3QWWA

Crystal structure of histone lysine methyltransferase smyd2 in complex with the methyltransferase inhibitor sinefungin
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
430
structure length
430
Chain Sequence
AEARGGLERFCSAGKGRGLRALRPFHVGDLLFSCPAYACVLTVGERGHHCECCFARKEGLSKCGRCKQAFYCDVECQKEDWPLHKLECSSMVVLGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVREFESHLDKLDNEKKDLIQSDIAALHQFYSKYLEFPDHSSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGDEVFTSYIDLLYPTEDRNDRLRDSYFFTCECRECTTKDKDKAKVEVRKLSSPPQAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALKYGQKIIKPYSKHYPVYSLNVASMWLKLGRLYMGLENKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of histone and p53 methyltransferase SmyD2 reveal a conformational flexibility of the autoinhibitory C-terminal domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
molecule keywords SET and MYND domain-containing protein 2
total genus 150
structure length 430
sequence length 430
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3qwwA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3qwwA01
4XIFA 5CCLA 3KD7A 4MI0A 4YPAA 3K5KA 1QZ2A 5JJ0A 5DBKA 3M53A 5EX0A 1OUVA 3FFLA 3CBOA 4YPUA 1MUFA 2AVPA 3RJWA 3RQ4A 3O48A 2Y4UA 3U3WA 3KS2A 5G05C 3ZGQA 4J8EA 4NRHB 1KT0A 3BO5A 4J0UA 2PZIA 4O6FA 2JLBA 1ZKKA 3ASGA 3MO2A 4N5CA 3ZHEB 3M57A 3QOUA 3HNAA 5BNWA 4GPKA 5G04C 4IJ8A 3CVNA 4NQ0A 1ZU2A 4GZ5A 1HH8A 3CVLA 4U04A 4BT8A 3OXLA 2LNIA 5JINA 5LSXA 4H7YA 1NZNA 4F3VA 4N2QA 4KBQA 3M58A 3PE3A 4IJDA 3S7DA 5KJMA 5KJKA 5A6CA 4RZ0A 1NA3A 5HQ8A 1P5QA 4BUPA 1YA0A 2QPWA 3F9YA 3F9WA 3LY7A 3K9IA 3N71A 3ULQA 1HZ4A 4GZ6A 5HI7A 4JDSA 3CVQA 1KT1A 5F5EA 2FI7A 5BW8C 5FZSA 3DALA 4QENA 5D0QD 2V5FA 3CEQA 3LYAA 3CKCA 2PL2A 2FEZA 5ARFA 4GA0A 2KCKA 5G04J 4BTBA 4O30A 4E47A 4LEUA 2UWJG 1A17A 2O8JA 1ML9A 1ELRA 5CCMA 2FF4A 3AS5A 4GCOA 2KATA 3OXGA 3KMJA 1QQEA 2RFIA 3E4BA 5FT9A 5JJ7A 4JLGA 3PE4A 2IGQA 3FWVA 3TG5A 2XGSA 3QWWA 3ZPJA 3TGOA 5CPRB 3GW4A 4ME2A 3KMTA 2P58C 2ONDA 4UQZA 2W5YA 2GW1A 2FBNA 4HOTA 5A7DB 4XI9A 2C2LA 4G2VA 2DBAA 3MKRA 2I6HA 4APOA 4U0UA 3ASHA 3IEGA 4UI9J 2VGXA 4WUYA 2E2EA 1MVHA 3SW9A 1FCHA 2VSNA 1MT6A 3IHXA 4G1TA 5D0OD 3QWVA 4A1SA 4HOUA 3RJVA 1N3JA 1WAO1 5AYFA 4J7FA 2KCVA 4G26A 5G05J 4BTAA 2XGMA 2F69A 2HO1A 4J8DA 3M54A 3M59A 5AYWD 4AU7A 4U07A 2R3AA 4U0SA 2VSYA 4EQFA 1IYGA 3TAXA 3EP0A 2OOEA 1KLXA 4N39A 5C1DA 3NF1A 4N2SA 3JYSA 3CKBA 3CV0A 3F9ZA 3RIBA 4BWRA 4RG9A 4HOSA 4AY5A 3M5AA 4H7XA 2UY1B 5F6KC 3CK7A 3RU0A 2JV0A 4N3BA 3DB5A 5KJNA 5DIZA 2Q7FA 