3QWWA

Crystal structure of histone lysine methyltransferase smyd2 in complex with the methyltransferase inhibitor sinefungin
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
430
structure length
430
Chain Sequence
AEARGGLERFCSAGKGRGLRALRPFHVGDLLFSCPAYACVLTVGERGHHCECCFARKEGLSKCGRCKQAFYCDVECQKEDWPLHKLECSSMVVLGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVREFESHLDKLDNEKKDLIQSDIAALHQFYSKYLEFPDHSSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGDEVFTSYIDLLYPTEDRNDRLRDSYFFTCECRECTTKDKDKAKVEVRKLSSPPQAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALKYGQKIIKPYSKHYPVYSLNVASMWLKLGRLYMGLENKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SET and MYND domain-containing protein 2
publication title Crystal structures of histone and p53 methyltransferase SmyD2 reveal a conformational flexibility of the autoinhibitory C-terminal domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 150
structure length 430
sequence length 430
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3qwwA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3qwwA01
4Y6CA 3ZHEB 4N3BA 4GPKA 3F9YA 4A1SA 3M54A 4N2SA 3URZA 3FWVA 4GZ5A 5DBKA 3CBMA 3RJWA 2IGQA 2UWJG 1WM5A 3OXLA 4KBQA 4WNEA 4FMUA 2W5ZA 3O48A 3QWVA 4IN3B 5ARGA 5FZRA 3CEQA 2VGXA 3AS5A 2Q7FA 1NA3A 3ESKA 2VSNA 2YQ8A 1O9SA 3VUZA 5KJNA 2HYZA 3EP0A 4YPUA 5FZQA 1KT0A 4AY6A 3AS8A 3GW4A 4JA7A 5FZSA 5M72A 1QQEA 1NA0A 5JINA 4J7FA 4GA1A 3RAYA 1E96B 3UQ3A 3M53A 2VSYA 5DIZA 4EQFA 5TH7A 5JJ0A 3CV0A 2VGXB 3LY9A 3K9IA 3MO5A 3CKBA 1IYGA 4GCNA 2ONDA 2PQNA 1KLXA 2LNIA 3Q4AB 1ML9A 4ME2A 5D0QD 2W5YA 4JHRA 5FJYA 2P58C 3RIBA 3QWWA 5EX3A 4GCOA 3TGOA 4GYYA 1P5QA 2WQHA 1NZNA 3QWPA 5F59A 3SF4A 3MO2A 4G2VA 4U0ZA 1QZ2A 3MA5A 5F5EA 4YPAA 4MI5A 2L6JA 2NC9A 3FPDA 4JDSA 1FCHA 2G46A 2C2LA 3ASFA 4J8DA 3KD7A 2XPIA 3MKRA 3SZ7A 4I51A 2XGMA 3CVLA 3CVPA 4AY5A 1ZKKA 3GYZA 3M58A 2KATA 3Q47B 1XQHA 3MO0A 4YVOA 1MT6A 5ARFA 3FP3A 3F9WA 1A17A 3N71A 5EG2A 5D0OD 1OUVA 4AU7A 1W3BA 1YA0A 3VTXA 5LSXA 3R9AB 3OXFA 3RQ4A 3LCAA 3SW9A 2KCLA 3ZPJA 5AYWD 2UY1B 3E4BA 3VTYA 3EDTB 5TTFA 3M57A 2KCKA 3CKCA 2VYIA 3CK9A 1ELWA 2KC7A 3ZN3A 4U07A 4WNGA 2XGSA 4UI9J 4YNDA 5JJ7A 3M5AA 2BUGA 4RZ0A 4RG6A 5CPRB 2J9QA 4I2WA 5TEGA 4GZ6A 3PE3A 4JLGA 3S7JA 3LY8A 1HXIA 1MVXA 5JIYA 2FO7A 5JHNA 5EKQD 3KMJA 5G04C 4G1TA 1HZ4A 4JL0A 1PEGA 2FEZA 3Q15A 3GZ2A 2FF4A 5LCWJ 4HOSA 2RFIA 4MI0A 5CCLA 3KMTA 3TAXA 4WNDA 3OXGA 2XCBA 4BT8A 2HO1A 4I1AA 4H12A 4J0UA 4E47A 4N5CA 4U04A 4LDGA 4UQYA 3Q5MA 5FTPA 3ZFWA 2I6HA 4F3VA 4UQZA 3TG5A 3HYMB 4KYOB 1N6CA 2JV0A 3BEEA 3S7FA 2R5SA 3JYSA 3GZ1A 4G26A 4JA9A 5F6LA 2BQZA 4BTAA 4WNFA 4O30A 3KAEA 1IHGA 3WXXA 5LSZA 4J8FA 2XGOA 4WUYA 3VV0A 4HOQA 3RO3A 2PL2A 3ULQA 4UQXA 5G05C 5G04J 3DB5A 5A7DB 4UI9K 4N3CA 3RO2A 4YPEA 1ZU2A 1N3JA 3CBOA 4GYWA 1H3IA 4U0SA 4N3AA 2UY1A 4IJ8A 3UPVA 3CBPA 4YVQC 2FI7A 5T0MA 4B94A 2Y4TA 4J83A 3ASDA 3DALA 3CVNA 2Y4UA 5T0KA 4G23A 4O6FA 3K5KA 3Q49B 4NQ0A 2R3AA 3F9XA 2KCVA 2IF4A 2XEVA 4QEPA 3MV3B 3KMAA 5AYFA 3MEKA 3QKYA 4J8EA 3RU0A 5JJ6A 4I2ZA 4RG9A 4YNPA 4XI0A 4XI9A 3LY7A 2C0LA 5CHEE 5A6CA 2YHCA 3CK7A 4GA2A 4I9CA 2XCCA 5G05J 5KJLA 4NJ5A 3ASGA 4I9EA 5T5GA 5C1DA 3QDNA 2PQRA 5F6KC 3PE4A 2MHKA 4H7XA 4N39A 4BT9A 1MUFA 1PC2A 5FT9A 4AIFA 2VGYA 2O8JA 4U0UA 3OS5A 3OOIA 1ZBPA 4J8OA 4BUPA 4Y6WA 1WAO1 4QENA 4IJDA 3BO5A 4XIFA 4CGWA 4Z4PA 3TG4A 4CDRA 4J7IA 3S7DA 1Y8MA 3PDNA 5HQ8A 1TJCA 3LKUA 3LYAA 4G25A 3U4TA 3FFLA 4GA0A 1MVHA 5KJMA 3CK8A 3M55A 1HH8A 3ASHA 3AS4A 3IHXA 4GZ3A 4N2QA 4HOTA 4BTBA 2QFCA 5JJTA 3HNAA 1B89A 1ELRA 3CVQA 3M59A 2LSVA 2E2EA 4G24A 4I17A 5KJKA 4LEUA 1N6AA 4NRHB 3SWCA 4QEOA 5CCMA 4ABNA 3S7BA 2WPVA 4HOUA 5BNWA 3UUXA 4H7YA 3RJVA 3ZGQA 5BT1A 4UI9C 3OPEA 4YNMA 4APOA 1KT1A 3NF1A 2V5FA 2PZIA 2C0MA 4BWRA 3IEGA 3ZHEA 4HORA 3S8PA 2AVPA 2FBNA 4CGVA 3F9ZA 2JLBA 3MV2B 4KXKB 5EX0A 3RKVA 2OOEA 3U3WA 4C1QA 2LSUA 3KS2A 2F69A 3LPZA 2QPWA 2VQ2A 2IFUA 4NVQA 4W9RA 5BW8C 4AM9A 5LCWC 2GW1A 3QOUA 4GYOA 1XNFA 2DBAA 2HR2A 5HI7A 3M56A
chains in the Genus database with same CATH superfamily
1OCRE 4JZYA 1HS6A 3FTYA 4GPKA 3F9YA 4A1SA 4KMOA 2NXPA 4GZ5A 2QY7A 3FHEA 3CBMA 2X6HA 4GTPA 2B6CA 3RJWA 1RW2A 4FMUA 2XZDG 3I4RB 1TNYA 3QWVA 2EIME 4IN3B 5FZRA 4K5AB 3FU3A 3ZKJA 5H7PA 2BTDA 3CHMA 1O9SA 4J8YA 4FLBA 2IU1A 3UIOC 3ZXSA 5FZSA 5M72A 2P9KG 4BEPA 3PS6A 2GRNB 3ULYA 4CEMA 5HRYA 3RAYA 4HNAD 2VSYA 4KZCA 4PUCA 3SBTB 2VGXB 1O1RA 3LY9A 4OYSA 3J5PA 3SHFA 3MO5A 4GCNA 2LNIA 4GMLA 3UMVA 4KT6B 2WB2A 2W5YA 4JHRA 4FHKA 2P58C 3RIBA 5JHBA 2WQHA 1TNZA 3C3RA 4A1GA 1NZNA 4BX9A 1OCZE 1JPLA 5F59A 3DBSA 4U0ZA 4DX7D 2NC9A 4DLQA 1FCHA 4MS6A 3C5RA 2C2LA 2I2OA 5E76A 2VJ8A 2HM8A 3ZIMA 3KD7A 3EHRA 3T5VA 3EIQC 3UM2A 3HXCA 2KATA 4C0EA 1UN9A 5ARFA 3FP3A 4MLPA 4J6IA 3T8KA 1ZB1A 4B0ZA 5D0OD 4U96D 1OUVA 3ULEG 3NBNB 3P1UA 2DYSE 2RD0A 3D9HA 4L2LA 5T8IA 3FUMA 3D9MA 2P9NG 5AYWD 3EDTB 3W9FA 5TTFA 4LRZA 5BXUA 3M57A 2XENA 2VYIA 4O60A 5CMWA 1E90A 4PDXA 5JJ7A 4UI9J 2AJAA 2BUGA 4U63A 3ABLE 4HRMB 4OVVA 2JABA 4JLGA 3LY8A 5JIYA 2WXQA 1DVPA 3UT4A 5B3SE 4HB5A 4G1TA 1HZ4A 3UX4A 4ACLA 4J7WA 3LDZA 3FH8A 2FEZA 3Q15A 5CBNA 2OCCE 2FF4A 5CCLA 4A63B 4H12A 4J0UA 4JVSA 4U04A 3V2OA 4LDGA 3Q5MA 5FTPA 4GZDA 3LJ3A 3QARA 4KYOB 1H6KA 4UWGA 2JV0A 3GZ1A 3DRAA 4I43A 1U3CA 2BQZA 4BTAA 4WNFA 3WXXA 1O5MA 3AU5A 2XGOA 5FQ6A 2DWZA 4F1SA 1OCOE 5LP0A 2PM7A 3RO3A 5ENRD 5G05C 1IQUA 3FU6A 2BEDA 3RSEG 1ZU2A 2OEVA 3CBOA 4GYWA 4ILHB 4N3AA 4DX6D 3CVVA 3UPVA 4U8HA 4EECA 2P9PG 5AENA 3CIAA 1N95A 2Y4TA 4J83A 4DRXE 2XRYA 1MQSA 1MX2A 3K5KA 1TN8A 3DSWA 1N4SA 1FVHA 3CSFA 4AXHA 3MEKA 4J8EA 5FQ7A 1MJ0A 1JWGA 4JXTA 4YNPA 4XI0A 3LY7A 4AEZC 2XRZA 3HDXA 5A6CA 2YHCA 4QQIA 3CK7A 4YDYA 3Q75A 4I9CA 2DCPA 4CDNA 5G05J 4NJ5A 1OWMA 3PZ4A 5ITZF 2I1JA 4MBGA 4JEHA 3RRNB 4RSYA 3PZDA 1EDUA 5F6KC 3NZUA 3L82A 2WXNA 4URKA 4DI4A 5FT9A 4U0UA 4Y6WA 4TUMA 2WXHA 1WAO1 4O1OA 4ATGA 5J90A 3G2UA 3C72A 1H6PA 3FTUA 1YCSB 4Z4PA 4CDRA 3SQVA 3NQPA 2WVIA 2ZGDA 4BSZB 4ATZD 2J49A 2F37A 5B1AE 5HQ8A 3U66A 3L08A 1HG5A 2X6JA 1L5JA 3LYAA 3ZXPA 4HRLA 4G25A 1D9SA 3DPDA 4GA0A 3PH0C 3V30A 3SD5A 3DSVA 5KJMA 3O4ZA 2B0OE 4N2QA 5AQ9A 5JJTA 2ZU6B 4O1PA 5CRUA 5A23A 