;  3Q75 A;  3ZU7 B;  4YNM A;  5D2M C;  3Q9U C;  3ML8 A;  3B7R L;  2OND A;  1SZ9 A;  5J08 A;  5JJ7 A;  3Q7A A;  3DB5 A;  4ZFH A;  3LCA A;  1HS6 A;  1PAQ A;  2FO7 A;  4IN3 B;  3P2B A;  3NZS A;  4ZHB A;  2HR2 A;  3LY9 A;  3UTM A;  4H12 A;  5AJD A;  3T9K A;  1XQH A;  2BUG A;  3EDT B;  2ZIS A;  5AAR A;  3OOI A;  4E85 A;  3PZ2 A;  1OCO E;  4A63 B;  3D3M A;  3FU0 A;  4N39 A;  2R59 A;  4YNP A;  1TN6 A;  4FHJ A;  2VSO E;  4CDM A;  4N3A A;  1QZ2 A;  3M59 A;  4HRN A;  1IXV A;  2WXF A;  4XI9 A;  4I43 A;  2QYJ A;  4DK5 A;  3CVX A;  1MUF A;  4JW1 A;  4E6H A;  4RVB A;  4K0R A;  4G1T A;  3OTN A;  3IHV A;  1N3J A;  4HFG A;  4IUL A;  3C3Q A;  1INZ A;  4EEC A;  2WPV A;  4AOF A;  3PS6 A;  2DZN A;  1MVH A;  2GRL A;  4FJY A;  1X81 A;  4GYW A;  1ELR A;  3FTZ A;  4QEN A;  3MO2 A;  3RRN B;  3LJN A;  2Y69 E;  3DEO A;  5BV0 A;  4ANV A;  3AS4 A;  1H6K A;  4CT4 A;  3CVP A;  1OY3 D;  3DPD A;  3K9I A;  3LVR E;  4GZ5 A;  1HFA A;  3TG5 A;  4J7F A;  5KCM A;  3ZXP A;  5ARG A;  4OAU C;  3L08 A;  3CHP A;  3ZNG A;  3DSW A;  3CHQ A;  1MX4 A;  2QYU A;  2BKK B;  4BWR A;  3APD A;  3I4G A;  3SFX A;  1SA5 A;  1H6O A;  3CHM A;  2J8S D;  5LCW J;  3HDX A;  3PZ4 A;  1NZN A;  2NSZ A;  4NJ5 A;  3JUI A;  1O1S A;  4ABN A;  2P9I G;  3ABM E;  5G04 J;  2KBX A;  4JHJ A;  4P29 A;  3JUE A;  4JA7 A;  4L2Y A;  1N0Q A;  3CQC B;  1E8W A;  4EZL A;  4DX5 D;  5JHA A;  3L16 A;  1G3N B;  4K5A B;  4JD2 G;  2XPI A;  3S2A A;  3M5A A;  3ZN3 A;  4WWN A;  3VV0 A;  3ZKJ A;  4ME2 A;  1E8X A;  3AU5 A;  2WXG A;  1Y8M A;  3DSU A;  1SA4 A;  4TXP A;  3KSL A;  3G2V A;  4XIF A;  3PRE A;  3ZGQ A;  3ZIM A;  5LFA A;  5EIL A;  1FCH A;  5KNG A;  3RKV A;  3UI2 A;  1H6P A;  4A55 A;  4LEU A;  5EKQ D;  5CBN A;  5HRY A;  3FTS A;  1ML9 A;  4DX2 A;  3FPD A;  3CKC A;  3F9Z A;  1FT1 A;  4JA9 A;  4J0U A;  3KMT A;  3SBS A;  1EYH A;  4XKB A;  3G2S A;  2QZA A;  1S64 A;  3UMV A;  5JIN A;  3LEW A;  3ASD A;  5JIY A;  2XEH A;  4AM9 A;  1H3I A;  4GTO A;  3QC1 A;  3FUH A;  3FEX A;  3PH0 C;  2M63 A;  5EN5 D;  4F3V A;  3RIB A;  5ENQ D;  3E30 A;  2R05 A;  3ZW3 A;  1MHQ A;  3PUJ A;  1LD8 A;  4C0E A;  2WMO A;  5CEA A;  3IEG A;  4B94 A;  5HS0 A;  2PZI A;  1N11 A;  3ONL A;  5BV1 A;  1IHB A;  3NBN B;  4I2Z A;  3AG1 E;  1HH8 A;  2O8J A;  