5JHNA 4YNMA 4I9CA 3U4TA 4YVOA 2HYZA 4I9EA 4G24A 1O9SA 4NJ5A 1XNFA 2NC9A 2VQ2A 1NA0A 3PDNA 4MI5A 4YPEA 4W9RA 3CVPA 4IN3B 3R9AB 2W5ZA 2KCLA 3Q49B 4J83A 2XEVA 1Y8MA 2VGYA 3ASDA 3URZA 3Q47B 3VTXA 2L6JA 2LSUA 2C0LA 2WQHA 1PC2A 2WPVA 2J9QA 2XCBA 3GZ2A 2MHKA 4NVQA 3GZ1A 3CBMA 1E96B 5JIYA 4GYOA 3LY9A 5T0KA 5FZQA 3SZ7A 4WNDA 3RO2A 2FO7A 4YNDA 3RO3A 4GA2A 5F6LA 1XQHA 3KAEA 3CK9A 4N3AA 1WM5A 1W3BA 3LKUA 2VYIA 5TTFA 3OXFA 2BUGA 3ZHEA 3QWPA 5FJYA 5FTPA 4JA9A 1IHGA 1ZBPA 2PQNA 4KYOB 4G23A 3Q5MA 3S7JA 5EG2A 2XCCA 3Q4AB 1MVXA 4BT9A 4XI0A 5LCWC 4J7IA 3MO5A 3S7FA 5JJ6A 5FZRA 3MEKA 4QEPA 3RKVA 4GYYA 4QEOA 4I2ZA 3FPDA 1N6AA 3UQ3A 5T5GA 4I2WA 3VTYA 2KC7A 5TEGA 1PEGA 4JA7A 4CGVA 4GYWA 5LSZA 4JHRA 3CK8A 4LDGA 3RAYA 4I17A 4Y6CA 3TG4A 2G46A 4G25A 3CBPA 4YVQC 4UI9C 5T0MA 3KMAA 2PQRA 4U0ZA 4GCNA 4B94A 3OOIA 2YHCA 1N6CA 2XPIA 4C1QA 3AS4A 5LCWJ 3S8PA 4H12A 4YNPA 2BQZA 2IF4A 5JJTA 4JL0A 3VUZA 4UQYA 2HR2A 4N3CA 2IFUA 4AM9A 5KJLA 3QKYA 3HYMB 3WXXA 4AY6A 3VV0A 3SWCA 3UPVA 3ASFA 5TH7A 5F59A 5EX3A 4J8FA 5M72A 4J8OA 2XGOA 3ESKA 2R5SA 1TJCA 4I1AA 4CDRA 4CGWA 1H3IA 4RG6A 4HORA 4FMUA 3UUXA 3MO0A 3OPEA 4WNGA 3ZN3A 3S7BA 3SF4A 3QDNA 1ELWA 5BT1A 4Z4PA 3F9XA 2C0MA 4HOQA 3LPZA 5EKQD 4KXKB 3MA5A 4WNEA 4WNFA 3LY8A 4UI9K 2QFCA 3FP3A 3MV3B 1HXIA 1B89A 3LCAA 2UY1A 2VGXB 2Y4TA 2YQ8A 3ZFWA 3GYZA 3M56A 2LSVA 3MV2B 5CHEE 3M55A 4Y6WA 4ABNA 4GZ3A 3EDTB 3AS8A 4AIFA 4GA1A 3BEEA 3OS5A 4I51A 5ARGA 3Q15A 4UQXA
chains in the Genus database with same CATH superfamily
2J49A 3KD7A 3T5VA 3J5PA 3UIPC 3M53A 2A5EA 1OUVA 2X6IA 3PVLA 1MUFA 5EILA 4FLHA 3RQ4A 3O48A 2Y4UA 3PZ2A 3ZGQA 1E7VA 4NRHB 1G3NB 4UWGA 2KM4A 1N52A 3P2BA 3MO2A 2EIME 5ENQD 3HNAA 3EHNA 2GGFA 5BNWA 4UWLA 4IJ8A 3ASOE 4NQ0A 5KCMA 1SQMA 3C3OA 4C0MA 3ZYMA 5EIDA 3C98A 5G2NA 1MZCA 4O1OA 3L6AA 1S63A 1NZNA 4ACLA 4F3VA 2ZGGA 2LO6A 3KEAA 3Q75A 3PE3A 4APFA 2GROB 5LP0A 3R7QA 1P5QA 1TNYA 1YA0A 4DK5A 2QPWA 3LY7A 5HS0A 2WXGA 3FULA 3N71A 3ULQA 3DSXA 4CDNA 1HZ4A 2X38A 4JDSA 3CVQA 5CRUA 5BW8C 1XGWA 3DALA 4JPSA 2R17C 3CKCA 4MBGA 3APCA 5BV1A 1TR4A 5ARFA 3JUIA 1HF8A 4GZCA 1OCOE 1DCEA 4E47A 4GTSA 2X6JA 1A17A 3TWQA 3U9WA 3B7BA 2J4BA 4GCOA 2VSOE 2KATA 4U95D 3G2VA 1N94A 1TNOA 2MOWA 4AVXA 3TG5A 3ZPJA 3ISMC 3ZVVA 3SHFA 1SZAA 4BEPA 2P58C 2ONDA 4L9PA 3IBEA 4JXTA 5CRVA 5FQ4A 2QYJA 4U63A 5AIJA 4HOTA 2RG8A 2ZU6B 4XI9A 2L9BA 3CSFA 2I6HA 3ASHA 4ZHBA 1JWFA 2RD0A 3HRAA 5B3SE 2VGXA 1MVHA 5KNGA 1FCHA 3QJZA 3DXMG 3FUNA 4G1TA 5D0OD 2RKKA 3QWVA 3MKQA 1N3JA 1WAO1 4U8HA 1GW6A 5G05J 2IO2C 1OT8A 4HRMB 4GB9A 4A3VA 