2XEHA 2F8XK 4PS8A 3CVQA 2LSVA 4G24A 5D2MC 2P9IG 4I17A 2WQ7A 3CVWA 2R2LA 2YNQA 3SBSA 3FEXA 1N6AA 3UTMA 4NRHB 4TXRA 2YINA 4HOUA 3AJIA 4HLLA 3ZGQA 3LVQE 3NZSA 4GB9A 3J5QB 3OPEA 3ZW3A 4APOA 3OTNA 3NF1A 4BWRA 2XPYA 4A3VA 3L13A 3PNTB 2JLBA 3BU8A 3ASNE 1SZAA 3FU5A 2QPWA 1KZPA 3G2SA 3MYVA 4AM9A 2QZAA 1VDYA 3E33A 4BSXA 3UT8A 2Y3AA 5KNHD 3ZHEB 3FUKA 2BF0X 3SGHA 3IBEA 5DBKA 5AN8A 4HI8A 1H2UA 1WM5A 2W5ZA 4DPRA 1QYMA 1V55E 3AS5A 3G2TA 2YHEA 2IJGX 3AU4A 3ESKA 2VSNA 5T4YA 5KJNA 2KZTA 5FZQA 2ETBA 3AS8A 4JA7A 1OWLA 3QK0A 3UINC 1PAQA 2WXFA 5JINA 4CCAA 5KWDA 1DC2A 4GA1A 1E96B 1UN8A 3UQ3A 4EHMA 2ZIRA 3PUKA 2GRPB 2CG2A 2XZTG 4KVMA 2WXLA 5LOZA 3CKBA 1S63A 3CHQA 1AWCB 3Q4AB 4CDMA 5FJYA 3EHNA 4EZKA 5D66A 3Q78A 4GCOA 2LUHA 5FIOA 4EBAA 3TWWA 3MA5A 5F5EA 4YPAA 2AXUA 3FUNA 3KSQA 3SZ7A 3ZRHA 2XGMA 3DPYA 4I51A 4DI3A 3CVLA 3T5XA 4GAAA 3PEVB 1HO8A 3FULA 2WXMA 1TNBA 3ZU7B 4GTTA 2A5UA 2CHXA 4K0RA 3T8MA 2P2CP 1A17A 3APCA 2KXPC 4AU7A 1KPSB 1W3BA 4OAUC 2M63A 5LFAA 3ZYQA 2VSXE 3SFXA 1E8XA 1UJKA 3LCAA 3SW9A 4PS7A 1N11A 4JHKA 1XGWA 2KCKA 4AP2A 3D9OA 3CKCA 4QFVA 1D8EA 3CHOA 4YNDA 2XGSA 4RZ0A 3TWUA 2ZXWE 4RG6A 2IOSA 1N54A 2J9QA 3M56A 1IHBA 1MX6A 2FO7A 4B93B 4UWLA 1YMPA 3GZSA 3FUHA 2HE0A 3KMJA 4NACA 1H19A 5FINA 4JL0A 1PEGA 3GZ2A 5LCWJ 2RFIA 2IQCA 3KMTA 3KEZA 3HRAA 4BT8A 5EIBE 2J8SD 4N5CA 2IY0C 2L9BA 3ZFWA 4F3VA 3S2AA 2RFAA 1N4RA 4NIKA 3S7FA 4G26A 5F6LA 3IXEA 5JMND 1SA5A 3KAEA 5EILA 1IHGA 4J8FA 5E75A 4AVXA 3PUJA 2XHEA 2PL2A 3ULQA 3X2QE 2WXGA 3NAWA 2OEWA 2UY1A 1KZOA 4YVQC 4APFA 4HBDA 5T0MA 3TWRA 3FH7A 1BLXB 2Y4UA 3MZLB 2P9UG 4GTMA 3ZUVB 5T0KA 4XKBA 4JPSA 4G23A 2J07A 4I6JA 1MHQA 3FTXA 3Q49B 2QC9A 3UT7A 2IF4A 4QEPA 3RK6A 3MV3B 2LAHA 3KMAA 2OV8A 3PRZA 5AIJA 5IY5E 3VLDA 1HU3A 4XI9A 5CHEE 3SY2A 3TWVA 2XPZA 2ETCA 4GA2A 1Z3YA 3PZ1A 4E85A 2P9LG 4JC8A 2AXZA 2XCCA 4OVUA 3AG3E 3FTWA 4F6RD 3KSLA 4F1PA 3G2VA 1OCCE 2VTBA 3HXEA 4EPZA 4BY6A 5C2YA 3JQ0A 1BU9A 3L9TA 2PQRA 3EHQA 3PE4A 4H7XA 4N39A 3IV0A 1MUFA 4AJWA 3JXIA 3D9PA 3TL5A 4AIFA 3OS5A 3TWSA 4J8OA 3G2WA 5EIDA 2NSZA 4XKCA 1JWFA 4JW1A 3APDA 1E7UA 3DWLG 3HIZA 4K03A 3NOGD 4CGWA 3ML8A 3S7DA 1NL4A 4AV7A 1SW6A 1Y8MA 3TWTA 4XZ4A 2EIJE 2MYOA 1TJCA 5AQAA 4U8YD 3VLEA 3LKUA 3UI2A 1NI1A 3CR3A 1LTXA 3DSTA 3CHRA 2ZGGA 3JXJA 3FFLA 2R17C 3RRMB 2EQXA 4LNBA 3RRUA 2XEEA 1HH8A 4EZLA 4V3IA 1H6OA 1SVXA 5CRVA 4GTOA 2IO3C 2OVBA 4WWOA 1K8KG 1U2VG 4ANVA 4LCTA 3ZVVA 4QEOA 3KEAA 5CECB 2WPVA 4CT4A 5BNWA 4H7YA 1TN7A 3FU0A 4AOFA 1GW6A 4YNMA 2EILE 2PZIA 4JB8P 3CVYA 4LNUD 1TNUA 4XX5A 3S8PA 2FBNA 3L54A 4CGVA 4U95D 3U64A 3FUIA 5EX0A 4DX2A 1Z5SC 3RKVA 3CSTA 1LF8A 3MKQB 2OOEA 3U3WA 2LSUA 4B8AA 1V54E 3KS2A 5EYLA 2F69A 3Q7AA 2VQ2A 3V2XA 5BW8C 1G3NB 3QOUA 4GYOA 1SQMA 1OWNA 1XNFA 3JUEA 4CRWA 5T3RA 4GZCA 4B8CB 3DEPA 3E37A 3CQCB 5KCMA 1HX8A 3V31A 3MGBA 4U8VD 3Q9UC 1D8DA 4N3BA 3M54A 3QAQA 4ACKA 3C98A 3URZA 4C9BB 5AARA 3FWVA 4WAFA 2UWJG 1E8ZA 3FH5A 5ARGA 1MYOA 3CEQA 2VGXA 3B7SA 4WWPA 1K1BA 3VUZA 1QNFA 4YPUA 4AY6A 3ESLA 2H6HA 2NYJA 2GRLA 1UOHA 1X81A 1H2VC 1H2TC 3AG4E 2JEKA 2QYUA 4KZ0A 5DIZA 1OWOA 2GRRB 3NOCD 3CV0A 3DXMG 1X5BA 2AWIA 1INZA 4U7EB 3K9IA 3JQ1A 5FQ8A 3I5PA 4ME2A 3QWWA 4WWNA 3QJZA 3TGOA 1P5QA 4RVBA 3T9KA 1Y6IA 1S70B 3QWPA 3SF4A 3MO2A 1QZ2A 4Q94A 4MI5A 2L6JA 3B7RL 3PZ2A 3FPDA 2WQ6A 1HG2A 2CHWA 3ONKA 2P9SG 4UWHA 4F7AA 4XEIG 3ASFA 2XPIA 3MKRA 3CVPA 1O1SA 2LO6A 4AY5A 4X8QA 4GTSA 3GYZA 3LXUX 1XQHA 1JUQA 2A4ZA 3EJNA 3MO0A 1MT6A 4LERA 2OVFA 4HLEA 3F9WA 4FHJA 3HHMA 3HVEA 3N71A 1EPUA 5EG2A 1HFAA 4M3OA 2FO1E 3E34A 2WM9A 1H0AA 3OXFA 2LXLA 2X6IA 3IKOB 4HFGA 5EYPF 2UY1B 5ENSD 2WXKA 3LS8A 2IOLA 3P2BA 3CK9A 1ELWA 5AJLA 3CVUA 1N52A 3APFA 4U07A 3Q79A 5CPRB 3FTVA 4I2WA 2VSOE 4GZ6A 3S7JA 1HXIA 3B7UX 1MVXA 3UKRG 5JHNA 5G2NA 4D10C 2PNNA 1FVFA 3I4GA 4ANUA 2E0IA 3PVLA 1OY3D 4HOSA 2L0IA 2L0TB 3TAXA 2R05A 3OXGA 1TEZA 2HO1A 4I1AA 2X38A 1FT2A 1QBQA 4GTQA 4UQYA 4MRUA 1EYHA 4L9PA 2I6HA 4M7CA 3TG5A 3HYMB 4EBAG 1N6CA 2FULA 3FTZA 3JYSA 4JA9A 3TXNA 4KVOA 1OWPA 5BPPA 4O30A 3JUIA 3L17A 3FUJA 3SFZA 2CG3A 4WUYA 3VV0A 3MX3A 4I6EA 2J4BA 4GTVA 4Z68A 3BG0B 3ASOE 4PH4B 5A7DB 5LX8A 4FJZA 4N3CA 3RO2A 1N3JA 3TXMA 4BFRA 1O1TA 4IJ8A 3CBPA 4I1MA 2FI7A 3DXKG 4FP7A 3D9KA 1LD7A 5FWQA 4FC8A 3UKUG 5CERB 3FTSA 4BETA 3C3OA 3DSXA 4O6FA 5AQBA 3V79K 2R3AA 3CLJA 2KCVA 2DYRE 5B1BE 4FJYA 3L16A 2XEVA 1DCQA 5AQ7A 3LVRE 5AYFA 1UJJA 5JJ6A 3HXBA 3MCXA 4HS2A 1K3ZD 3CGHA 1TJFA 2H6GA 1DCEA 2CFUA 4ZHBA 1MX4A 4IRUA 5EDSA 3CQGB 4GMRA 5BV1A 3ASGA 1S0PA 2IONA 1IQRA 5T5GA 2R59A 5KNGA 5C1DA 4A55A 4HQDA 4UWFA 4FLHA 4BT9A 4DJAA 2VGYA 2O8JA 3OOIA 5ENPD 4QENA 4IJDA 3B13A 4CZ2D 3IHYA 1TN6A 1S64A 3PDNA 3D9LA 4GMJA 4NURA 3U4TA 5CMYA 2ILRA 4TUUA 3BG1B 1MVHA 2V4HC 2ZISA 3M55A 3FUFA 3IHXA 1OXJA 2QFCA 2V0PA 1UG3A 3HNAA 1ELRA 2LAIA 4RQIA 2E2EA 1WDYA 3DSSA 3E32A 2MOWA 1N4QA 3EU5A 3DSUA 3DEOA 3SWCA 3Q7FA 4G8KA 3TWQA 5CCMA 4B89A 4PS3A 4YDOA 4L2YA 3UUXA 1Z6TA 3L22A 4YDWA 3RJVA 4FA6A 2CHZA 4UI9C 4BERA 1KT1A 2V5FA 4BX8A 3ZHEA 5ENQD 4CT0A 3ZYKA 2X6KA 3F9ZA 4KXKB 1E8WA 5JHAA 4JHJA 3D9NA 1N4PA 5ENTD 3L6AA 2WXJA 2IFUA 2I9CA 4UWKA 4W9RA 2EIKE 2GGFA 4P29A 2GW1A 3SNXA 2PM6A 2DBAA 5ANRA 1IKND 2HR2A 1TYQG 3CVXA 5HI7A 4Y6CA 3F6QA 2Y69E 1WG0A 4L7TA 4N2SA 4JD2G 2ETAA 1BPOA 2IGQA 3OXLA 4KBQA 4WNEA 4DX1A 3O48A 3R7QA 3HXDA 1Q2ZA 1AP7A 3HVEB 2Q7FA 1NA3A 5J08A 1HE8A 2WXPA 4XE0A 2YQ8A 3EP0A 2HYZA 3PEUB 2J4DA 4G8LA 1KT0A 3SFYA 3GW4A 1QQEA 2Y0BG 4I6GA 2R03A 1NA0A 1SA4A 5AJDA 1N0RA 5FQ4A 4J7FA 4EZJA 3FDHA 2QYJA 3M53A 4DUIA 4EQFA 4HRNA 5TH7A 5JJ0A 3B95A 2XS8A 2CFZA 5BXOA 3ENEA 2RKKA 5ENNA 3IHVA 4A3TA 1SZ9A 2BKKB 1IYGA 4TXPA 2KZTB 3AAAC 1KLXA 2ONDA 2PQNA 5EN5D 1ML9A 3QB2A 2WMNA 4HXIA 5D0QD 2XQ0A 5EX3A 4GYYA 2WXIA 2V5QC 4YDEA 4CYMD 4J8SA 4G2VA 3EU9A 4ILIA 3HXFA 4TRQA 2A5EA 4JDSA 2G46A 2KM4A 2DZOA 4J8DA 4ANXA 4LUNU 3UM3A 1ZKKA 1PY1A 3M58A 4L1BA 3Q47B 4YVOA 2IEJA 3LEWA 2RG8A 4FADA 4FU3A 3TJPA 4G11A 4RLYA 4E6HA 4F53A 1YA0A 4UUCA 3VTXA 5LSXA 3R9AB 2LXMA 3RQ4A 2KCLA 3QNKA 3ZYLA 3R9MA 3ZPJA 3E4BA 3VTYA 3PZ3A 2KC7A 3ZN3A 4WNGA 1OT8A 3ABME 4LSZE 3M5AA 2V4LA 1DNPA 1BI7B 2L6BA 3WG7E 4OAVB 3RAUA 1NFIE 5TEGA 3PE3A 4LG6A 4ANWA 1TR4A 5EKQD 5G04C 1WY6A 4GU5A 1E8YA 1N9AA 