2ZU6 B;  3UT7 A;  2LAH A;  5AN8 A;  4L1B A;  2XCB A;  5E75 A;  1K1A A;  3IHX A;  2P9S G;  2YQ8 A;  4O6F A;  1TYQ G;  4CDN A;  1W3B A;  1XNF A;  5CPR B;  3E34 A;  1YA0 A;  4N2S A;  2Q7F A;  2GW1 A;  3E32 A;  3JXI A;  3ZYM A;  4D10 C;  4GTP A;  4AY5 A;  3RRM B;  4URK A;  3NF1 A;  5KBA A;  2VSN A;  1L5J A;  1ZU2 A;  3ESK A;  3RAY A;  3Q79 A;  1HF8 A;  1HXI A;  3FTU A;  3MCX A;  3SY2 A;  2LXM A;  2LNI A;  4N3B A;  4DI3 A;  3RSE G;  4BEP A;  4ILI A;  1K3Z D;  4L9P A;  5EG2 A;  2UY1 B;  5F59 A;  4J8D A;  3ZXS A;  2XGS A;  3FFL A;  4AY6 A;  4U8H A;  4ATG A;  4O1O A;  4FU3 A;  4JLG A;  4Y6C A;  3DEP A;  3M57 A;  2YIN A;  2ION A;  3MEK A;  4ACK A;  5HKP A;  2DZO A;  2H6F A;  3ABL E;  3T8K A;  2IJG X;  5B3S E;  2PQN A;  4DPR A;  2J9Q A;  1WDY A;  3FTY A;  3F9W A;  3OPE A;  1IQR A;  2LSU A;  4EHM A;  5FT9 A;  3UKU G;  4HVB A;  1JCR A;  3DSV A;  2XGO A;  4G2V A;  5A7D B;  3FUI A;  1IQU A;  5ENP D;  3UXG A;  1JUQ A;  1IHG A;  5FQ4 A;  4MBG A;  3QAR A;  5FIN A;  3AG3 E;  4KVO A;  2DBA A;  3KEZ A;  2NC9 A;  3FUL A;  2XZD G;  5AQ9 A;  1Z3X A;  3SD5 A;  3V79 K;  4L2L A;  3IBE A;  4BTB A;  1N6C A;  3UIO C;  3UIP C;  3FDH A;  1QYM A;  3LYA A;  2CHZ A;  2BTD A;  2ETB A;  4N5C A;  4FP7 A;  5CCM A;  4I9C A;  2KM4 A;  4R7L A;  4I51 A;  3ASG A;  5ENN A;  3CBP A;  3V31 A;  5IY5 E;  3NZU A;  2VTB B;  2KZT A;  2WQH A;  3EIJ A;  1NP7 A;  4LCT A;  4EQF A;  2WXK A;  4YDE A;  2MRI A;  1D8E A;  4WUY A;  4TXR A;  1ELW A;  1MX6 A;  3ASH A;  3S7J A;  3CVU A;  2IGQ A;  3QWV A;  2P9U G;  2JLB A;  4M7C A;  1N95 A;  4MS6 A;  4PH4 B;  3ZRH A;  3O4Z A;  3VLE A;  3OXG A;  5ENT D;  4WAF A;  4BES A;  1PY1 A;  3B7U X;  2WQ7 A;  2XHE A;  5G04 C;  3WXX A;  2F8Y A;  4HOS A;  1E7V A;  3SF4 A;  2RFM A;  4JEU A;  2PM6 A;  2XQ0 A;  1XGW A;  4GCN A;  2WXQ A;  4BT8 A;  4CCA A;  3G2W A;  2W5Y A;  3Q5M A;  5F6L A;  3VTY A;  4B0Z A;  2LSV A;  5FJY A;  4AEZ C;  5G05 J;  2CG2 A;  1A5E A;  4HI9 A;  3E4B A;  2GRP B;  4HXI A;  4UUC A;  3MKQ A;  3B13 A;  3KMA A;  5EYP F;  3HXC A;  4UI9 K;  4NVQ A;  1O1T A;  3AU4 A;  3TXM A;  3CK9 A;  1QNF A;  3K5K A;  4JZY A;  2WVI A;  2J49 A;  4B8A A;  4NQ0 A;  5DIZ A;  4KXK B;  3EU9 A;  1N54 A;  1Y6I A;  5CRV A;  2Y3A A;  1QBQ A;  2I6H A;  4GA2 A;  2AXU