3M59A 3AU4A 4DLQA 2R3AA 1D9SA 3TJPA 1WY6A 3CHRA 3L82A 2OOEA 5C1DA 4N2SA 3JYSA 3T5XA 5IY5E 1LTXA 3UKUG 4RG9A 4AY5A 4H7XA 4FJYA 5KNHD 4O1PA 3G2SA 2JV0A 4N3BA 4MRUA 3E37A 3G2TA 2X6FA 5JHNA 1D8EA 4GMJA 1D8DA 1UOHA 4G24A 1IHBA 3RK6A 5AAOA 1O9SA 4NJ5A 3IHVA 1NA0A 2J08A 3R9AB 1SA5A 4RSYA 5G55A 2C0LA 3NOCD 1MYOA 4GU5A 1PC2A 3UMVA 3V79K 2Y69E 2MHKA 4B89A 5JIYA 3V2OA 5AQ7A 2V4LA 4WNDA 5CECB 2FO7A 4YNDA 2XEHA 5F6LA 3L22A 1XQHA 2P9UG 3FU0A 4A3TA 1X81A 3CK9A 1W3BA 3OXFA 4WWOA 4NIKA 2KXPC 1K3ZD 3QWPA 5ENOD 2PQNA 4E6HA 3Q5MA 2PM7A 3CLJA 5EG2A 1BI7B 3Q4AB 2I1KA 3L08A 2WXKA 1FVFA 4Z68A 5FZRA 4GYYA 1JPLA 4DX1A 2DWZA 1N6AA 3FEYA 3FUFA 3FUKA 4CGVA 3UINC 2WXMA 1HG5A 4FULA 5ENSD 2CHZA 2L0TB 2WXFA 1L5JA 4HI9A 1O5MA 2WXNA 4TV3A 4G25A 4CYMD 4JHJA 4UI9C 4FADA 2YHCA 4PDXA 4C1QA 3AS4A 3U64A 4H12A 4YNPA 2IQCA 3CHSA 4YDOA 1N4PA 4HBDA 4ATGA 3DEPA 4LERA 4JL0A 3VUZA 4UQYA 2IFUA 2XEEA 3RRMB 3QKYA 1U3CA 3UPVA 2L6BA 4NACA 5TH7A 4A63B 5CERB 5FWQA 5B1BE 4ANVA 3FUJA 3CVXA 3NQPA 3ESKA 3PEUB 1TJCA 1H3IA 4ANUA 1K1BA 3AU5A 4WNGA 3CVVA 3S7BA 3D9LA 5EYPF 5T3RA 3F9XA 2C0MA 4HOQA 5EKQD 4WNEA 4WNFA 1HFAA 3W9FA 3MV3B 1HXIA 2NXPA 3LCAA 5BXUA 3UI2A 4RQIA 4Q69A 2BKKB 4BY6A 5ITZF 4L2YA 3L9TA 2IEJA 1E8WA 2EIKE 5CMWA 4A55A 3GYZA 3NZSA 2BTDA 3M56A 2QC9A 3V30A 3BUAA 3EIJA 4FHKA 2F8YA 5T4YA 4M3OA 4GZ3A 4HXIA 3EDTB 5ARGA 3HG0D 4XEIG 4TRQA 3RRNB 4MI0A 4YPAA 5JJ0A 5EX0A 2BEDA 4G11A 3FFLA 2V5QC 4YPUA 1BU9A 5G05C 3QNKA 1KT0A 5BPPA 3BO5A 2GRLA 4GTVA 1K8KG 2JLBA 1H6PA 3APFA 3G2WA 1ZKKA 2PM6A 3ASGA 4N5CA 3B13A 4IYPA 4L23A 1OWLA 5G04C 1JUQA 1ZU2A 2V4HC 4GZ5A 2CFZA 2J8SD 3MGBA 3C3RA 4U04A 1S0PA 5LSXA 3PH0C 3HXFA 2P9PG 4N2QA 1PAQA 3V31A 1MJ0A 5H7PA 3QARA 4DRXE 4IJDA 1LD8A 4RZ0A 4B8AA 4DJAA 5HQ8A 4BUPA 3D9JA 3TWUA 2XQ0A 1OXJA 1TJFA 2MYOA 2ZISA 2LUHA 4K5BA 4GZ6A 5ANLA 3PZ4A 2FI7A 2WMOA 2EILE 3LS8A 4TXPA 2LAIA 4HVBA 1JCRA 4GMLA 3CEQA 3FTXA 3ZU7B 3CIAA 3LYAA 2H6FA 1OWPA 2MRIA 4PS3A 5AJDA 4L1BA 4JB8P 5JA4D 2KCKA 5G04J 1HG2A 4R7LA 4LEUA 2UWJG 3TXMA 3Q7AA 2O8JA 3FH8A 5CCMA 2FF4A 1TN8A 3CVWA 3AS5A 3NAWA 4JW1A 1UG3A 3KSLA 1QQEA 1SVXA 4JLGA 1O1SA 3FY4A 3MKQB 2XGSA 4XZ4A 3HXDA 4XX5A 2P9SG 3MYVA 2A5UA 2OEWA 3DSUA 3TWXA 2NYJA 4CT4A 3L54A 4ME2A 3KMTA 5AQBA 4UUCA 3QAQA 5JMND 4BSZB 3DPYA 4UQZA 2OV8A 2W5YA 2GW1A 2GRPB 4V3IA 2C2LA 4LNUD 3DSTA 2DBAA 1OY3D 4APOA 2DVWA 3L16A 4GTPA 1AWCB 1MT6A 5C2YA 2FO1E 3IHXA 1SZ9A 4EZJA 1EF1C 5ENPD 5HKPA 3RJVA 4HQDA 2V8SE 3B7UX 3EHRA 1HU3A 1IQRA 4I43A 5B1AE 5JHAA 2F69A 2HO1A 4AU7A 4ANXA 4U0SA 2VSYA 4G8LA 1IYGA 3TAXA 