3OAWA 2H6IA 5HS0A 3D9JA 4MI0A 1JCRA 4WNDA 2XCBA 2DVWA 4N5QA 4E47A 2GROB 2X3MA 3UIPC 4BESA 4LNGA 2IO2C 2KBXA 4UQZA 3D3MA 3BEEA 4HVBA 2R5SA 4FULA 4GPMA 1FT1A 4K5CA 5LSZA 1JCSA 3ZNGA 1A5EA 2AXVA 3MJWA 4HOQA 4ZFHA 4HI9A 5CEAA 4UQXA 5ANLA 5G04J 3DB5A 4UI9K 4K5BA 4YPEA 4C0MA 1H3IA 2R02A 4U0SA 2WXRA 2H6FA 4B94A 4C48B 1E7VA 3D9IA 4ILGA 3ASDA 3DALA 3CVNA 2XS1A 2DZNA 4DK5A 3Q9NC 4NQ0A 3F9XA 3ISMC 5JA4D 5CEDB 2Y1LE 2EINE 3QKYA 4IYPA 3RU0A 4I2ZA 4RG9A 3BQOA 2C0LA 2J09A 1N0QA 3NB2A 3ZYMA 3C3QA 2F0YA 5KJLA 4DX5D 4I9EA 5AAOA 1U3DA 3PNLB 2VGEA 3I3NA 3ML9A 3SI5A 3QDNA 3HG0D 2MHKA 4DLOA 2V8SE 1PC2A 4IULA 2GRQB 4TXQA 1ZBPA 4BUPA 5KBAA 5HKPA 3VLFA 5CBOA 3E30A 3ABKE 5ENOD 3UXGA 3Q73A 3BO5A 4XIFA 1JCQA 2WXOA 3TG4A 3ONLA 4J7IA 1EF1C 1MZCA 3EUVA 2RFMA 3B7BA 2VTBB 1Z3XA 3PREA 3FEYA 1NP7A 2AW6A 3SO8A 1LD8A 4Q96A 1ELKA 5BUZA 3FY4A 2F8YA 3CK8A 1FPPA 2WMOA 3ASHA 3AS4A 3UM0A 2GRMA 4GZ3A 4HOTA 1IXVA 4BTBA 3LJNA 1UW4B 5BV0A 2MRIA 1B89A 3U9WA 4R7LA 3M59A 3TWXA 3AG2E 5KJKA 3JCKC 3R7RA 3W9GA 4MKTA 3MKQA 4GTRA 4LEUA 1K1AA 3FUEA 1TNOA 2J08A 4ABNA 4I1OB 3S7BA 5G55A 1RZ4A 1YYHA 4Q69A 3FUDA 5BT1A 1HF8A 2X6FA 3CHPA 3BUAA 2C0MA 3IEGA 3ZEFA 4HORA 2AVPA 3B7TA 3MV2B 4TV3A 3EHMA 4C1QA 3UM1A 3CHSA 3LPZA 3QC1A 4JEUA 4NVQA 2BKGA 2I1KA 5LCWC 4L23A 1BI8B 1BD8A 2DIWA 3AG1E 1N94A 3EIJA
chains in the Genus database with same CATH topology
3MGBA 4Y6CA 4JZYA 1HS6A 4N3BA 3ZHEB 3FTYA 4L7TA 4GPKA 3F9YA 4A1SA 3FUKA 3M54A 4N2SA 3QAQA 4KMOA 3C98A 4ACKA 2NXPA 3URZA 4C9BB 2BF0X 3SGHA 3FWVA 4GZ5A 2QY7A 4WAFA 3FHEA 3IBEA 5DBKA 3CBMA 2X6HA 3RJWA 1BPOA 2IGQA 1H2UA 2UWJG 1E8ZA 1WM5A 3OXLA 4KBQA 4WNEA 4FMUA 3FH5A 2W5ZA 4DPRA 3I4RB 3O48A 3QWVA 4IN3B 5ARGA 5FZRA 3R7QA 3CEQA 2VGXA 3HVEB 3AS5A 2Q7FA 1NA3A 3FU3A 5J08A 3B7SA 3G2TA 4WWPA 2YHEA 1HE8A 2IJGX 3AU4A 3ESKA 2WXPA 2BTDA 2VSNA 3CHMA 2YQ8A 4XE0A 5T4YA 1O9SA 3VUZA 5KJNA 2HYZA 3EP0A 1QNFA 2J4DA 3PEUB 4FLBA 4YPUA 2IU1A 2KZTA 5FZQA 1KT0A 4AY6A 3ZXSA 3AS8A 3GW4A 4JA7A 5FZSA 5M72A 3ESLA 1QQEA 4I6GA 1OWLA 1NA0A 3QK0A 3PS6A 1PAQA 2WXFA 5AJDA 5JINA 4CEMA 5FQ4A 2GRLA 4J7FA 4CCAA 4EZJA 3FDHA 4GA1A 1H2VC 1H2TC 3RAYA 1E96B 1UN8A 3UQ3A 2JEKA 3M53A 2VSYA 4KZ0A 5DIZA 4EQFA 1OWOA 4KZCA 5TH7A 5JJ0A 3PUKA 4PUCA 3CV0A 2CG2A 3SBTB 2VGXB 2CFZA 1X5BA 2AWIA 1INZA 3ENEA 4KVMA 5ENNA 3LY9A 2WXLA 3IHVA 3K9IA 5BNWA 4OYSA 3SHFA 1SZ9A 5LOZA 4A3TA 3MO5A 3CKBA 3JQ1A 1IYGA 4GCNA 2KZTB 3I5PA 3CHQA 5FQ8A 1KLXA 2ONDA 2PQNA 2LNIA 3Q4AB 1ML9A 3QB2A 4GMLA 2WMNA 3UMVA 4KT6B 2WB2A 4ME2A 4HXIA 5D0QD 2W5YA 4JHRA 5FJYA 3EHNA 4FHKA 4CDMA 4EZKA 2XQ0A 2P58C 3RIBA 3QWWA 4WWNA 5EX3A 4GCOA 3QJZA 5JHBA 3TGOA 4GYYA 1P5QA 4RVBA 2WQHA 1Y6IA 2WXIA 4A1GA 1NZNA 3QWPA 4BX9A 4EBAA 1JPLA 5F59A 4J8SA 3DBSA 3SF4A 3MO2A 4G2VA 4U0ZA 1QZ2A 3MA5A 5F5EA 4Q94A 4YPAA 4MI5A 2L6JA 3B7RL 4ILIA 2NC9A 4TRQA 2AXUA 3FPDA 2WQ6A 4DLQA 4JDSA 1FCHA 1HG2A 4MS6A 2G46A 2CHWA 2C2LA 2KM4A 3FUNA 3ONKA 2I2OA 4UWHA 5E76A 4F7AA 2VJ8A 3ASFA 4J8DA 4LUNU 2HM8A 3ZIMA 4ANXA 3KD7A 2XPIA 3MKRA 3SZ7A 3ZRHA 2XGMA 3T5VA 4I51A 4DI3A 3CVLA 3T5XA 3CVPA 2LO6A 4AY5A 3EIQC 1ZKKA 1PY1A 3GYZA 4GAAA 3M58A 3LXUX 4L1BA 3PEVB 2KATA 3Q47B 1HO8A 3FULA 1XQHA 1JUQA 2A4ZA 2WXMA 3EJNA 3MO0A 4YVOA 4C0EA 1MT6A 1UN9A 5ARFA 2A5UA 2CHXA 4K0RA 3T8MA 3FP3A 4LERA 2OVFA 3LEWA 4MLPA 4J6IA 2RG8A 4HLEA 4FADA 4FHJA 3F9WA 3HHMA 4FU3A 1A17A 3HVEA 3APCA 1EPUA 3N71A 3TJPA 4G11A 1HFAA 4M3OA 5D0OD 4B0ZA 5EG2A 1OUVA 4E6HA 3P1UA 4AU7A 4F53A 1W3BA 2M63A 2WM9A 2RD0A 1YA0A 4L2LA 3VTXA 5LSXA 5LFAA 5T8IA 3R9AB 1H0AA 3ZYQA 3OXFA 2VSXE 2X6IA 3IKOB 4HFGA 1E8XA 3RQ4A 1UJKA 3LCAA 3SW9A 2KCLA 3FUMA 3QNKA 3D9MA 3ZYLA 3ZPJA 4PS7A 5AYWD 2UY1B 3E4BA 3VTYA 3EDTB 2WXKA 3LS8A 5TTFA 4LRZA 4JHKA 1XGWA 3M57A 2KCKA 4AP2A 3D9OA 2IOLA 3CKCA 3P2BA 2VYIA 3CK9A 1ELWA 5AJLA 2KC7A 1N52A 3APFA 4QFVA 3ZN3A 5CMWA 3CVUA 3CHOA 4U07A 4WNGA 1E90A 4PDXA 2XGSA 4UI9J 4YNDA 2V4LA 5JJ7A 2BUGA 4U63A 1DNPA 3M5AA 4RZ0A 4RG6A 2IOSA 1N54A 5CPRB 2J9QA 3FTVA 4OVVA 4I2WA 2VSOE 5TEGA 4GZ6A 3PE3A 4JLGA 3S7JA 3LY8A 4ANWA 1HXIA 3B7UX 1MVXA 2WXQA 2FO7A 5JIYA 4UWLA 5JHNA 1DVPA 3UT4A 5G2NA 3GZSA 3FUHA 5EKQD 4D10C 3KMJA 5G04C 4G1TA 1FVFA 1HZ4A 1WY6A 3I4GA 4GU5A 1E8YA 1H19A 4NACA 3OAWA 3UX4A 4ACLA 4ANUA 2E0IA 3LDZA 3PVLA 4JL0A 3FH8A 1PEGA 2FEZA 3Q15A 3GZ2A 3D9JA 2FF4A 2L0IA 5LCWJ 2L0TB 2IQCA 4HOSA 2RFIA 4MI0A 5CCLA 3KMTA 3KEZA 4WNDA 3TAXA 3OXGA 1TEZA 2XCBA 4BT8A 2HO1A 4I1AA 4H12A 4J0UA 2X38A 4E47A 2X3MA 4N5CA 4JVSA 4U04A 4LDGA 4UQYA 4MRUA 3Q5MA 5FTPA 1EYHA 2L9BA 3ZFWA 4GZDA 3LJ3A 2I6HA 4F3VA 4UQZA 3S2AA 3TG5A 3HYMB 3QARA 4EBAG 3D3MA 4KYOB 1N6CA 1H6KA 4UWGA 2JV0A 2FULA 3BEEA 3FTZA 4HVBA 3S7FA 2R5SA 4FULA 3JYSA 3GZ1A 4G26A 4I43A 1U3CA 4JA9A 3TXNA 4KVOA 5F6LA 2BQZA 1OWPA 4BTAA 5BPPA 4WNFA 4O30A 3KAEA 1IHGA 3JUIA 3L17A 3FUJA 3SFZA 3WXXA 5LSZA 3AU5A 4J8FA 5E75A 2CG3A 2XGOA 4WUYA 5FQ6A 3VV0A 3MX3A 4AVXA 2AXVA 3MJWA 4I6EA 3PUJA 4F1SA 2J4BA 4HOQA 5LP0A 2PM7A 2XHEA 3RO3A 3BG0B 2PL2A 3ULQA 4UQXA 4PH4B 5G05C 5ANLA 5G04J 3DB5A 5A7DB 1IQUA 4UI9K 5LX8A 4FJZA 3FU6A 4N3CA 3RO2A 4YPEA 4C0MA 1ZU2A 2WXGA 1N3JA 4GYWA 3CBOA 3TXMA 4BFRA 1H3IA 4ILHB 4U0SA 4N3AA 2UY1A 4IJ8A 2WXRA 3CVVA 3UPVA 3CBPA 4YVQC 4APFA 4U8HA 4I1MA 4EECA 2FI7A 5AENA 5T0MA 4B94A 3CIAA 1E7VA 4FP7A 2Y4TA 3D9KA 4J83A 5FWQA 3D9IA 3FH7A 4ILGA 4FC8A 3ASDA 2XRYA 3DALA 1MQSA 3CVNA 2Y4UA 3MZLB 5T0KA 3FTSA 4XKBA 4JPSA 4G23A 2J07A 4DK5A 4O6FA 4I6JA 3K5KA 1MHQA 3FTXA 3CLJA 3Q49B 4NQ0A 2R3AA 2KCVA 3F9XA 4FJYA 3UT7A 2IF4A 3L16A 2XEVA 4QEPA 1FVHA 3MV3B 3RK6A 2LAHA 3KMAA 3LVRE 5AYFA 2OV8A 3CSFA 3PRZA 1UJJA 4AXHA 3MEKA 3QKYA 4IYPA 4J8EA 3RU0A 5FQ7A 5JJ6A 5AIJA 4I2ZA 3VLDA 1JWGA 1HU3A 3MCXA 4JXTA 4RG9A 4HS2A 4YNPA 4XI0A 4XI9A 3CGHA 3LY7A 4AEZC 1TJFA 2C0LA 5CHEE 2J09A 2XRZA 3HDXA 5A6CA 2YHCA 2CFUA 3CK7A 2XPZA 4GA2A 1Z3YA 3ZYMA 4I9CA 4E85A 4JC8A 2DCPA 4IRUA 4CDNA 5EDSA 3CQGB 2AXZA 2XCCA 5BV1A 4OVUA 3FTWA 5G05J 5KJLA 3G2VA 4NJ5A 3ASGA 4I9EA 1S0PA 2VTBA 1OWMA 1U3DA 3PNLB 2I1JA 2IONA 1IQRA 4EPZA 5T5GA 4JEHA 4BY6A 3I3NA 5C2YA 2R59A 3ML9A 3RRNB 3SI5A 5C1DA 3JQ0A 3QDNA 4RSYA 3PZDA 4A55A 1EDUA 4UWFA 2PQRA 5F6KC 3PE4A 2MHKA 4H7XA 4FLHA 3NZUA 4N39A 4BT9A 2V8SE 3IV0A 4DLOA 4AJWA 4DJAA 1MUFA 1PC2A 3D9PA 3TL5A 2WXNA 4URKA 4DI4A 5FT9A 4IULA 4AIFA 2VGYA 2O8JA 4U0UA 3OS5A 3OOIA 1ZBPA 4J8OA 3G2WA 4BUPA 4Y6WA 2NSZA 2WXHA 1WAO1 4XKCA 3VLFA 1JWFA 4ATGA 4JW1A 5J90A 4IJDA 4QENA 3APDA 1E7UA 3G2UA 4K03A 3HIZA 3BO5A 4XIFA 4CGWA 3FTUA 4Z4PA 2WXOA 3B13A 3TG4A 3ONLA 4CDRA 4J7IA 1EF1C 3NQPA 2WVIA 3ML8A 3S7DA 2VTBB 1Z3XA 3PREA 4AV7A 3IHYA 2J49A 3FEYA 1Y8MA 4XZ4A 3PDNA 5HQ8A 1TJCA 3L08A 3U66A 1HG5A 3D9LA 1NP7A 3LKUA 3VLEA 2AW6A 1L5JA 2X6JA 3LYAA 3CR3A 4GMJA 4Q96A 4G25A 4NURA 3DPDA 3CHRA 3U4TA 5CMYA 2ILRA 3FFLA 4GA0A 4TUUA 1ELKA 3BG1B 3PH0C 1MVHA 3SD5A 5BUZA 5KJMA 2R17C 3FY4A 3RRMB 3CK8A 3O4ZA 2EQXA 3RRUA 3M55A 1HH8A 2WMOA 3ASHA 3AS4A 4EZLA 3FUFA 4V3IA 2GRMA 3IHXA 4GZ3A 4N2QA 4HOTA 4BTBA 2QFCA 2V0PA 1UW4B 5BV0A 2MRIA 5JJTA 1UG3A 2ZU6B 3HNAA 1B89A 5A23A 1ELRA 3U9WA 4PS8A 3CVQA 4R7LA 2LAIA 3M59A 2LSVA 2E2EA 2OVBA 4G24A 4WWOA 2MOWA 2WQ7A 4I17A 3CVWA 5KJKA 3JCKC 3R7RA 2YNQA 4ANVA 4MKTA 3SBSA 3MKQA 4LEUA 3FEXA 3FUEA 4LCTA 3ZVVA 1N6AA 4NRHB 3SWCA 4QEOA 2J08A 5CCMA 4ABNA 4B89A 4I1OB 4PS3A 2WPVA 2YINA 5G55A 3S7BA 4HOUA 4L2YA 3UUXA 4H7YA 1Z6TA 3L22A 3RJVA 4CT4A 4Q69A 4FA6A 2CHZA 3FUDA 3ZGQA 3LVQE 1HF8A 3NZSA 5BT1A 3FU0A 2X6FA 4GB9A 4UI9C 4AOFA 1GW6A 3OPEA 3CHPA 3ZW3A 4YNMA 4APOA 3OTNA 1KT1A 3NF1A 2V5FA 2PZIA 2C0MA 4BX8A 4BWRA 3CVYA 3IEGA 3ZHEA 3ZEFA 4XX5A 2XPYA 4HORA 3S8PA 4A3VA 2AVPA 4CT0A 3B7TA 2FBNA 3L54A 3ZYKA 4CGVA 2X6KA 3L13A 3PNTB 3F9ZA 3U64A 2JLBA 3MV2B 3FUIA 4KXKB 5EX0A 1E8WA 3RKVA 3CSTA 1LF8A 3MKQB 2OOEA 4TV3A 3EHMA 3U3WA 4C1QA 2LSUA 4B8AA 5JHAA 3KS2A 1SZAA 4JHJA 3FU5A 2F69A 3D9NA 3CHSA 3LPZA 3QC1A 3L6AA 4JEUA 2WXJA 2VQ2A 2IFUA 2I9CA 4UWKA 2QPWA 2I1KA 3G2SA 4W9RA 4NVQA 3MYVA 5BW8C 4AM9A 2GGFA 4P29A 5LCWC 4L23A 2GW1A 3QOUA 1VDYA 1SQMA 2PM6A 1OWNA 4GYOA 3SNXA 3UT8A 4BSXA 1XNFA 4CRWA 2DBAA 5ANRA 2DIWA 2Y3AA 2HR2A 5T3RA 4GZCA 4B8CB 3CVXA 3CQCB 5KCMA 1HX8A 5HI7A 3M56A 3EIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y6C A;  3ZHE B;  4N3B A;  4GPK A;  3F9Y A;  4A1S A;  3M54 A;  4N2S A;  3URZ A;  3FWV A;  4GZ5 A;  5DBK A;  3CBM A;  3RJW A;  2IGQ A;  2UWJ G;  1WM5 A;  3OXL A;  4KBQ A;  4WNE A;  4FMU A;  2W5Z A;  3O48 A;  3QWV A;  4IN3 B;  5ARG A;  5FZR A;  3CEQ A;  2VGX A;  3AS5 A;  2Q7F A;  1NA3 A;  3ESK A;  2VSN A;  2YQ8 A;  1O9S A;  3VUZ A;  5KJN A;  2HYZ A;  3EP0 A;  4YPU A;  5FZQ A;  1KT0 A;  4AY6 A;  3AS8 A;  3GW4 A;  4JA7 A;  5FZS A;  5M72 A;  1QQE A;  1NA0 A;  5JIN A;  4J7F A;  4GA1 A;  3RAY A;  1E96 B;  3UQ3 A;  3M53 A;  2VSY A;  5DIZ A;  4EQF A;  5TH7 A;  5JJ0 A;  3CV0 A;  2VGX B;  3LY9 A;  3K9I A;  3MO5 A;  3CKB A;  1IYG A;  4GCN A;  2OND A;  2PQN A;  1KLX A;  2LNI A;  3Q4A B;  1ML9 A;  4ME2 A;  5D0Q D;  2W5Y A;  4JHR A;  5FJY A;  2P58 C;  3RIB A;  3QWW A;  5EX3 A;  4GCO A;  3TGO A;  4GYY A;  1P5Q A;  2WQH A;  1NZN A;  3QWP A;  5F59 A;  3SF4 A;  3MO2 A;  4G2V A;  4U0Z A;  1QZ2 A;  3MA5 A;  5F5E A;  4YPA A;  4MI5 A;  2L6J A;  2NC9 A;  3FPD A;  4JDS A;  1FCH A;  2G46 A;  2C2L A;  3ASF A;  4J8D A;  3KD7 A;  2XPI A;  3MKR A;  3SZ7 A;  4I51 A;  2XGM A;  3CVL A;  3CVP A;  4AY5 A;  1ZKK A;  3GYZ A;  3M58 A;  2KAT A;  3Q47 B;  1XQH A;  3MO0 A;  4YVO A;  1MT6 A;  5ARF A;  3FP3 A;  3F9W A;  1A17 A;  3N71 A;  5EG2 A;  5D0O D;  1OUV A;  4AU7 A;  1W3B A;  1YA0 A;  3VTX A;  5LSX A;  3R9A B;  3OXF A;  3RQ4 A;  3LCA A;  3SW9 A;  2KCL A;  3ZPJ A;  5AYW D;  2UY1 B;  3E4B A;  3VTY A;  3EDT B;  5TTF A;  3M57 A;  2KCK A;  3CKC A;  2VYI A;  3CK9 A;  1ELW A;  2KC7 A;  3ZN3 A;  4U07 A;  4WNG A;  2XGS A;  4UI9 J;  4YND A;  5JJ7 A;  3M5A A;  2BUG A;  4RZ0 A;  4RG6 A;  5CPR B;  2J9Q A;  4I2W A;  5TEG A;  4GZ6 A;  3PE3 A;  4JLG A;  3S7J A;  3LY8 A;  1HXI A;  1MVX A;  5JIY A;  2FO7 A;  5JHN A;  5EKQ D;  3KMJ A;  5G04 C;  4G1T A;  1HZ4 A;  4JL0 A;  1PEG A;  2FEZ A;  3Q15 A;  3GZ2 A;  2FF4 A;  5LCW J;  4HOS A;  2RFI A;  4MI0 A;  5CCL A;  3KMT A;  3TAX A;  4WND A;  3OXG A;  2XCB A;  4BT8 A;  2HO1 A;  4I1A A;  4H12 A;  4J0U A;  4E47 A;  4N5C A;  4U04 A;  4LDG A;  4UQY A;  3Q5M A;  5FTP A;  3ZFW A;  2I6H A;  4F3V A;  4UQZ A;  3TG5 A;  3HYM B;  4KYO B;  1N6C A;  2JV0 A;  3BEE A;  3S7F A;  2R5S A;  3JYS A;  3GZ1 A;  4G26 A;  4JA9 A;  5F6L A;  2BQZ A;  4BTA A;  4WNF A;  4O30 A;  3KAE A;  1IHG A;  3WXX A;  5LSZ A;  4J8F A;  2XGO A;  4WUY A;  3VV0 A;  4HOQ A;  3RO3 A;  2PL2 A;  3ULQ A;  4UQX A;  5G05 C;  5G04 J;  3DB5 A;  5A7D B;  4UI9 K;  4N3C A;  3RO2 A;  4YPE A;  1ZU2 A;  1N3J A;  3CBO A;  4GYW A;  1H3I A;  4U0S A;  4N3A A;  2UY1 A;  4IJ8 A;  3UPV A;  3CBP A;  4YVQ C;  2FI7 A;  5T0M A;  4B94 A;  2Y4T A;  4J83 A;  3ASD A;  3DAL A;  3CVN A;  2Y4U A;  5T0K A;  4G23 A;  4O6F A;  3K5K A;  3Q49 B;  4NQ0 A;  2R3A A;  3F9X A;  2KCV A;  2IF4 A;  2XEV A;  4QEP A;  3MV3 B;  3KMA A;  5AYF A;  3MEK A;  3QKY A;  4J8E A;  3RU0 A;  5JJ6 A;  4I2Z A;  4RG9 A;  4YNP A;  4XI0 A;  4XI9 A;  3LY7 A;  2C0L A;  5CHE E;  5A6C A;  2YHC A;  3CK7 A;  4GA2 A;  4I9C A;  2XCC A;  5G05 J;  5KJL A;  4NJ5 A;  3ASG A;  4I9E A;  5T5G A;  5C1D A;  3QDN A;  2PQR A;  5F6K C;  3PE4 A;  2MHK A;  4H7X A;  4N39 A;  4BT9 A;  1MUF A;  1PC2 A;  5FT9 A;  4AIF A;  2VGY A;  2O8J A;  4U0U A;  3OS5 A;  3OOI A;  1ZBP A;  4J8O A;  4BUP A;  4Y6W A;  1WAO 1;  4QEN A;  4IJD A;  3BO5 A;  4XIF A;  4CGW A;  4Z4P A;  3TG4 A;  4CDR A;  4J7I A;  3S7D A;  1Y8M A;  3PDN A;  5HQ8 A;  1TJC A;  3LKU A;  3LYA A;  4G25 A;  3U4T A;  3FFL A;  4GA0 A;  1MVH A;  5KJM A;  3CK8 A;  3M55 A;  1HH8 A;  3ASH A;  3AS4 A;  3IHX A;  4GZ3 A;  4N2Q A;  4HOT A;  4BTB A;  2QFC A;  5JJT A;  3HNA A;  1B89 A;  1ELR A;  3CVQ A;  3M59 A;  2LSV A;  2E2E A;  4G24 A;  4I17 A;  5KJK A;  4LEU A;  1N6A A;  4NRH B;  3SWC A;  4QEO A;  5CCM A;  4ABN A;  3S7B A;  2WPV A;  4HOU A;  5BNW A;  3UUX A;  4H7Y A;  3RJV A;  3ZGQ A;  5BT1 A;  4UI9 C;  3OPE A;  4YNM A;  4APO A;  1KT1 A;  3NF1 A;  2V5F A;  2PZI A;  2C0M A;  4BWR A;  3IEG A;  3ZHE A;  4HOR A;  3S8P A;  2AVP A;  2FBN A;  4CGV A;  3F9Z A;  2JLB A;  3MV2 B;  4KXK B;  5EX0 A;  3RKV A;  2OOE A;  3U3W A;  4C1Q A;  2LSU A;  3KS2 A;  2F69 A;  3LPZ A;  2QPW A;  2VQ2 A;  2IFU A;  4NVQ A;  4W9R A;  5BW8 C;  4AM9 A;  5LCW C;  2GW1 A;  3QOU A;  4GYO A;  1XNF A;  2DBA A;  2HR2 A;  5HI7 A;  3M56 A; 