A;  3TWW A;  4Q94 A;  1FVF A;  2L6B A;  3I3N A;  4O1P A;  3LY7 A;  4RG9 A;  5CMW A;  2RKK A;  1MX2 A;  4DLQ A;  4U0U A;  2KXP C;  3HXE A;  4LNU D;  3ZHE A;  2OV8 A;  1KT0 A;  3KEA A;  4DX6 D;  4DX1 A;  5AQ7 A;  5AAO A;  2FF4 A;  1GW6 A;  3EU5 A;  3UM3 A;  3BQO A;  2L0T B;  1JCS A;  5FZR A;  3FUM A;  3D9I A;  5D0Q D;  4UQX A;  2P2C P;  1H2T C;  2VGY A;  2C0L A;  3EJN A;  5FWQ A;  3MX3 A;  4AV7 A;  3FTX A;  4J8S A;  5G55 A;  2IF4 A;  4DX7 D;  4U8V D;  2P9K G;  4KBQ A;  1UN9 A;  2DYS E;  1O1R A;  4IJD A;  3T5V A;  3CV0 A;  5B1A E;  2F69 A;  5HQ8 A;  1NA3 A;  2XS1 A;  4HB5 A;  1NA0 A;  3EP0 A;  3LKU A;  3O48 A;  1OXJ A;  4CGV A;  3F9X A;  2F37 A;  4UWH A;  4DRX E;  3M53 A;  1U2V G;  4UWG A;  2DCP A;  3CVN A;  1UOH A;  2PM7 A;  4XEI G;  3JXJ A;  1EDU A;  3IHY A;  4G11 A;  1E7U A;  2J07 A;  4GPM A;  4GTR A;  4G8L A;  5J90 A;  2MYO A;  1SZA A;  1DNP A;  1QQE A;  3HVE B;  4NAC A;  2DWZ A;  3CLJ A;  3FY4 A;  3SI5 A;  4BET A;  5C1D A;  3S7F A;  3BO5 A;  3PEU B;  5M72 A;  3S8P A;  1SW6 A;  4RSY A;  1DCE A;  1K1B A;  4APO A;  3B7B A;  2XPZ A;  4I6G A;  3KS2 A;  2ILR A;  2QC9 A;  2J09 A;  3L13 A;  2L0I A;  4HOU A;  1E8Z A;  3SQV A;  3B7S A;  3J5Q B;  3CVY A;  3DSS A;  3HHM A;  5CEC B;  4FA6 A;  3HYM B;  4L7T A;  1ZKK A;  3W9F A;  3SFZ A;  4PS3 A;  4WNF A;  5BUZ A;  3RK6 A;  5EYL A;  5AIJ A;  3GZ1 A;  5H7P A;  1TNU A;  4A3V A;  3FUE A;  5BNW A;  1ZB1 A;  4G25 A;  3FTW A;  3AS5 A;  4X8Q A;  4ATZ D;  1BLX B;  4Q96 A;  2WXJ A;  3HIZ A;  4YPA A;  4AU7 A;  3ZYL A;  5JJ0 A;  2CFU A;  5BXU A;  2VGE A;  2EQX A;  3IXE A;  5JA4 D;  4G26 A;  3UM2 A;  1LTX A;  1HE8 A;  2E2E A;  4MRU A;  4IRU A;  4RG6 A;  3D9L A;  2V5Q C;  4BT9 A;  4N2Q A;  2ZGG A;  1S63 A;  5ENR D;  3D9O A;  3OXL A;  4HRM B;  4HQD A;  1H0A A;  3TAX A;  5KJK A;  3EHM A;  2X6J A;  1HX8 A;  2OCC E;  3VLD A;  1WM5 A;  4NRH B;  4TUU A;  5FZS A;  2R17 C;  1N4R A;  3ABK E;  4CGW A;  4RZ0 A;  3OS5 A;  4I1O B;  1TNB A;  2WQ6 A;  1OWL A;  3F9Y A;  3G2T A;  4GYO A;  3JCK C;  4M3O A;  4GTT A;  5G05 C;  4I6J A;  1Z5S C;  4AP2 A;  3FUK A;  4GYY A;  2XPY A;  4J8E A;  5F5E A;  5LSX A;  2FO1 E;  1OWO A;  2GRO B;  4F7A A;  3IV0 A;  1BU9 A;  4G8K A;  3LY8 A;  3LDZ A;  3DSX A;  5TH7 A;  1TNY A;  5CER B;  