3UT4A 5BXOA 5HRYA 3FEXA 3NF1A 5AQAA 2AJAA 2R05A 3RIBA 4BWRA 4HOSA 3I5PA 3CK7A 1MX6A 3B95A 3CHPA 1PY1A 3X2QE 4MLPA 4I9CA 4DUIA 4YVOA 2XRYA 3APDA 4QQIA 1XNFA 2NC9A 3J5QB 3SFYA 3HHMA 1H2TC 3PNLB 4C0EA 4YPEA 1SA4A 3BQOA 5BV0A 4IN3B 3EIQC 2W5ZA 1OCRE 2XEVA 3URZA 3Q47B 4I1OB 3I4GA 2OVBA 5ENTD 1MHQA 5AARA 3RRUA 1TEZA 3GZ1A 3CBMA 1E96B 5D66A 2P2CP 2XS1A 4JEHA 3PUJA 5FZQA 3L13A 5CEAA 3RO2A 4GA2A 2ZIRA 2YNQA 1LD7A 1JCSA 2ETAA 3LKUA 5EIBE 2IO3C 4YDEA 3PUKA 5FJYA 5FTPA 1IHGA 2HE0A 4KMOA 3SBTB 4G23A 3HXBA 1H6KA 4XI0A 3CQGB 3PZ1A 3IV0A 3T8MA 1LF8A 3MO5A 2OCCE 3MEKA 4QEPA 3RKVA 2EINE 1RW2A 2WMNA 2LAHA 3JCKC 1OCCE 3QB2A 3DSWA 2KC7A 5TEGA 1PEGA 1SW6A 1K1AA 3AG3E 4A1GA 1H2UA 4GYWA 2DCPA 1O1RA 2CG3A 5LSZA 4GAAA 4JHRA 3CK8A 3PEVB 4LDGA 2CHWA 2ZGDA 3FUHA 2WXJA 2G46A 4ILHB 4JVSA 3ABME 3SGHA 2IOLA 3DBSA 4GCNA 3DRAA 1N6CA 4HI8A 2E0IA 4ILIA 4LUNU 5LCWJ 5ENNA 1N54A 2BKGA 3UXGA 2BQZA 2IF4A 2YINA 3VLDA 5JJTA 2IONA 2A4ZA 3LJNA 1DVPA 4PS8A 2F8XK 3VV0A 3FUIA 3BG1B 3ASNE 4GZDA 2ETCA 3EJNA 2QY7A 4AJWA 2I2OA 2VJ8A 4HFGA 4M7CA 2WQ6A 1BI8B 3WG7E 4OVVA 2AXVA 4HORA 2I9CA 4KVOA 4FMUA 4N5QA 2R03A 2GRRB 4URKA 3MA5A 2H6IA 4UI9K 4F6RD 3ZYLA 3ZIMA 3SNXA 4XKBA 4KT6B 3DWLG 1N0RA 1H6OA 3CQCB 4DLOA 4GTTA 3ZFWA 2NSZA 2VTBA 3FTYA 4RLYA 4F53A 4U8VD 3MV2B 4Y6WA 4HNAD 1E90A 3ZYQA 3B7RL 4FHJA 3OS5A 4I51A 3LVQE 3QK0A 2GRQB 2AWIA 3ABLE 4UQXA 3IKOB 4GTMA 3PS6A 3K5KA 2DYRE 4G8KA 3CBOA 4I1MA 2WVIA 3Q9UC 2AVPA 3RJWA 4KVMA 4WAFA 3KS2A 4F7AA 3ULEG 3HIZA 4J8EA 3NZUA 2PZIA 2WXOA 4JD2G 4O6FA 1IXVA 3IHYA 1FT1A 2RFMA 1BLXB 1QYMA 4GPKA 3CVNA 3D9OA 4EBAG 2P9LG 1E7UA 4KZ0A 3ZKJA 4HRNA 5CBNA 4F1SA 1EPUA 3OXLA 2LNIA 5JINA 1H0AA 3JQ1A 4H7YA 4KBQA 3TWSA 3FTWA 5D2MC 3UM2A 2X3MA 2I1JA 2ILRA 5KJKA 5A6CA 1NA3A 1QBQA 1BD8A 5AJLA 3LXUX 3F9YA 2DYSE 2CFUA 4JEUA 5HI7A 1TYQG 2HM8A 3JXIA 2BF0X 4OVUA 3CSTA 3ONLA 5FZSA 5D0QD 2V5FA 1Z6TA 4U96D 2XHEA 2FEZA 3EU9A 1NI1A 3ZXPA 4GA0A 4L2LA 4BTBA 1N4RA 4E85A 1OWOA 3QC1A 3FTVA 2OEVA 1ELKA 3R9MA 3KMJA 3E4BA 2QZAA 5JJ7A 4LG6A 1OCZE 4J8SA 5CPRB 1OWMA 2WXQA 3GW4A 3Q78A 3S2AA 4AEZC 5E76A 3RSEG 4ATZD 2R02A 4IULA 3Q9NC 4BFRA 1TNZA 4DI4A 3W9GA 2LXMA 4I6JA 1FVHA 1UJJA 3DSVA 4ACKA 3CHQA 2IY0C 4XKCA 3IEGA 3LJ3A 1DC2A 4WUYA 2E2EA 3AAAC 3F6QA 2AXUA 2VSNA 3RAUA 3PZ3A 4KZCA 1YMPA 4HOUA 4LCTA 2XZDG 4YDYA 1V55E 2KCVA 4G26A 3I3NA 2B6CA 3PRZA 5FQ7A 2XGMA 4J8DA 3M54A 5AYWD 3ZEFA 2IOSA 2VGEA 3D9NA 4U07A 3FU3A 4ANWA 2VSXE 4GTOA 3EP0A 1KLXA 4HLEA 3CKBA 4DPRA 3CV0A 4MKTA 4B0ZA 3E32A 1BPOA 4MS6A 1A5EA 1Z5SC 3DB5A 5KJNA 2Q7FA 4BETA 2CG2A 