#chains in the Genus database with same CATH topology
 1OCR E;  4JZY A;  1HS6 A;  3FTY A;  4GPK A;  3F9Y A;  4A1S A;  4KMO A;  2NXP A;  4GZ5 A;  2QY7 A;  3FHE A;  3CBM A;  2X6H A;  4GTP A;  2B6C A;  3RJW A;  1RW2 A;  4FMU A;  2XZD G;  3I4R B;  1TNY A;  3QWV A;  2EIM E;  4IN3 B;  5FZR A;  4K5A B;  3FU3 A;  3ZKJ A;  5H7P A;  2BTD A;  3CHM A;  1O9S A;  4J8Y A;  4FLB A;  2IU1 A;  3UIO C;  3ZXS A;  5FZS A;  5M72 A;  2P9K G;  4BEP A;  3PS6 A;  2GRN B;  3ULY A;  4CEM A;  5HRY A;  3RAY A;  4HNA D;  2VSY A;  4KZC A;  4PUC A;  3SBT B;  2VGX B;  1O1R A;  3LY9 A;  4OYS A;  3J5P A;  3SHF A;  3MO5 A;  4GCN A;  2LNI A;  4GML A;  3UMV A;  4KT6 B;  2WB2 A;  2W5Y A;  4JHR A;  4FHK A;  2P58 C;  3RIB A;  5JHB A;  2WQH A;  1TNZ A;  3C3R A;  4A1G A;  1NZN A;  4BX9 A;  1OCZ E;  1JPL A;  5F59 A;  3DBS A;  4U0Z A;  4DX7 D;  2NC9 A;  4DLQ A;  1FCH A;  4MS6 A;  3C5R A;  2C2L A;  2I2O A;  5E76 A;  2VJ8 A;  2HM8 A;  3ZIM A;  3KD7 A;  3EHR A;  3T5V A;  3EIQ C;  3UM2 A;  3HXC A;  2KAT A;  4C0E A;  1UN9 A;  5ARF A;  3FP3 A;  4MLP A;  4J6I A;  3T8K A;  1ZB1 A;  4B0Z A;  5D0O D;  4U96 D;  1OUV A;  3ULE G;  3NBN B;  3P1U A;  2DYS E;  2RD0 A;  3D9H A;  4L2L A;  5T8I A;  3FUM A;  3D9M A;  2P9N G;  5AYW D;  3EDT B;  3W9F A;  5TTF A;  4LRZ A;  5BXU A;  3M57 A;  2XEN A;  2VYI A;  4O60 A;  5CMW A;  1E90 A;  4PDX A;  5JJ7 A;  4UI9 J;  2AJA A;  2BUG A;  4U63 A;  3ABL E;  4HRM B;  4OVV A;  2JAB A;  4JLG A;  3LY8 A;  5JIY A;  2WXQ A;  1DVP A;  3UT4 A;  5B3S E;  4HB5 A;  4G1T A;  1HZ4 A;  3UX4 A;  4ACL A;  4J7W A;  3LDZ A;  3FH8 A;  2FEZ A;  3Q15 A;  5CBN A;  2OCC E;  2FF4 A;  5CCL A;  4A63 B;  4H12 A;  4J0U A;  4JVS A;  4U04 A;  3V2O A;  4LDG A;  3Q5M A;  5FTP A;  4GZD A;  3LJ3 A;  3QAR A;  4KYO B;  1H6K A;  4UWG A;  2JV0 A;  3GZ1 A;  3DRA A;  4I43 A;  1U3C A;  2BQZ A;  4BTA A;  4WNF A;  3WXX A;  1O5M A;  3AU5 A;  2XGO A;  5FQ6 A;  2DWZ A;  4F1S A;  1OCO E;  5LP0 A;  2PM7 A;  3RO3 A;  5ENR D;  5G05 C;  1IQU A;  3FU6 A;  2BED A;  3RSE G;  1ZU2 A;  2OEV A;  3CBO A;  4GYW A;  4ILH B;  4N3A A;  4DX6 D;  3CVV A;  3UPV A;  4U8H A;  4EEC A;  2P9P G;  5AEN A;  3CIA A;  1N95 A;  2Y4T A;  4J83 A;  4DRX E;  2XRY A;  1MQS A;  1MX2 A;  3K5K A;  1TN8 A;  3DSW A;  1N4S A;  1FVH A;  3CSF A;  4AXH A;  3MEK A;  4J8E A;  5FQ7 A;  1MJ0 A;  1JWG A;  4JXT A;  4YNP A;  4XI0 A;  3LY7 A;  4AEZ C;  2XRZ A;  3HDX A;  5A6C A;  2YHC A;  4QQI A;  3CK7 A;  4YDY A;  3Q75 A;  4I9C A;  2DCP A;  4CDN A;  5G05 J;  4NJ5 A;  1OWM A;  3PZ4 A;  5ITZ F;  2I1J A;  4MBG A;  4JEH A;  3RRN B;  4RSY A;  3PZD A;  1EDU A;  5F6K C;  3NZU A;  3L82 A;  2WXN A;  4URK A;  4DI4 A;  5FT9 A;  4U0U A;  4Y6W A;  4TUM A;  2WXH A;  1WAO 1;  4O1O A;  4ATG A;  5J90 A;  3G2U A;  3C72 A;  1H6P A;  3FTU A;  1YCS B;  4Z4P A;  4CDR A;  3SQV A;  3NQP A;  2WVI A;  2ZGD A;  4BSZ B;  4ATZ D;  2J49 A;  2F37 A;  5B1A E;  5HQ8 A;  3U66 A;  3L08 A;  1HG5 A;  2X6J A;  1L5J A;  3LYA A;  3ZXP A;  4HRL A;  4G25 A;  1D9S A;  3DPD A;  4GA0 A;  3PH0 C;  3V30 A;  3SD5 A;  3DSV A;  5KJM A;  3O4Z A;  2B0O E;  4N2Q A;  5AQ9 A;  5JJT A;  2ZU6 B;  4O1P A;  5CRU A;  5A23 A;  2XEH A;  2F8X K;  4PS8 A;  3CVQ A;  2LSV A;  4G24 A;  5D2M C;  2P9I G;  4I17 A;  2WQ7 A;  3CVW A;  2R2L A;  2YNQ A;  3SBS A;  3FEX A;  1N6A A;  3UTM A;  4NRH B;  4TXR A;  2YIN A;  4HOU A;  3AJI A;  4HLL A;  3ZGQ A;  3LVQ E;  3NZS A;  4GB9 A;  3J5Q B;  3OPE A;  3ZW3 A;  4APO A;  3OTN A;  3NF1 A;  4BWR A;  2XPY A;  4A3V A;  3L13 A;  3PNT B;  2JLB A;  3BU8 A;  3ASN E;  1SZA A;  3FU5 A;  2QPW A;  1KZP A;  3G2S A;  3MYV A;  4AM9 A;  2QZA A;  1VDY A;  3E33 A;  4BSX A;  3UT8 A;  2Y3A A;  5KNH D;  3ZHE B;  3FUK A;  2BF0 X;  3SGH A;  3IBE A;  5DBK A;  5AN8 A;  4HI8 A;  1H2U A;  1WM5 A;  2W5Z A;  4DPR A;  1QYM A;  1V55 E;  3AS5 A;  3G2T A;  2YHE A;  2IJG X;  3AU4 A;  3ESK A;  2VSN A;  5T4Y A;  5KJN A;  2KZT A;  5FZQ A;  2ETB A;  3AS8 A;  4JA7 A;  1OWL A;  3QK0 A;  3UIN C;  1PAQ A;  2WXF A;  5JIN A;  4CCA A;  5KWD A;  1DC2 A;  4GA1 A;  1E96 B;  1UN8 A;  3UQ3 A;  4EHM A;  2ZIR A;  3PUK A;  2GRP B;  2CG2 A;  2XZT G;  4KVM A;  2WXL A;  5LOZ A;  3CKB A;  1S63 A;  3CHQ A;  1AWC B;  3Q4A B;  4CDM A;  5FJY A;  3EHN A;  4EZK A;  5D66 A;  3Q78 A;  4GCO A;  2LUH A;  5FIO A;  4EBA A;  3TWW A;  3MA5 A;  5F5E A;  4YPA A;  2AXU A;  3FUN A;  3KSQ A;  3SZ7 A;  3ZRH A;  2XGM A;  3DPY A;  4I51 A;  4DI3 A;  3CVL A;  3T5X A;  4GAA A;  3PEV B;  1HO8 A;  3FUL A;  2WXM A;  1TNB A;  3ZU7 B;  4GTT A;  2A5U A;  2CHX A;  4K0R A;  3T8M A;  2P2C P;  1A17 A;  3APC A;  2KXP C;  4AU7 A;  1KPS B;  1W3B A;  4OAU C;  2M63 A;  5LFA A;  3ZYQ A;  2VSX E;  3SFX A;  1E8X A;  1UJK A;  3LCA A;  3SW9 A;  4PS7 A;  1N11 A;  4JHK A;  1XGW A;  2KCK A;  4AP2 A;  3D9O A;  3CKC A;  4QFV A;  1D8E A;  3CHO A;  4YND A;  2XGS A;  4RZ0 A;  3TWU A;  2ZXW E;  4RG6 A;  2IOS A;  1N54 A;  2J9Q A;  3M56 A;  1IHB A;  1MX6 A;  2FO7 A;  4B93 B;  4UWL A;  1YMP A;  3GZS A;  3FUH A;  2HE0 A;  3KMJ A;  4NAC A;  1H19 A;  5FIN A;  4JL0 A;  1PEG A;  3GZ2 A;  5LCW J;  2RFI A;  2IQC A;  3KMT A;  3KEZ A;  3HRA A;  4BT8 A;  5EIB E;  2J8S D;  4N5C A;  2IY0 C;  2L9B A;  3ZFW A;  4F3V A;  3S2A A;  2RFA A;  1N4R A;  4NIK A;  3S7F A;  4G26 A;  5F6L A;  3IXE A;  5JMN D;  1SA5 A;  3KAE A;  5EIL A;  1IHG A;  4J8F A;  5E75 A;  4AVX A;  3PUJ A;  2XHE A;  2PL2 A;  3ULQ A;  3X2Q E;  2WXG A;  3NAW A;  2OEW A;  2UY1 A;  1KZO A;  4YVQ C;  4APF A;  4HBD A;  5T0M A;  3TWR A;  3FH7 A;  1BLX B;  2Y4U A;  3MZL B;  2P9U G;  4GTM A;  3ZUV B;  5T0K A;  4XKB A;  4JPS A;  4G23 A;  2J07 A;  4I6J A;  1MHQ A;  3FTX A;  3Q49 B;  2QC9 A;  3UT7 A;  2IF4 A;  4QEP A;  3RK6 A;  3MV3 B;  2LAH A;  3KMA A;  2OV8 A;  3PRZ A;  5AIJ A;  5IY5 E;  3VLD A;  1HU3 A;  4XI9 A;  5CHE E;  3SY2 A;  3TWV A;  2XPZ A;  2ETC A;  4GA2 A;  1Z3Y A;  3PZ1 A;  4E85 A;  2P9L G;  4JC8 A;  2AXZ A;  2XCC A;  4OVU A;  3AG3 E;  3FTW A;  4F6R D;  3KSL A;  4F1P A;  3G2V A;  1OCC E;  2VTB A;  3HXE A;  4EPZ A;  