1E96 B;  4PDX A;  3TL5 A;  3MGB A;  3PZ3 A;  2JV0 A;  4K5B A;  2WXR A;  4CT0 A;  2DYR E;  2KCV A;  2X6F A;  5JJT A;  3ML9 A;  4FMU A;  2WM9 A;  4GZD A;  4BFR A;  2I1J A;  1YMP A;  4BX8 A;  1N52 A;  2ZXW E;  4UQZ A;  1DVP A;  3V2O A;  3CHO A;  1S70 B;  1N4P A;  1D8D A;  3MV3 B;  3TXN A;  4QFV A;  3ULQ A;  2DIW A;  5CRU A;  3D9H A;  4AVX A;  2VSX E;  4HI8 A;  5BT1 A;  1TNZ A;  3LPZ A;  2V0P A;  2ZGD A;  2UWJ G;  4XE0 A;  3M56 A;  4O30 A;  3FH7 A;  4DI4 A;  4BY6 A;  2AWI A;  4BX9 A;  2EIL E;  1Q2Z A;  2PNN A;  3HXB A;  4B93 B;  4CZ2 D;  3X2Q E;  4PS7 A;  2E0I A;  3PNL B;  3ONK A;  4CYM D;  3UT8 A;  1B89 A;  1OUV A;  2PQR A;  3L54 A;  2YHC A;  3DXK G;  1KPS B;  5AYW D;  4I9E A;  2XRZ A;  2RFA A;  4UWL A;  4UI9 J;  3T8M A;  4KVM A;  1WAO 1;  3VUZ A;  4Q69 A;  3CST A;  2OEV A;  4IYP A;  1HU3 A;  3AS8 A;  3CHR A;  3SBT B;  1FVH A;  2Y4T A;  4BUP A;  1U3C A;  5JJ6 A;  4EBA G;  4AIF A;  3QAQ A;  2R03 A;  3FUN A;  2IO2 C;  3CR3 A;  4JL0 A;  3CVV A;  4U0S A;  3ZYK A;  4KZC A;  1HO8 A;  2I1K A;  1HG2 A;  2JEK A;  3NOC D;  3TWQ A;  3ASF A;  1FPP A;  1Z3Y A;  5ENO D;  2V4L A;  5EDS A;  3DWL G;  1NL4 A;  2HM8 A;  3B7T A;  1BI7 B;  4G23 A;  3RO2 A;  2DVW A;  3PZ1 A;  4FC8 A;  4JC8 A;  3LS8 A;  2EIK E;  3HRA A;  4I1M A;  1KZP A;  4HLL A;  3EHN A;  3TWU A;  3ZEF A;  4KZ0 A; 
#chains in the Genus database with same CATH homology
 4DLQ A;  4JHK A;  3LVR E;  3G2U A;  4GZ5 A;  4U0Z A;  1HFA A;  3TG5 A;  3PZD A;  4U0U A;  2X3M A;  4J7F A;  3VLF A;  3PRZ A;  5KCM A;  2MOW A;  2IOL A;  2UY1 A;  2FI7 A;  4WNG A;  3OAW A;  1Z6T A;  3QOU A;  5ARG A;  5LOZ A;  3R7Q A;  3ZHE A;  1ELK A;  3L08 A;  2OV8 A;  1KT0 A;  3BEE A;  5ANR A;  1UW4 B;  4HS2 A;  1BPO A;  3CHP A;  3Q47 B;  3KMJ A;  4FUL A;  1SQM A;  4QEO A;  4KMO A;  1H2U A;  1MT6 A;  3U3W A;  3CKB A;  3CHQ A;  3CQG B;  2WXN A;  3U64 A;  2FF4 A;  2OVF A;  3VTX A;  4BWR A;  3APD A;  3L17 A;  3MZL B;  1GW6 A;  3D9J A;  4I6E A;  3ZPJ A;  3I4G A;  3MJW A;  5T0M A;  2J4D A;  2VGX B;  3CHM A;  4LER A;  2L0T B;  5LCW J;  2KAT A;  3HDX A;  1NZN A;  3CVQ A;  2NSZ A;  5FZR A;  3DAL A;  2XEV A;  3FUM A;  3JUI A;  4NJ5 A;  4I17 A;  4N3C A;  3D9I A;  5D0O D;  5D0Q D;  4ABN A;  4EZK A;  1JWG A;  4UQX A;  5G04 J;  4JHJ A;  4P29 A;  5JHN A;  3DBS A;  1H2T C;  4JA7 A;  4L2Y A;  3OPE A;  2VGY A;  4I1A A;  2C0L A;  3CQC B;  1E8W A;  3EJN A;  5FWQ A;  4EZL A;  4OVV A;  3MX3 A;  3N71 A;  5JHA A;  2QY7 A;  4C1Q A;  3L16 A;  3RU0 A;  2XGM A;  3I4R B;  4AV7 A;  3M55 A;  3CK8 A;  4ANX A;  3FTX A;  4J8S A;  5G55 A;  2XPI A;  3S2A A;  3QB2 A;  4J6I A;  4JVS A;  3M5A A;  2IF4 A;  3ZN3 A;  4WWN A;  4DJA A;  1OWM A;  3VV0 A;  1LF8 A;  3MKR A;  2XRY A;  4YPU A;  4KBQ A;  3QWW A;  1KT1 A;  1UN9 A;  4ME2 A;  1JWF A;  1E8X A;  1WY6 A;  1E90 A;  3AU5 A;  2WXG A;  4IJD A;  1Y8M A;  2IFU A;  3CV0 A;  4L23 A;  3T5V A;  4A3T A;  4XX5 A;  2F69 A;  5CHE E;  3G2V A;  5HQ8 A;  1NA3 A;  4XIF A;  3EP0 A;  1NA0 A;  3ZYQ A;  3PRE A;  3LKU A;  5FZQ A;  3O48 A;  3ZGQ A;  3FU6 A;  4I2W A;  3RJV A;  3ZIM A;  5LFA A;  4CGV A;  4WND A;  3F9X A;  1UN8 A;  3FUD A;  1FCH A;  2KZT B;  3RKV A;  3CVL A;  5EX3 A;  3UUX A;  4G24 A;  4A55 A;  3Q49 B;  4UWH A;  3R9A B;  3KD7 A;  5T8I A;  4LEU A;  5EKQ D;  3U66 A;  3M53 A;  1ZBP A;  5LP0 A;  4UWG A;  3APF A;  4J8O A;  1A17 A;  2DCP A;  3FP3 A;  3QNK A;  3L22 A;  3CVN A;  3FTS A;  2PM7 A;  2VQ2 A;  2QFC A;  4HOR A;  1ML9 A;  2CHX A;  4PUC A;  3FPD A;  2VSY A;  1EDU A;  3CKC A;  4CT0 A;  3F9Z A;  5CMY A;  2AVP A;  3IHY A;  4JA9 A;  4JPS A;  4J0U A;  4ANW A;  3KMT A;  4G11 A;  4GAA A;  3TG4 A;  1E7U A;  2J07 A;  5HI7 A;  3SBS A;  1EYH A;  3TGO A;  2IU1 A;  3LJ3 A;  4XKB A;  5TEG A;  3G2S A;  3PEV B;  5J90 A;  2G46 A;  2VTB A;  1SZA A;  3UMV A;  5ARF A;  1DNP A;  5BPP A;  5JIN A;  4C9B B;  1QQE A;  4CEM A;  3HVE B;  3PVL A;  4NAC A;  2HO1 A;  3CLJ A;  3SWC A;  3LEW A;  3FY4 A;  3ASD A;  3GZS A;  4JHR A;  5JIY A;  4AM9 A;  3SI5 A;  5C1D A;  1H3I A;  2CFZ A;  5T3R A;  3S7F A;  1TEZ A;  3QC1 A;  3FUH A;  5DBK A;  3BO5 A;  3NQP A;  3C98 A;  3PE4 A;  2X6K A;  2X38 A;  4HLE A;  3MYV A;  3PEU B;  3FEX A;  3PH0 C;  2X6I A;  4TRQ A;  2M63 A;  5M72 A;  4A1S A;  1OWP A;  4GA1 A;  2WB2 A;  2PL2 A;  4YVO A;  4F3V A;  3S8P A;  3D9N A;  4LDG A;  3JQ0 A;  1OWN A;  3RIB A;  4MKT A;  4RSY A;  4GB9 A;  5F6K C;  2LO6 A;  3CEQ A;  4APO A;  3ZW3 A;  1MHQ A;  1EF1 C;  1TJC A;  2XPZ A;  4I6G A;  3PUJ A;  3U9W A;  3KS2 A;  4C0E A;  2YNQ A;  3UQ3 A;  2WMO A;  4ILG A;  