2IJGX 3U4TA 3FUMA 4I9EA 3HVEB 3BG0B 2VQ2A 3PDNA 4W9RA 3B7SA 3Q49B 1MX2A 4J83A 1Y8MA 2VGYA 3DXKG 4Q96A 3SFZA 3VTXA 3E34A 1OWNA 1NFIE 2L6JA 4FLBA 2WQHA 5BUZA 2WPVA 2PNNA 1TNUA 4OAVB 3GZ2A 3ESLA 3PNTB 2XPYA 2J09A 1S70B 1N4QA 5LOZA 3DPDA 3RO3A 1U3DA 3C5RA 1MQSA 4DX7D 3EHQA 5TTFA 2BUGA 3ZHEA 3OAWA 1JWGA 2F0YA 2DZOA 4JA9A 3ML8A 4KYOB 4BERA 5FQ8A 4CEMA 3JXJA 1NL4A 1MVXA 4BT9A 2CHXA 3SQVA 5LCWC 4J7IA 3S7FA 5JJ6A 3TL5A 1N95A 3CR3A 3TWWA 4BX9A 4QEOA 1EDUA 3FPDA 3UQ3A 4TXQA 3SY2A 4LNBA 3RAYA 4I17A 4Y6CA 1KZOA 3TG4A 3HXEA 3UKRG 4YVQC 1UW4B 5T0MA 2WQ7A 2P9KG 4U0ZA 3OOIA 4JHKA 2FULA 3S8PA 4J8YA 4ZFHA 1WG0A 4RVBA 3AG4E 2DZNA 4N3CA 4BSXA 4AM9A 1YYHA 4JC8A 3HYMB 3WXXA 4P29A 4YDWA 1IKND 5EX3A 4J8FA 5M72A 4J8OA 1DCQA 3D9PA 4TUMA 2YHEA 2WXRA 3TWRA 3CHOA 5FQ6A 4CDRA 4X8QA 5KWDA 4RG6A 1YCSB 3UUXA 3MO0A 3OPEA 1Y6IA 3SF4A 1ELWA 2P9NG 5BT1A 5CMYA 1KPSB 4KXKB 3UX4A 1JCQA 3PREA 4IRUA 3LY8A 2QFCA 1WDYA 3FP3A 4DX6D 1MX4A 1AP7A 1B89A 1N11A 3FU6A 4UWKA 3D9KA 3UM1A 2YQ8A 2GRMA 3FUDA 1Z3XA 2GRNB 1FPPA 3ULYA 3D9HA 3DEOA 2LSVA 1TN6A 3LVRE 2X6KA 4AIFA 4GA1A 2J4DA 3BEEA 3AG1E 1N0QA 3ZYKA 3Q15A 4XIFA 4C48B 5CCLA 2XS8A 3EHMA 1INZA 1QZ2A 4JZYA 4AXHA 3JUEA 2EQXA 5DBKA 4BESA 3ZUVB 4C9BB 2VTBB 4O60A 4HRLA 3ZXSA 3U3WA 4XE0A 4GTQA 5EN5D 4J0UA 3MZLB 3D3MA 3CHMA 3SO8A 1UJKA 3FTZA 3ZHEB 3M57A 3QOUA 2H6HA 3R7RA 4I6GA 4B93B 1HH8A 3CVLA 4CT0A 4LSZE 3E33A 2XENA 4BT8A 5JHBA 3MCXA 5J08A 3LEWA 2B0OE 3M58A 1HX8A 2AW6A 3FU5A 3S7DA 3AG2E 4CDMA 5KJMA 3MX3A 3CGHA 2ETBA 4GTRA 4ILGA 2JEKA 3F9WA 3K9IA 3OTNA 3HVEA 4EPZA 3JQ0A 3ZNGA 2Y3AA 1KT1A 4FC8A 5F5EA 3VLEA 2M63A 3ZRHA 3AJIA 4QENA 2KZTB 4AV7A 4UWHA 3UTMA 2PL2A 1V54E 3ABKE 2J07A 1NP7A 4K0RA 5KBAA 4O30A 5LFAA 1ML9A 1ELRA 3Q7FA 3I4RB 3V2XA 4TXRA 3OXGA 2V0PA 4PS7A 2RFIA 3HXCA 5FT9A 4EZLA 3PE4A 2IGQA 3FWVA 3QWWA 1Z3YA 4GMRA 3TGOA 2XPZA 4UWFA 1TN7A 3D9MA 4AP2A 5FINA 2FBNA 5A7DB 4HLLA 4G2VA 1H19A 3MKRA 4CRWA 4U0UA 1E8ZA 4OAUC 2OVFA 2LXLA 3KSQA 3UIOC 4UI9J 2Y0BG 3SW9A 2KBXA 3SD5A 2KZTA 4F1PA 4A1SA 4TUUA 5AYFA 4J7FA 4BTAA 3LDZA 1HO8A 3C3QA 3TWVA 1UN8A 3Q73A 1EYHA 4BX8A 2XZTG 3T9KA 4EQFA 2XRZA 4Q94A 4N39A 3SFXA 4D10C 4WWPA 4CZ2D 4PUCA 3F9ZA 3M5AA 3FH5A 2UY1B 3FTSA 5F6KC 3RU0A 2JABA 2WXIA 4HB5A 5DIZA 2R59A 4YNMA 2WXLA 1O1TA 1HE8A 2HYZA 5A23A 3IXEA 3SBSA 5ANRA 2WXPA 4MI5A 3CVPA 2EIJE 4U8YD 3FUEA 4FA6A 2KCLA 2ZXWE 3ASDA 3ENEA 5AQ9A 3KEZA 2LSUA 4GPMA 2QYUA 2RFAA 2R2LA 2J9QA 2XCBA 3UM3A 4NVQA 1Q2ZA 3D9IA 4GYOA 3O4ZA 5LX8A 3LY9A 5T0KA 1E8YA 3SZ7A 3U66A 4CCAA 2L0IA 5ENRD 5J90A 5FIOA 3L17A 