4BY6 A;  5C2Y A;  3JQ0 A;  1BU9 A;  3L9T A;  2PQR A;  3EHQ A;  3PE4 A;  4H7X A;  4N39 A;  3IV0 A;  1MUF A;  4AJW A;  3JXI A;  3D9P A;  3TL5 A;  4AIF A;  3OS5 A;  3TWS A;  4J8O A;  3G2W A;  5EID A;  2NSZ A;  4XKC A;  1JWF A;  4JW1 A;  3APD A;  1E7U A;  3DWL G;  3HIZ A;  4K03 A;  3NOG D;  4CGW A;  3ML8 A;  3S7D A;  1NL4 A;  4AV7 A;  1SW6 A;  1Y8M A;  3TWT A;  4XZ4 A;  2EIJ E;  2MYO A;  1TJC A;  5AQA A;  4U8Y D;  3VLE A;  3LKU A;  3UI2 A;  1NI1 A;  3CR3 A;  1LTX A;  3DST A;  3CHR A;  2ZGG A;  3JXJ A;  3FFL A;  2R17 C;  3RRM B;  2EQX A;  4LNB A;  3RRU A;  2XEE A;  1HH8 A;  4EZL A;  4V3I A;  1H6O A;  1SVX A;  5CRV A;  4GTO A;  2IO3 C;  2OVB A;  4WWO A;  1K8K G;  1U2V G;  4ANV A;  4LCT A;  3ZVV A;  4QEO A;  3KEA A;  5CEC B;  2WPV A;  4CT4 A;  5BNW A;  4H7Y A;  1TN7 A;  3FU0 A;  4AOF A;  1GW6 A;  4YNM A;  2EIL E;  2PZI A;  4JB8 P;  3CVY A;  4LNU D;  1TNU A;  4XX5 A;  3S8P A;  2FBN A;  3L54 A;  4CGV A;  4U95 D;  3U64 A;  3FUI A;  5EX0 A;  4DX2 A;  1Z5S C;  3RKV A;  3CST A;  1LF8 A;  3MKQ B;  2OOE A;  3U3W A;  2LSU A;  4B8A A;  1V54 E;  3KS2 A;  5EYL A;  2F69 A;  3Q7A A;  2VQ2 A;  3V2X A;  5BW8 C;  1G3N B;  3QOU A;  4GYO A;  1SQM A;  1OWN A;  1XNF A;  3JUE A;  4CRW A;  5T3R A;  4GZC A;  4B8C B;  3DEP A;  3E37 A;  3CQC B;  5KCM A;  1HX8 A;  3V31 A;  3MGB A;  4U8V D;  3Q9U C;  1D8D A;  4N3B A;  3M54 A;  3QAQ A;  4ACK A;  3C98 A;  3URZ A;  4C9B B;  5AAR A;  3FWV A;  4WAF A;  2UWJ G;  1E8Z A;  3FH5 A;  5ARG A;  1MYO A;  3CEQ A;  2VGX A;  3B7S A;  4WWP A;  1K1B A;  3VUZ A;  1QNF A;  4YPU A;  4AY6 A;  3ESL A;  2H6H A;  2NYJ A;  2GRL A;  1UOH A;  1X81 A;  1H2V C;  1H2T C;  3AG4 E;  2JEK A;  2QYU A;  4KZ0 A;  5DIZ A;  1OWO A;  2GRR B;  3NOC D;  3CV0 A;  3DXM G;  1X5B A;  2AWI A;  1INZ A;  4U7E B;  3K9I A;  3JQ1 A;  5FQ8 A;  3I5P A;  4ME2 A;  3QWW A;  4WWN A;  3QJZ A;  3TGO A;  1P5Q A;  4RVB A;  3T9K A;  1Y6I A;  1S70 B;  3QWP A;  3SF4 A;  3MO2 A;  1QZ2 A;  4Q94 A;  4MI5 A;  2L6J A;  3B7R L;  3PZ2 A;  3FPD A;  2WQ6 A;  1HG2 A;  2CHW A;  3ONK A;  2P9S G;  4UWH A;  4F7A A;  4XEI G;  3ASF A;  2XPI A;  3MKR A;  3CVP A;  1O1S A;  2LO6 A;  4AY5 A;  4X8Q A;  4GTS A;  3GYZ A;  3LXU X;  1XQH A;  1JUQ A;  2A4Z A;  3EJN A;  3MO0 A;  1MT6 A;  4LER A;  2OVF A;  4HLE A;  3F9W A;  4FHJ A;  3HHM A;  3HVE A;  3N71 A;  1EPU A;  5EG2 A;  1HFA A;  4M3O A;  2FO1 E;  3E34 A;  2WM9 A;  1H0A A;  3OXF A;  2LXL A;  2X6I A;  3IKO B;  4HFG A;  5EYP F;  2UY1 B;  5ENS D;  2WXK A;  3LS8 A;  2IOL A;  3P2B A;  3CK9 A;  1ELW A;  5AJL A;  3CVU A;  1N52 A;  3APF A;  4U07 A;  3Q79 A;  5CPR B;  3FTV A;  4I2W A;  2VSO E;  4GZ6 A;  3S7J A;  1HXI A;  3B7U X;  1MVX A;  3UKR G;  5JHN A;  5G2N A;  4D10 C;  2PNN A;  1FVF A;  3I4G A;  4ANU A;  2E0I A;  3PVL A;  1OY3 D;  4HOS A;  2L0I A;  2L0T B;  3TAX A;  2R05 A;  3OXG A;  1TEZ A;  2HO1 A;  4I1A A;  2X38 A;  1FT2 A;  1QBQ A;  4GTQ A;  4UQY A;  4MRU A;  1EYH A;  4L9P A;  2I6H A;  4M7C A;  3TG5 A;  3HYM B;  4EBA G;  1N6C A;  2FUL A;  3FTZ A;  3JYS A;  4JA9 A;  3TXN A;  4KVO A;  1OWP A;  5BPP A;  4O30 A;  3JUI A;  3L17 A;  3FUJ A;  3SFZ A;  2CG3 A;  4WUY A;  3VV0 A;  3MX3 A;  4I6E A;  2J4B A;  4GTV A;  4Z68 A;  3BG0 B;  3ASO E;  4PH4 B;  5A7D B;  5LX8 A;  4FJZ A;  4N3C A;  3RO2 A;  1N3J A;  3TXM A;  4BFR A;  1O1T A;  4IJ8 A;  3CBP A;  4I1M A;  2FI7 A;  3DXK G;  4FP7 A;  3D9K A;  1LD7 A;  5FWQ A;  4FC8 A;  3UKU G;  5CER B;  3FTS A;  4BET A;  3C3O A;  3DSX A;  4O6F A;  5AQB A;  3V79 K;  2R3A A;  3CLJ A;  2KCV A;  2DYR E;  5B1B E;  4FJY A;  3L16 A;  2XEV A;  1DCQ A;  5AQ7 A;  3LVR E;  5AYF A;  1UJJ A;  5JJ6 A;  3HXB A;  3MCX A;  4HS2 A;  1K3Z D;  3CGH A;  1TJF A;  2H6G A;  1DCE A;  2CFU A;  4ZHB A;  1MX4 A;  4IRU A;  5EDS A;  3CQG B;  4GMR A;  5BV1 A;  3ASG A;  1S0P A;  2ION A;  1IQR A;  5T5G A;  2R59 A;  5KNG A;  5C1D A;  4A55 A;  4HQD A;  4UWF A;  4FLH A;  4BT9 A;  4DJA A;  2VGY A;  2O8J A;  3OOI A;  5ENP D;  4QEN A;  4IJD A;  3B13 A;  4CZ2 D;  3IHY A;  1TN6 A;  1S64 A;  3PDN A;  3D9L A;  4GMJ A;  4NUR A;  3U4T A;  5CMY A;  2ILR A;  4TUU A;  3BG1 B;  1MVH A;  2V4H C;  2ZIS A;  3M55 A;  3FUF A;  3IHX A;  1OXJ A;  2QFC A;  2V0P A;  1UG3 A;  3HNA A;  1ELR A;  2LAI A;  4RQI A;  2E2E A;  1WDY A;  3DSS A;  3E32 A;  2MOW A;  1N4Q A;  3EU5 A;  3DSU A;  3DEO A;  3SWC A;  3Q7F A;  4G8K A;  3TWQ A;  5CCM A;  4B89 A;  4PS3 A;  4YDO A;  4L2Y A;  3UUX A;  1Z6T A;  3L22 A;  4YDW A;  3RJV A;  4FA6 A;  2CHZ A;  4UI9 C;  4BER A;  1KT1 A;  2V5F A;  4BX8 A;  3ZHE A;  5ENQ D;  4CT0 A;  3ZYK A;  2X6K A;  3F9Z A;  4KXK B;  1E8W A;  5JHA A;  4JHJ A;  3D9N A;  1N4P A;  5ENT D;  3L6A A;  2WXJ A;  2IFU A;  2I9C A;  4UWK A;  4W9R A;  2EIK E;  2GGF A;  4P29 A;  2GW1 A;  3SNX A;  2PM6 A;  2DBA A;  5ANR A;  1IKN D;  2HR2 A;  1TYQ G;  3CVX A;  5HI7 A;  4Y6C A;  3F6Q A;  2Y69 E;  1WG0 A;  4L7T A;  4N2S A;  4JD2 G;  2ETA A;  1BPO A;  2IGQ A;  3OXL A;  4KBQ A;  4WNE A;  4DX1 A;  3O48 A;  3R7Q A;  3HXD A;  1Q2Z A;  1AP7 A;  3HVE B;  2Q7F A;  1NA3 A;  5J08 A;  1HE8 A;  2WXP A;  4XE0 A;  2YQ8 A;  3EP0 A;  2HYZ A;  3PEU B;  2J4D A;  4G8L A;  1KT0 A;  3SFY A;  3GW4 A;  1QQE A;  2Y0B G;  4I6G A;  2R03 A;  1NA0 A;  1SA4 A;  5AJD A;  1N0R A;  5FQ4 A;  4J7F A;  4EZJ A;  3FDH A;  2QYJ A;  3M53 A;  4DUI A;  4EQF A;  4HRN A;  5TH7 A;  5JJ0 A;  3B95 A;  2XS8 A;  2CFZ A;  5BXO A;  3ENE A;  2RKK A;  5ENN A;  3IHV A;  4A3T A;  1SZ9 A;  2BKK B;  1IYG A;  4TXP A;  2KZT B;  3AAA C;  1KLX A;  2OND A;  2PQN A;  5EN5 D;  1ML9 A;  3QB2 A;  2WMN A;  4HXI A;  5D0Q D;  2XQ0 A;  5EX3 A;  4GYY A;  2WXI A;  2V5Q C;  4YDE A;  4CYM D;  4J8S A;  4G2V A;  3EU9 A;  4ILI A;  3HXF A;  4TRQ A;  2A5E A;  4JDS A;  2G46 A;  2KM4 A;  2DZO A;  4J8D A;  4ANX A;  4LUN U;  3UM3 A;  1ZKK A;  1PY1 A;  3M58 A;  4L1B A;  3Q47 B;  4YVO A;  2IEJ A;  3LEW A;  2RG8 A;  4FAD A;  4FU3 A;  3TJP A;  4G11 A;  4RLY A;  4E6H A;  4F53 A;  1YA0 A;  4UUC A;  3VTX A;  5LSX A;  3R9A B;  2LXM A;  3RQ4 A;  2KCL A;  3QNK A;  3ZYL A;  3R9M A;  3ZPJ A;  3E4B A;  3VTY A;  3PZ3 A;  2KC7 A;  3ZN3 A;  4WNG A;  1OT8 A;  3ABM