2ILR A;  1UJJ A;  1O9S A;  2BQZ A;  3UX4 A;  2J09 A;  3IEG A;  3L13 A;  3CSF A;  3FUF A;  2L0I A;  4HOU A;  2IQC A;  2AW6 A;  1E8Z A;  3MKQ B;  4YND A;  2BF0 X;  3B7S A;  5AJL A;  5FQ8 A;  4B94 A;  5T5G A;  3CVY A;  2PZI A;  3ONL A;  4J8F A;  4DLO A;  3P1U A;  4GCO A;  3HHM A;  5BV1 A;  2GRM A;  4W9R A;  4FA6 A;  4I2Z A;  3HYM B;  4L7T A;  4XI0 A;  3I5P A;  5KJL A;  4Z4P A;  1HH8 A;  1UG3 A;  1ZKK A;  1HZ4 A;  2O8J A;  3SFZ A;  2ZU6 B;  4PS3 A;  1VDY A;  3CBM A;  4WNF A;  4OVU A;  3UT7 A;  5BUZ A;  4WNE A;  3FH8 A;  2LAH A;  4FHK A;  3RK6 A;  4L1B A;  2XCB A;  3OXF A;  4WWP A;  5E75 A;  3MV2 B;  3IHX A;  5AIJ A;  3GZ1 A;  5A23 A;  5G2N A;  3TJP A;  2YQ8 A;  4O6F A;  4A3V A;  3FUE A;  3QDN A;  4CRW A;  5BNW A;  4CDN A;  1W3B A;  1XNF A;  3D9K A;  4G25 A;  5CCL A;  4JDS A;  5CPR B;  2X6H A;  1YA0 A;  3FTW A;  1P5Q A;  3AS5 A;  4N2S A;  2WXO A;  3FH5 A;  5C2Y A;  3GZ2 A;  3JQ1 A;  1N6A A;  2Q7F A;  2CG3 A;  1MVX A;  2GW1 A;  5TTF A;  4KT6 B;  2L6J A;  2WXJ A;  4Q96 A;  3HIZ A;  4YPA A;  3ZYM A;  4AU7 A;  3ZVV A;  2GGF A;  3ZYL A;  4D10 C;  4AY5 A;  5JJ0 A;  3CGH A;  3RRM B;  2C2L A;  2CFU A;  3RO3 A;  3CVW A;  3FUJ A;  2RG8 A;  4URK A;  3CIA A;  2VYI A;  3NF1 A;  2EQX A;  4YVQ C;  4G26 A;  2VSN A;  3UT4 A;  1L5J A;  1ZU2 A;  1HE8 A;  2E2E A;  4MRU A;  3ESK A;  4IRU A;  4YPE A;  4RG6 A;  4GU5 A;  3D9L A;  3RAY A;  5LCW C;  1HF8 A;  1HXI A;  2P58 C;  3FTU A;  4LRZ A;  4N2Q A;  4BT9 A;  3MCX A;  2R3A A;  2LNI A;  4FAD A;  4GZ6 A;  4N3B A;  4DI3 A;  3D9M A;  4K03 A;  4ILI A;  2WXH A;  2W5Z A;  3F9W A;  4FLH A;  3D9O A;  3OXL A;  5EG2 A;  3RJW A;  4PS8 A;  2UY1 B;  3QWP A;  4GML A;  3MO0 A;  3ZFW A;  4FJZ A;  3ZHE B;  5F59 A;  4J8D A;  3ZXS A;  2XGS A;  1H0A A;  4U07 A;  3TAX A;  5KJK A;  3EHM A;  3FFL A;  4AY6 A;  2X6J A;  3FU3 A;  1HX8 A;  4U8H A;  3URZ A;  3Q4A B;  4ATG A;  4HOQ A;  3T5X A;  3CK7 A;  4FU3 A;  3VLD A;  2A4Z A;  1WM5 A;  4NRH B;  4TUU A;  5FZS A;  2R17 C;  4CGW A;  4RZ0 A;  4APF A;  4AJW A;  1H2V C;  3OS5 A;  2KCK A;  4JLG A;  4Y6C A;  2NXP A;  4I1O B;  2AXZ A;  4B89 A;  3HNA A;  3M57 A;  4H7X A;  2YIN A;  2ION A;  2WMN A;  3MEK A;  3LXU X;  3SZ7 A;  2WQ6 A;  4ACK A;  2KCL A;  4GZ3 A;  3QK0 A;  1OWL A;  3F9Y A;  3FEY