3KAEA 4N3AA 1WM5A 4HS2A 2VYIA 1U2VG 5AN8A 4EZKA 1RZ4A 3FHEA 1IQUA 1ZBPA 1QNFA 4EECA 4EBAA 3CVUA 3S7JA 2WM9A 2XCCA 3FTUA 1TNBA 3DSSA 3TXNA 3Q79A 1H2VC 3PZDA 3UT8A 4FJZA 2H6GA 2P9IG 3NOGD 3HDXA 4K5AB 1UN9A 4I2ZA 1N4SA 5T5GA 3ZW3A 4I2WA 3VTYA 5AENA 3B7TA 4JA7A 4OYSA 1N9AA 3ONKA 3P1UA 1HS6A 3CVYA 5E75A 3CBPA 3VLFA 3MJWA 2PQRA 3KMAA 4B94A 3NBNB 3FDHA 3EUVA 2XPIA 4L7TA 5T8IA 4DX5D 3FH7A 4B8CB 1X5BA 1ZB1A 1E8XA 2HR2A 4AOFA 5KJLA 3EU5A 4AY6A 2WB2A 3SWCA 3ASFA 4NURA 5F59A 3UT7A 4LNGA 2X6HA 4QFVA 4U7EB 2XGOA 4J6IA 3UM0A 5EYLA 2R5SA 2IU1A 5EDSA 4I1AA 4CGWA 1S64A 4FP7A 4LRZA 4DX2A 2WXHA 3BU8A 3ZN3A 4WWNA 3QDNA 3G2UA 3SI5A 4Z4PA 2DIWA 4PH4B 3ML9A 3LPZA 3TWTA 4K03A 4J7WA 2Y1LE 4FU3A 2UY1A 1FT2A 2VGXB 5CEDB 3E30A 3C72A 2F37A 2Y4TA 3T8KA 1VDYA 4I6EA 4K5CA 2AXZA 4EHMA 5CHEE 3M55A 1KZPA 3NB2A 4ABNA 1DNPA 3AS8A 3GZSA 4DI3A 5CBOA
chains in the Genus database with same CATH topology
4XIFA 2J49A 3RRNB 5CCLA 3KD7A 4MI0A 3T5VA 4YPAA 3PS6A 3EHMA 1INZA 3K5KA 1QZ2A 4JZYA 4AXHA 5JJ0A 2EQXA 5DBKA 3M53A 5EX0A 4G11A 1OUVA 3FFLA 3CBOA 4YPUA 4I1MA 2X6IA 3PVLA 2WVIA 4C9BB 2VTBB 1MUFA 2AVPA 4FLHA 3RJWA 4KVMA 3RQ4A 3O48A 2Y4UA 3ZXSA 3U3WA 4XE0A 4WAFA 3KS2A 3QNKA 5G05C 3ZGQA 4F7AA 1E7VA 3HIZA 4J8EA 4NRHB 3NZUA 4UWGA 1KT0A 5BPPA 3BO5A 4J0UA 3MZLB 2KM4A 2PZIA 1N52A 2WXOA 2GRLA 4O6FA 3D3MA 3CHMA 2JLBA 3IHYA 3APFA 3G2WA 3P2BA 1ZKKA 2PM6A 3ASGA 1UJKA 3FTZA 3MO2A 4N5CA 3B13A 4IYPA 4L23A 3QOUA 3ZHEB 3EHNA 3HNAA 3M57A 2GGFA 5BNWA 4UWLA 1OWLA 4GPKA 5G04C 4IJ8A 3CVNA 4NQ0A 3R7RA 1JUQA 3D9OA 4I6GA 1ZU2A 5KCMA 4EBAG 1E7UA 1SQMA 4C0MA 4KZ0A 4GZ5A 1HH8A 3ZYMA 3CVLA 3C98A 5G2NA 2CFZA 4CT0A 3L6AA 3MGBA 4F1SA 1EPUA 4U04A 4BT8A 3OXLA 1S0PA 2LNIA 5JHBA 5JINA 5LSXA 1H0AA 3JQ1A 3PH0C 4H7YA 1NZNA 4ACLA 4F3VA 4N2QA 4KBQA 1PAQA 3MCXA 3LEWA 5J08A 3FTWA 2LO6A 2X3MA 3M58A 1HX8A 2AW6A 3FU5A 3QARA 2I1JA 3PE3A 3S7DA 2ILRA 4APFA 4CDMA 5KJMA 5A6CA 5KJKA 4IJDA 3MX3A 4RZ0A 1NA3A 4B8AA 5LP0A 4DJAA 5HQ8A 3R7QA 1P5QA 3CGHA 4BUPA 5AJLA 4DK5A 1YA0A 3LXUX 2QPWA 4ILGA 3F9YA 2JEKA 3F9WA 3LY7A 3D9JA 3K9IA 2WXGA 2CFUA 2XQ0A 3FULA 3N71A 1TJFA 3ULQA 4JEUA 4CDNA 3OTNA 3HVEA 1HZ4A 4EPZA 3JQ0A 4GZ6A 2X38A 5ANLA 5HI7A 4JDSA 3CVQA 2Y3AA 1KT1A 4FC8A 5F5EA 3VLEA 2FI7A 2HM8A 2M63A 2WMOA 3ZRHA 5BW8C 1XGWA 3LS8A 2BF0X 2LAIA 4OVUA 4HVBA 3CSTA 3ONLA 5FZSA 3DALA 4QENA 2KZTB 4GMLA 4AV7A 5D0QD 2V5FA 3CEQA 3FTXA 4UWHA 1Z6TA 3CIAA 4JPSA 3LYAA 2XHEA 1OWPA 2R17C 2PL2A 2FEZA 3APCA 3CKCA 5BV1A 2MRIA 4PS3A 5AJDA 4L1BA 5ARFA 2J07A 4GA0A 2KCKA 3JUIA 5G04J 4L2LA 4BTBA 1HF8A 