E;  4LSZ E;  3M5A A;  2V4L A;  1DNP A;  1BI7 B;  2L6B A;  3WG7 E;  4OAV B;  3RAU A;  1NFI E;  5TEG A;  3PE3 A;  4LG6 A;  4ANW A;  1TR4 A;  5EKQ D;  5G04 C;  1WY6 A;  4GU5 A;  1E8Y A;  1N9A A;  3OAW A;  2H6I A;  5HS0 A;  3D9J A;  4MI0 A;  1JCR A;  4WND A;  2XCB A;  2DVW A;  4N5Q A;  4E47 A;  2GRO B;  2X3M A;  3UIP C;  4BES A;  4LNG A;  2IO2 C;  2KBX A;  4UQZ A;  3D3M A;  3BEE A;  4HVB A;  2R5S A;  4FUL A;  4GPM A;  1FT1 A;  4K5C A;  5LSZ A;  1JCS A;  3ZNG A;  1A5E A;  2AXV A;  3MJW A;  4HOQ A;  4ZFH A;  4HI9 A;  5CEA A;  4UQX A;  5ANL A;  5G04 J;  3DB5 A;  4UI9 K;  4K5B A;  4YPE A;  4C0M A;  1H3I A;  2R02 A;  4U0S A;  2WXR A;  2H6F A;  4B94 A;  4C48 B;  1E7V A;  3D9I A;  4ILG A;  3ASD A;  3DAL A;  3CVN A;  2XS1 A;  2DZN A;  4DK5 A;  3Q9N C;  4NQ0 A;  3F9X A;  3ISM C;  5JA4 D;  5CED B;  2Y1L E;  2EIN E;  3QKY A;  4IYP A;  3RU0 A;  4I2Z A;  4RG9 A;  3BQO A;  2C0L A;  2J09 A;  1N0Q A;  3NB2 A;  3ZYM A;  3C3Q A;  2F0Y A;  5KJL A;  4DX5 D;  4I9E A;  5AAO A;  1U3D A;  3PNL B;  2VGE A;  3I3N A;  3ML9 A;  3SI5 A;  3QDN A;  3HG0 D;  2MHK A;  4DLO A;  2V8S E;  1PC2 A;  4IUL A;  2GRQ B;  4TXQ A;  1ZBP A;  4BUP A;  5KBA A;  5HKP A;  3VLF A;  5CBO A;  3E30 A;  3ABK E;  5ENO D;  3UXG A;  3Q73 A;  3BO5 A;  4XIF A;  1JCQ A;  2WXO A;  3TG4 A;  3ONL A;  4J7I A;  1EF1 C;  1MZC A;  3EUV A;  2RFM A;  3B7B A;  2VTB B;  1Z3X A;  3PRE A;  3FEY A;  1NP7 A;  2AW6 A;  3SO8 A;  1LD8 A;  4Q96 A;  1ELK A;  5BUZ A;  3FY4 A;  2F8Y A;  3CK8 A;  1FPP A;  2WMO A;  3ASH A;  3AS4 A;  3UM0 A;  2GRM A;  4GZ3 A;  4HOT A;  1IXV A;  4BTB A;  3LJN A;  1UW4 B;  5BV0 A;  2MRI A;  1B89 A;  3U9W A;  4R7L A;  3M59 A;  3TWX A;  3AG2 E;  5KJK A;  3JCK C;  3R7R A;  3W9G A;  4MKT A;  3MKQ A;  4GTR A;  4LEU A;  1K1A A;  3FUE A;  1TNO A;  2J08 A;  4ABN A;  4I1O B;  3S7B A;  5G55 A;  1RZ4 A;  1YYH A;  4Q69 A;  3FUD A;  5BT1 A;  1HF8 A;  2X6F A;  3CHP A;  3BUA A;  2C0M A;  3IEG A;  3ZEF A;  4HOR A;  2AVP A;  3B7T A;  3MV2 B;  4TV3 A;  3EHM A;  4C1Q A;  3UM1 A;  3CHS A;  3LPZ A;  3QC1 A;  4JEU A;  4NVQ A;  2BKG A;  2I1K A;  5LCW C;  4L23 A;  1BI8 B;  1BD8 A;  2DIW A;  3AG1 E;  1N94 A;  3EIJ A; 
#chains in the Genus database with same CATH homology
 3MGB A;  4Y6C A;  4JZY A;  1HS6 A;  4N3B A;  3ZHE B;  3FTY A;  4L7T A;  4GPK A;  3F9Y A;  4A1S A;  3FUK A;  3M54 A;  4N2S A;  3QAQ A;  4KMO A;  3C98 A;  4ACK A;  2NXP A;  3URZ A;  4C9B B;  2BF0 X;  3SGH A;  3FWV A;  4GZ5 A;  2QY7 A;  4WAF A;  3FHE A;  3IBE A;  5DBK A;  3CBM A;  2X6H A;  3RJW A;  1BPO A;  2IGQ A;  1H2U A;  2UWJ G;  1E8Z A;  1WM5 A;  3OXL A;  4KBQ A;  4WNE A;  4FMU A;  3FH5 A;  2W5Z A;  4DPR A;  3I4R B;  3O48 A;  3QWV A;  4IN3 B;  5ARG A;  5FZR A;  3R7Q A;  3CEQ A;  2VGX A;  3HVE B;  3AS5 A;  2Q7F A;  1NA3 A;  3FU3 A;  5J08 A;  3B7S A;  3G2T A;  4WWP A;  2YHE A;  1HE8 A;  2IJG X;  3AU4 A;  3ESK A;  2WXP A;  2BTD A;  2VSN A;  3CHM A;  2YQ8 A;  4XE0 A;  5T4Y A;  1O9S A;  3VUZ A;  5KJN A;  2HYZ A;  3EP0 A;  1QNF A;  2J4D A;  3PEU B;  4FLB A;  4YPU A;  2IU1 A;  2KZT A;  5FZQ A;  1KT0 A;  4AY6 A;  3ZXS A;  3AS8 A;  3GW4 A;  4JA7 A;  5FZS A;  5M72 A;  3ESL A;  1QQE A;  4I6G A;  1OWL A;  1NA0 A;  3QK0 A;  3PS6 A;  1PAQ A;  2WXF A;  5AJD A;  5JIN A;  4CEM A;  5FQ4 A;  2GRL A;  4J7F A;  4CCA A;  4EZJ A;  3FDH A;  4GA1 A;  1H2V C;  1H2T C;  3RAY A;  1E96 B;  1UN8 A;  3UQ3 A;  2JEK A;  3M53 A;  2VSY A;  4KZ0 A;  5DIZ A;  4EQF A;  1OWO A;  4KZC A;  5TH7 A;  5JJ0 A;  3PUK A;  4PUC A;  3CV0 A;  2CG2 A;  3SBT B;  2VGX B;  2CFZ A;  1X5B A;  2AWI A;  1INZ A;  3ENE A;  4KVM A;  5ENN A;  3LY9 A;  2WXL A;  3IHV A;  3K9I A;  5BNW A;  4OYS A;  3SHF A;  1SZ9 A;  5LOZ A;  4A3T A;  3MO5 A;  3CKB A;  3JQ1 A;  1IYG A;  4GCN A;  2KZT B;  3I5P A;  3CHQ A;  5FQ8 A;  1KLX A;  2OND A;  2PQN A;  2LNI A;  3Q4A B;  1ML9 A;  3QB2 A;  4GML A;  2WMN A;  3UMV A;  4KT6 B;  2WB2 A;  4ME2 A;  4HXI A;  5D0Q D;  2W5Y A;  4JHR A;  5FJY A;  3EHN A;  4FHK A;  4CDM A;  4EZK A;  2XQ0 A;  2P58 C;  3RIB A;  3QWW A;  4WWN A;  5EX3 A;  4GCO A;  3QJZ A;  5JHB A;  3TGO A;  4GYY A;  1P5Q A;  4RVB A;  2WQH A;  1Y6I A;  2WXI A;  4A1G A;  1NZN A;  3QWP A;  4BX9 A;  4EBA A;  1JPL A;  5F59 A;  4J8S A;  3DBS A;  3SF4 A;  3MO2 A;  4G2V A;  4U0Z A;  1QZ2 A;  3MA5 A;  5F5E A;  4Q94 A;  4YPA A;  4MI5 A;  2L6J A;  3B7R L;  4ILI A;  2NC9 A;  4TRQ A;  2AXU A;  3FPD A;  2WQ6 A;  4DLQ A;  4JDS A;  1FCH A;  1HG2 A;  4MS6 A;  2G46 A;  2CHW A;  2C2L A;  2KM4 A;  3FUN A;  3ONK A;  2I2O A;  4UWH A;  5E76 A;  4F7A A;  2VJ8 A;  3ASF A;  4J8D A;  4LUN U;  2HM8 A;  3ZIM A;  4ANX A;  3KD7 A;  2XPI A;  3MKR A;  3SZ7 A;  3ZRH A;  2XGM A;  3T5V A;  4I51 A;  4DI3 A;  3CVL A;  3T5X A;  3CVP A;  2LO6 A;  4AY5 A;  3EIQ C;  1ZKK A;  1PY1 A;  3GYZ A;  4GAA A;  3M58 A;  3LXU X;  4L1B A;  3PEV B;  2KAT A;  3Q47 B;  1HO8 A;  3FUL A;  1XQH A;  1JUQ A;  2A4Z A;  2WXM A;  3EJN A;  3MO0 A;  4YVO A;  4C0E A;  1MT6 A;  1UN9 A;  5ARF A;  2A5U A;  2CHX A;  4K0R A;  3T8M A;  3FP3 A;  4LER A;  2OVF A;  3LEW A;  4MLP A;  4J6I A;  2RG8 A;  4HLE A;  4FAD A;  4FHJ A;  3F9W A;  3HHM A;  4FU3 A;  1A17 A;  3HVE A;  3APC A;  1EPU A;  3N71 A;  3TJP A;  4G11 A;  1HFA A;  4M3O A;  5D0O D;  4B0Z A;  5EG2 A;  1OUV A;  4E6H A;  3P1U A;  4AU7 A;  4F53 A;  1W3B A;  2M63 A;  2WM9 A;  2RD0 A;  1YA0 A;  4L2L A;  3VTX A;  5LSX A;  5LFA A;  5T8I A;  3R9A B;  1H0A A;  3ZYQ A;  3OXF A;  2VSX E;  2X6I A;  3IKO B;  4HFG A;  1E8X A;  3RQ4 A;  1UJK A;  3LCA A;  3SW9 A;  2KCL A;  3FUM A;  3QNK A;  3D9M A;  3ZYL A;  3ZPJ A;  4PS7 A;  5AYW D;  2UY1 B;  3E4B A;  3VTY A;  3EDT B;  2WXK A;  3LS8 A;  5TTF A;  4LRZ A;  4JHK A;  1XGW A;  3M57 A;  2KCK A;  4AP2 A;  3D9O A;  2IOL A;  3CKC A;  3P2B A;  2VYI A;  3CK9 A;  1ELW A;  5AJL A;  2KC7 A;  1N52 A;  3APF A;  4QFV A;  3ZN3 A;  5CMW A;  3CVU A;  3CHO A;  4U07 A;  4WNG A;  1E90 A;  4PDX A;  2XGS A;  4UI9 J;  4YND A;  2V4L A;  5JJ7 A;  2BUG A;  4U63 A;  1DNP A;  3M5A A;  4RZ0 A;  4RG6 A;  2IOS A;  1N54 A;  5CPR B;  2J9Q A;  3FTV A;  4OVV A;  4I2W A;  2VSO E;  5TEG A;  4GZ6 A;  3PE3 A;  