A;  3G2T A;  3IKO B;  4FLB A;  4GYO A;  2IJG X;  3ENE A;  2PQN A;  4DPR A;  2J9Q A;  4UI9 C;  3FTY A;  4GZC A;  3JCK C;  1IQR A;  4M3O A;  5G05 C;  2LSU A;  4I6J A;  3U4T A;  5A6C A;  5LX8 A;  4IJ8 A;  3RQ4 A;  2VJ8 A;  4TV3 A;  4J7I A;  5FT9 A;  4AP2 A;  4MI5 A;  2OVB A;  2WXP A;  2C0M A;  5FQ7 A;  3KAE A;  2L9B A;  4HVB A;  3FUK A;  4G2V A;  2XGO A;  5A7D B;  4GYY A;  3FUI A;  2XPY A;  1IQU A;  4J8E A;  1JUQ A;  5T0K A;  5EX0 A;  2A5U A;  1IHG A;  1X5B A;  5FQ4 A;  2RFI A;  5F5E A;  5LSX A;  3PE3 A;  2KC7 A;  3PDN A;  1OWO A;  4OYS A;  4AXH A;  4LUN U;  5AYF A;  3GYZ A;  3SNX A;  2VGX A;  4F7A A;  5ANL A;  3IV0 A;  2CHW A;  2YHE A;  3LY8 A;  4CDR A;  2R5S A;  3LDZ A;  4EZJ A;  3M58 A;  3QAR A;  4GPK A;  5TH7 A;  3CBO A;  4KVO A;  2DBA A;  3KEZ A;  3EIQ C;  2NC9 A;  4EPZ A;  1E96 B;  3BG0 B;  4PDX A;  4ILH B;  5BW8 C;  3JYS A;  3FUL A;  3FWV A;  2J4B A;  2AXV A;  4HOT A;  3S7B A;  5LSZ A;  5JHB A;  3TL5 A;  2WXL A;  3MGB A;  1Z3X A;  3SD5 A;  3GW4 A;  4JEH A;  4ANU A;  3APC A;  2JV0 A;  2QPW A;  2WXR A;  4H7Y A;  2V8S E;  2KCV A;  1S0P A;  2X6F A;  3IBE A;  3MA5 A;  3ML9 A;  4L2L A;  4XZ4 A;  4BTB A;  5JJT A;  1N6C A;  2WM9 A;  3FDH A;  4FMU A;  4V3I A;  1PC2 A;  4GZD A;  3M54 A;  4BFR A;  3BG1 B;  2I1J A;  3LYA A;  2CHZ A;  4BX8 A;  1N52 A;  2BTD A;  3LVQ E;  4A1G A;  1KLX A;  3SHF A;  4N5C A;  4Y6W A;  4FP7 A;  4UQZ A;  4I9C A;  5CCM A;  1DVP A;  2KM4 A;  2Y4U A;  3CHO A;  4R7L A;  5KJM A;  2FBN A;  3UPV A;  5FTP A;  4I51 A;  3ASG A;  4GMJ A;  3MV3 B;  5ENN A;  2LAI A;  4E47 A;  3CBP A;  5E76 A;  3TXN A;  3NZU A;  4QFV A;  2VTB B;  4WWO A;  3ULQ A;  3FU5 A;  2DIW A;  2KZT A;  2WQH A;  4U63 A;  3EIJ A;  1NP7 A;  5AEN A;  4LCT A;  4EQF A;  2WXK A;  4F1S A;  4XKC A;  2MRI A;  2MHK A;  4JXT A;  4YNM A;  4WUY A;  4AVX A;  1ELW A;  3ML8 A;  4U04 A;  2VSX E;  3B7R L;  3ASH A;  2OND A;  1SZ9 A;  5BT1 A;  3S7J A;  5J08 A;  5JJ7 A;  3CVU A;  2IGQ A;  4MI0 A;  3LPZ A;  3QWV A;  4F53 A;  4GA0 A;  2V0P A;  3DB5 A;  2UWJ G;  3LCA A;  1E8Y A;  2J08 A;  2JLB A;  1PAQ A;  1HS6 A;  2FO7 A;  4IN3 B;  3P2B A;  2HYZ A;  3NZS A;  2HR2 A;  4MS6 A;  4XE0 A;  3M56 A;  4O30 A;  4PH4 B;  3LY9 A;  3ZRH A;  3O4Z A;  3FH7 A;  3VLE A;  4DI4 A;  3OXG A;  