4GZCA 1HG2A 1NP7A 4K0RA 4O30A 4E47A 4R7LA 4LEUA 2UWJG 1OWOA 4E85A 3TXMA 5LFAA 2X6JA 3QC1A 1A17A 3FTVA 2O8JA 1ML9A 1ELRA 3FH8A 5CCMA 3I4RB 2FF4A 3CVWA 3U9WA 2J4BA 3AS5A 4GCOA 2VSOE 2KATA 1ELKA 2V0PA 3OXGA 1UG3A 4JW1A 3G2VA 4PS7A 3KMJA 1QQEA 2RFIA 3E4BA 5FT9A 2MOWA 5JJ7A 4JLGA 4EZLA 3FY4A 3PE4A 2IGQA 4AVXA 3MKQB 3FWVA 3TG5A 2XGSA 3QWWA 1Z3YA 4XZ4A 4XX5A 3ZPJA 4J8SA 3MYVA 3ZVVA 2A5UA 3SHFA 3TGOA 1SZAA 5CPRB 1OWMA 2WXQA 3GW4A 3S2AA 4CT4A 3L54A 4ME2A 2XPZA 4UWFA 4AEZC 5E76A 3KMTA 2P58C 2ONDA 3IBEA 3QAQA 4JXTA 5FQ4A 3D9MA 4UQZA 2OV8A 4AP2A 4IULA 2W5YA 2GW1A 4BFRA 2FBNA 4U63A 5AIJA 4HOTA 5A7DB 2RG8A 2ZU6B 4DI4A 4V3IA 4XI9A 2C2LA 2L9BA 4G2VA 3CSFA 4I6JA 2DBAA 1H19A 1FVHA 3MKRA 2I6HA 1UJJA 4APOA 4CRWA 4ACKA 3CHQA 4U0UA 1E8ZA 3L16A 2OVFA 3ASHA 1JWFA 4XKCA 2RD0A 3IEGA 4UI9J 2VGXA 3LJ3A 4WUYA 2E2EA 1MVHA 3SW9A 2AXUA 1FCHA 2VSNA 5C2YA 1MT6A 3IHXA 4KZCA 3QJZA 1SZ9A 3FUNA 4G1TA 4EZJA 3SD5A 1EF1C 2KZTA 5D0OD 3QWVA 4A1SA 4HOUA 4LCTA 3MKQA 3RJVA 1N3JA 1WAO1 2V8SE 3B7UX 4TUUA 4U8HA 4J7FA 5AYFA 1HU3A 1GW6A 1IQRA 2KCVA 4G26A 4I43A 3I3NA 5G05J 4BTAA 5T0MA 3LDZA 3PRZA 5FQ7A 1HO8A 2XGMA 5JHAA 2F69A 2HO1A 4GB9A 4J8DA 1UN8A 4A3VA 1EYHA 3M59A 5AYWD 3AU4A 3ZEFA 2IOSA 3M54A 4AU7A 4BX8A 3D9NA 4ANXA 4U07A 3FU3A 4DLQA 2R3AA 4U0SA 3TJPA 2VSYA 4EQFA 1IYGA 4ANWA 2XRZA 2VSXE 3TAXA 3EP0A 1WY6A 3CHRA 4Q94A 2OOEA 1KLXA 4N39A 3UT4A 4HLEA 4D10C 3FEXA 3NF1A 4WWPA 3JYSA 3CKBA 3T5XA 4DPRA 5C1DA 4N2SA 3CV0A 4MKTA 4PUCA 4B0ZA 3F9ZA 3RIBA 4RG9A 4BWRA 4AY5A 4HOSA 3M5AA 3FH5A 1BPOA 3I5PA 4FJYA 4H7XA 4MS6A 2UY1B 3FTSA 5F6KC 3CK7A 3RU0A 3G2SA 2JV0A 2WXIA 4N3BA 3DB5A 4MRUA 3CHPA 1PY1A 5KJNA 5DIZA 4MLPA 2R59A 2Q7FA 3G2TA 2X6FA 5JHNA 4YNMA 4I9CA 2WXLA 2CG2A 4GMJA 2IJGX 3U4TA 1HE8A 4YVOA 2HYZA 2XRYA 3APDA 3FUMA 5A23A 4I9EA 4G24A 1O9SA 3RK6A 4NJ5A 3HVEB 1XNFA 3IHVA 2NC9A 3BG0B 2VQ2A 1NA0A 3PDNA 3SBSA 3HHMA 5ANRA 2J08A 1H2TC 2WXPA 3PNLB 4C0EA 4MI5A 4YPEA 4W9RA 3CVPA 5BV0A 3FUEA 4IN3B 4FA6A 3B7SA 3EIQC 3R9AB 2KCLA 3Q49B 2W5ZA 4J83A 2XEVA 1Y8MA 2VGYA 3ASDA 4Q96A 3URZA 3ENEA 3Q47B 4I1OB 4RSYA 3SFZA 3VTXA 3KEZA 1OWNA 5G55A 2L6JA 2LSUA 4FLBA 3I4GA 2C0LA 2OVBA 2WQHA 4GU5A 5BUZA 1PC2A 2WPVA 2J9QA 1MHQA 3RRUA 1TEZA 3UMVA 2XCBA 3GZ2A 2MHKA 3ESLA 4NVQA 3GZ1A 3CBMA 1E96B 4B89A 3PNTB 3D9IA 4GYOA 3O4ZA 5LX8A 5JIYA 2XPYA 2J09A 2V4LA 3LY9A 3PUJA 4JEHA 5T0KA 5FZQA 1E8YA 3L13A 4WNDA 3SZ7A 3U66A 4CCAA 2L0IA 3RO2A 5LOZA 2FO7A 4YNDA 3DPDA 3RO3A 4GA2A 1U3DA 5J90A 2YNQA 5F6LA 3L22A 1XQHA 3L17A 3KAEA 1MQSA 3FU0A 4A3TA 3CK9A 4N3AA 1WM5A 1W3BA 