4JLG A;  3S7J A;  3LY8 A;  4ANW A;  1HXI A;  3B7U X;  1MVX A;  2WXQ A;  2FO7 A;  5JIY A;  4UWL A;  5JHN A;  1DVP A;  3UT4 A;  5G2N A;  3GZS A;  3FUH A;  5EKQ D;  4D10 C;  3KMJ A;  5G04 C;  4G1T A;  1FVF A;  1HZ4 A;  1WY6 A;  3I4G A;  4GU5 A;  1E8Y A;  1H19 A;  4NAC A;  3OAW A;  3UX4 A;  4ACL A;  4ANU A;  2E0I A;  3LDZ A;  3PVL A;  4JL0 A;  3FH8 A;  1PEG A;  2FEZ A;  3Q15 A;  3GZ2 A;  3D9J A;  2FF4 A;  2L0I A;  5LCW J;  2L0T B;  2IQC A;  4HOS A;  2RFI A;  4MI0 A;  5CCL A;  3KMT A;  3KEZ A;  4WND A;  3TAX A;  3OXG A;  1TEZ A;  2XCB A;  4BT8 A;  2HO1 A;  4I1A A;  4H12 A;  4J0U A;  2X38 A;  4E47 A;  2X3M A;  4N5C A;  4JVS A;  4U04 A;  4LDG A;  4UQY A;  4MRU A;  3Q5M A;  5FTP A;  1EYH A;  2L9B A;  3ZFW A;  4GZD A;  3LJ3 A;  2I6H A;  4F3V A;  4UQZ A;  3S2A A;  3TG5 A;  3HYM B;  3QAR A;  4EBA G;  3D3M A;  4KYO B;  1N6C A;  1H6K A;  4UWG A;  2JV0 A;  2FUL A;  3BEE A;  3FTZ A;  4HVB A;  3S7F A;  2R5S A;  4FUL A;  3JYS A;  3GZ1 A;  4G26 A;  4I43 A;  1U3C A;  4JA9 A;  3TXN A;  4KVO A;  5F6L A;  2BQZ A;  1OWP A;  4BTA A;  5BPP A;  4WNF A;  4O30 A;  3KAE A;  1IHG A;  3JUI A;  3L17 A;  3FUJ A;  3SFZ A;  3WXX A;  5LSZ A;  3AU5 A;  4J8F A;  5E75 A;  2CG3 A;  2XGO A;  4WUY A;  5FQ6 A;  3VV0 A;  3MX3 A;  4AVX A;  2AXV A;  3MJW A;  4I6E A;  3PUJ A;  4F1S A;  2J4B A;  4HOQ A;  5LP0 A;  2PM7 A;  2XHE A;  3RO3 A;  3BG0 B;  2PL2 A;  3ULQ A;  4UQX A;  4PH4 B;  5G05 C;  5ANL A;  5G04 J;  3DB5 A;  5A7D B;  1IQU A;  4UI9 K;  5LX8 A;  4FJZ A;  3FU6 A;  4N3C A;  3RO2 A;  4YPE A;  4C0M A;  1ZU2 A;  2WXG A;  1N3J A;  4GYW A;  3CBO A;  3TXM A;  4BFR A;  1H3I A;  4ILH B;  4U0S A;  4N3A A;  2UY1 A;  4IJ8 A;  2WXR A;  3CVV A;  3UPV A;  3CBP A;  4YVQ C;  4APF A;  4U8H A;  4I1M A;  4EEC A;  2FI7 A;  5AEN A;  5T0M A;  4B94 A;  3CIA A;  1E7V A;  4FP7 A;  2Y4T A;  3D9K A;  4J83 A;  5FWQ A;  3D9I A;  3FH7 A;  4ILG A;  4FC8 A;  3ASD A;  2XRY A;  3DAL A;  1MQS A;  3CVN A;  2Y4U A;  3MZL B;  5T0K A;  3FTS A;  4XKB A;  4JPS A;  4G23 A;  2J07 A;  4DK5 A;  4O6F A;  4I6J A;  3K5K A;  1MHQ A;  3FTX A;  3CLJ A;  3Q49 B;  4NQ0 A;  2R3A A;  2KCV A;  3F9X A;  4FJY A;  3UT7 A;  2IF4 A;  3L16 A;  2XEV A;  4QEP A;  1FVH A;  3MV3 B;  3RK6 A;  2LAH A;  3KMA A;  3LVR E;  5AYF A;  2OV8 A;  3CSF A;  3PRZ A;  1UJJ A;  4AXH A;  3MEK A;  3QKY A;  4IYP A;  4J8E A;  3RU0 A;  5FQ7 A;  5JJ6 A;  5AIJ A;  4I2Z A;  3VLD A;  1JWG A;  1HU3 A;  3MCX A;  4JXT A;  4RG9 A;  4HS2 A;  4YNP A;  4XI0 A;  4XI9 A;  3CGH A;  3LY7 A;  4AEZ C;  1TJF A;  2C0L A;  5CHE E;  2J09 A;  2XRZ A;  3HDX A;  5A6C A;  2YHC A;  2CFU A;  3CK7 A;  2XPZ A;  4GA2 A;  1Z3Y A;  3ZYM A;  4I9C A;  4E85 A;  4JC8 A;  2DCP A;  4IRU A;  4CDN A;  5EDS A;  3CQG B;  2AXZ A;  2XCC A;  5BV1 A;  4OVU A;  3FTW A;  5G05 J;  5KJL A;  3G2V A;  4NJ5 A;  3ASG A;  4I9E A;  1S0P A;  2VTB A;  1OWM A;  1U3D A;  3PNL B;  2I1J A;  2ION A;  1IQR A;  4EPZ A;  5T5G A;  4JEH A;  4BY6 A;  3I3N A;  5C2Y A;  2R59 A;  3ML9 A;  3RRN B;  3SI5 A;  5C1D A;  3JQ0 A;  3QDN A;  4RSY A;  3PZD A;  4A55 A;  1EDU A;  4UWF A;  2PQR A;  5F6K C;  3PE4 A;  2MHK A;  4H7X A;  4FLH A;  3NZU A;  4N39 A;  4BT9 A;  2V8S E;  3IV0 A;  4DLO A;  4AJW A;  4DJA A;  1MUF A;  1PC2 A;  3D9P A;  3TL5 A;  2WXN A;  4URK A;  4DI4 A;  5FT9 A;  4IUL A;  4AIF A;  2VGY A;  2O8J A;  4U0U A;  3OS5 A;  3OOI A;  1ZBP A;  4J8O A;  3G2W A;  4BUP A;  4Y6W A;  2NSZ A;  2WXH A;  1WAO 1;  4XKC A;  3VLF A;  1JWF A;  4ATG A;  4JW1 A;  5J90 A;  4IJD A;  4QEN A;  3APD A;  1E7U A;  3G2U A;  4K03 A;  3HIZ A;  3BO5 A;  4XIF A;  4CGW A;  3FTU A;  4Z4P A;  2WXO A;  3B13 A;  3TG4 A;  3ONL A;  4CDR A;  4J7I A;  1EF1 C;  3NQP A;  2WVI A;  3ML8 A;  3S7D A;  2VTB B;  1Z3X A;  3PRE A;  4AV7 A;  3IHY A;  2J49 A;  3FEY A;  1Y8M A;  4XZ4 A;  3PDN A;  5HQ8 A;  1TJC A;  3L08 A;  3U66 A;  1HG5 A;  3D9L A;  1NP7 A;  3LKU A;  3VLE A;  2AW6 A;  1L5J A;  2X6J A;  3LYA A;  3CR3 A;  4GMJ A;  4Q96 A;  4G25 A;  4NUR A;  3DPD A;  3CHR A;  3U4T A;  5CMY A;  2ILR A;  3FFL A;  4GA0 A;  4TUU A;  1ELK A;  3BG1 B;  3PH0 C;  1MVH A;  3SD5 A;  5BUZ A;  5KJM A;  2R17 C;  3FY4 A;  3RRM B;  3CK8 A;  3O4Z A;  2EQX A;  3RRU A;  3M55 A;  1HH8 A;  2WMO A;  3ASH A;  3AS4 A;  4EZL A;  3FUF A;  4V3I A;  2GRM A;  3IHX A;  4GZ3 A;  4N2Q A;  4HOT A;  4BTB A;  2QFC A;  2V0P A;  1UW4 B;  5BV0 A;  2MRI A;  5JJT A;  1UG3 A;  2ZU6 B;  3HNA A;  1B89 A;  5A23 A;  1ELR A;  3U9W A;  4PS8 A;  3CVQ A;  4R7L A;  2LAI A;  3M59 A;  2LSV A;  2E2E A;  2OVB A;  4G24 A;  4WWO A;  2MOW A;  2WQ7 A;  4I17 A;  3CVW A;  5KJK A;  3JCK C;  3R7R A;  2YNQ A;  4ANV A;  4MKT A;  3SBS A;  3MKQ A;  4LEU A;  3FEX A;  3FUE A;  4LCT A;  3ZVV A;  1N6A A;  4NRH B;  3SWC A;  4QEO A;  2J08 A;  5CCM A;  4ABN A;  4B89 A;  4I1O B;  4PS3 A;  2WPV A;  2YIN A;  5G55 A;  3S7B A;  4HOU A;  4L2Y A;  3UUX A;  4H7Y A;  1Z6T A;  3L22 A;  3RJV A;  4CT4 A;  4Q69 A;  4FA6 A;  2CHZ A;  3FUD A;  3ZGQ A;  3LVQ E;  1HF8 A;  3NZS A;  5BT1 A;  3FU0 A;  2X6F A;  4GB9 A;  4UI9 C;  4AOF A;  1GW6 A;  3OPE A;  3CHP A;  3ZW3 A;  4YNM A;  4APO A;  3OTN A;  1KT1 A;  3NF1 A;  2V5F A;  2PZI A;  2C0M A;  4BX8 A;  4BWR A;  3CVY A;  3IEG A;  3ZHE A;  3ZEF A;  4XX5 A;  2XPY A;  4HOR A;  3S8P A;  4A3V A;  2AVP A;  4CT0 A;  3B7T A;  2FBN A;  3L54 A;  3ZYK A;  4CGV A;  2X6K A;  3L13 A;  3PNT B;  3F9Z A;  3U64 A;  2JLB A;  3MV2 B;  3FUI A;  4KXK B;  5EX0 A;  1E8W A;  3RKV A;  3CST A;  1LF8 A;  3MKQ B;  2OOE A;  4TV3 A;  3EHM A;  3U3W A;  4C1Q A;  2LSU A;  4B8A A;  5JHA A;  3KS2 A;  1SZA A;  4JHJ A;  3FU5 A;  2F69 A;  3D9N A;  3CHS A;  3LPZ A;  3QC1 A;  3L6A A;  4JEU A;  2WXJ A;  2VQ2 A;  2IFU A;  2I9C A;  4UWK A;  2QPW A;  2I1K A;  3G2S A;  4W9R A;  4NVQ A;  3MYV A;  5BW8 C;  4AM9 A;  2GGF A;  4P29 A;  5LCW C;  4L23 A;  2GW1 A;  3QOU A;  1VDY A;  1SQM A;  2PM6 A;  1OWN A;  4GYO A;  3SNX A;  3UT8 A;  4BSX A;  1XNF A;  4CRW A;  2DBA A;  5ANR A;  2DIW A;  2Y3A A;  2HR2 A;  5T3R A;  4GZC A;  4B8C B;  3CVX A;  3CQC B;  5KCM A;  1HX8 A;  5HI7 A;  3M56 A;  3EIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...