4H12 A;  3PNT B;  4WAF A;  4BY6 A;  5AJD A;  1PY1 A;  2AWI A;  4BX9 A;  1XQH A;  2BUG A;  3EDT B;  3B7U X;  2WQ7 A;  3MO5 A;  3QJZ A;  2XHE A;  5G04 C;  3HVE A;  3WXX A;  4UWK A;  3OOI A;  4HOS A;  5FQ6 A;  3ESL A;  1E7V A;  4PS7 A;  3SF4 A;  4B8C B;  4E85 A;  2E0I A;  3PNL B;  3ONK A;  5KJN A;  4JEU A;  3UT8 A;  2PM6 A;  2XQ0 A;  1B89 A;  1XGW A;  1OUV A;  3D3M A;  2PQR A;  3FU0 A;  2WXQ A;  4GCN A;  2WXM A;  3L54 A;  4N39 A;  2YHC A;  4MLP A;  1U3D A;  5AYW D;  3G2W A;  4BT8 A;  4CCA A;  2V5F A;  4UQY A;  2W5Y A;  2XCC A;  2R59 A;  4C0M A;  3Q5M A;  4I9E A;  5F6L A;  4YNP A;  3VTY A;  4B0Z A;  2XRZ A;  2LSV A;  1UJK A;  5FJY A;  5T4Y A;  3FHE A;  4UWL A;  4BSX A;  4UI9 J;  3T8M A;  4AEZ C;  4KVM A;  4FHJ A;  5G05 J;  2CG2 A;  2VSO E;  4CDM A;  4N3A A;  1QZ2 A;  1WAO 1;  3E4B A;  3M59 A;  4HXI A;  3VUZ A;  4Q69 A;  3CST A;  4IYP A;  3MKQ A;  3B13 A;  4UWF A;  2WXF A;  4XI9 A;  4I43 A;  3KMA A;  1HU3 A;  3AS8 A;  2OOE A;  3CHR A;  1PEG A;  1MQS A;  4DK5 A;  3CVX A;  3SBT B;  1MUF A;  1FVH A;  2Y4T A;  4J83 A;  4BUP A;  1U3C A;  4UI9 K;  5JJ6 A;  4NVQ A;  1TJF A;  3RRU A;  4JW1 A;  3QKY A;  4E6H A;  4RVB A;  4K0R A;  4G1T A;  4EBA G;  4AIF A;  3AU4 A;  3L6A A;  1JPL A;  3OTN A;  3Q15 A;  3TXM A;  3CK9 A;  1QNF A;  3K5K A;  3IHV A;  1N3J A;  3FTV A;  3QAQ A;  2I2O A;  4HFG A;  3FUN A;  4IUL A;  2FEZ A;  3CR3 A;  1INZ A;  4JZY A;  4EEC A;  2WPV A;  2WVI A;  2J49 A;  4AOF A;  4NUR A;  4JL0 A;  4B8A A;  3PS6 A;  4NQ0 A;  3CVV A;  4BTA A;  5DIZ A;  3D9P A;  4U0S A;  3ZYK A;  4KXK B;  4KZC A;  1MVH A;  1HO8 A;  2GRL A;  4FJY A;  1HG2 A;  2I1K A;  2JEK A;  1N54 A;  3ASF A;  4GYW A;  1ELR A;  1H19 A;  3FTZ A;  3R7R A;  1Y6I A;  4QEN A;  3MO2 A;  1HG5 A;  3RRN B;  1Z3Y A;  3SW9 A;  2Y3A A;  3SGH A;  4ACL A;  2V4L A;  5EDS A;  2I6H A;  4GA2 A;  2HM8 A;  3PUK A;  2AXU A;  2I9C A;  3B7T A;  5BV0 A;  4QEP A;  1EPU A;  4G23 A;  2IOS A;  1IYG A;  3RO2 A;  1FVF A;  4Q94 A;  2FUL A;  3I3N A;  3AS4 A;  4FC8 A;  2RD0 A;  4ANV A;  3S7D A;  4JC8 A;  3LS8 A;  4EBA A;  4KYO B;  1H6K A;  3LY7 A;  4RG9 A;  5CMW A;  4I1M A;  4CT4 A;  3CVP A;  3EHN A;  3CHS A;  3ZEF A;  4KZ0 A;  2WXI A;  3DPD A;  3K9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...