3LKUA 4HS2A 2VYIA 5TTFA 3OXFA 3PUKA 4WWOA 2BUGA 3ZHEA 3OAWA 4EZKA 1JWGA 3QWPA 5FJYA 5FTPA 3FHEA 1IQUA 4JA9A 1IHGA 1ZBPA 1QNFA 4KMOA 3ML8A 2PQNA 3SBTB 4E6HA 4KYOB 4EECA 4EBAA 4G23A 5FQ8A 3CVUA 4CEMA 3Q5MA 2PM7A 3CLJA 3S7JA 5EG2A 2WM9A 2XCCA 3Q4AB 3FTUA 2I1KA 3L08A 1MVXA 1H6KA 4BT9A 2CHXA 4XI0A 3CQGB 2WXKA 2WQ7A 3IV0A 1FVFA 3TXNA 3T8MA 5LCWC 1LF8A 3MO5A 3S7FA 5JJ6A 1H2VC 4J7IA 3PZDA 3UT8A 5FZRA 3MEKA 3TL5A 4FJZA 4QEPA 3RKVA 4GYYA 1JPLA 2WMNA 3CR3A 4BX9A 2LAHA 3HDXA 4QEOA 1UN9A 1EDUA 4I2ZA 3JCKC 3UQ3A 1N6AA 3FPDA 5T5GA 3QB2A 3ZW3A 3FEYA 3FUFA 4I2WA 3VTYA 5AENA 2KC7A 3B7TA 5TEGA 1PEGA 3FUKA 4JA7A 4A1GA 4CGVA 1H2UA 4GYWA 4OYSA 2DCPA 2WXMA 2CG3A 1HG5A 2CHZA 4GAAA 4FULA 5LSZA 4JHRA 3CK8A 3PEVB 4LDGA 2L0TB 2WXFA 4I17A 3RAYA 1L5JA 2CHWA 4Y6CA 3ONKA 2WXNA 3FUHA 2WXJA 4TV3A 3P1UA 4G25A 4ILHB 3TG4A 2G46A 1HS6A 4JVSA 3CVYA 5E75A 3CBPA 4YVQC 3SGHA 4JHJA 2IOLA 1UW4B 3DBSA 4UI9C 3VLFA 4FADA 3MJWA 2PQRA 4U0ZA 4GCNA 4B94A 4JHKA 2YHCA 4PDXA 1N6CA 3FDHA 3OOIA 2XPIA 2E0IA 4C1QA 3AS4A 4ILIA 4LUNU 3U64A 2FULA 5LCWJ 3S8PA 4L7TA 5T8IA 4H12A 5ENNA 4YNPA 1N54A 2IQCA 3FH7A 3CHSA 4B8CB 2BQZA 4ATGA 1X5BA 4RVBA 2IF4A 2YINA 3VLDA 5JJTA 4LERA 1E8XA 4JL0A 3VUZA 4UQYA 2HR2A 4AOFA 4N3CA 2IFUA 4BSXA 4AM9A 3RRMB 2IONA 2A4ZA 4JC8A 3QKYA 5KJLA 1DVPA 3HYMB 3WXXA 4P29A 4PS8A 4AY6A 3VV0A 3FUIA 1U3CA 2WB2A 3SWCA 3UPVA 3ASFA 3BG1B 4NACA 4NURA 5TH7A 5F59A 3UT7A 4GZDA 4J8FA 5EX3A 5M72A 4J8OA 2X6HA 3D9PA 3EJNA 4QFVA 2QY7A 4AJWA 5FWQA 2YHEA 4ANVA 2XGOA 4J6IA 2WXRA 2I2OA 2VJ8A 3FUJA 3CVXA 3NQPA 3ESKA 2R5SA 2IU1A 3PEUB 4HFGA 5EDSA 3CHOA 5FQ6A 1TJCA 2WQ6A 4I1AA 4CDRA 4CGWA 4FP7A 1H3IA 4ANUA 4LRZA 4RG6A 4OVVA 3AU5A 2AXVA 4HORA 2I9CA 4KVOA 4FMUA 3UUXA 3MO0A 2WXHA 3OPEA 1Y6IA 4WNGA 3CVVA 3ZN3A 3S7BA 3D9LA 4WWNA 3SF4A 3QDNA 5T3RA 3G2UA 1ELWA 3SI5A 5BT1A 4Z4PA 3F9XA 2DIWA 4URKA 2C0MA 4PH4B 3ML9A 3LPZA 4HOQA 5CMYA 5EKQD 4KXKB 3UX4A 3MA5A 3PREA 4WNFA 4WNEA 4IRUA 3LY8A 4UI9K 2QFCA 1HFAA 3FP3A 3ZYLA 3ZIMA 3MV3B 1HXIA 4K03A 3SNXA 4XKBA 2NXPA 1B89A 3LCAA 4FU3A 4KT6B 4Q69A 2UY1A 4BY6A 3FU6A 4L2YA 4UWKA 2VGXB 3D9KA 3CQCB 4DLOA 1E8WA 2Y4TA 2YQ8A 5CMWA 1VDYA 2GRMA 3ZFWA 2NSZA 3FUDA 1Z3XA 3GYZA 4A55A 2VTBA 3NZSA 4I6EA 2BTDA 3M56A 3FTYA 2LSVA 2AXZA 3EIJA 4FHKA 4F53A 3LVRE 3MV2B 5CHEE 5T4YA 4M3OA 4Y6WA 3M55A 1E90A 2X6KA 4GZ3A 4HXIA 3ZYQA 1DNPA 3EDTB 3AS8A 3B7RL 4ABNA 4GA1A 4AIFA 3KMAA 2J4DA 3BEEA 3GZSA 4FHJA 3OS5A 4DI3A 5ARGA 4I51A 4TRQA 3LVQE 3ZYKA 3QK0A 2AWIA 3Q15A 4UQXA 3IKOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XIF A;  5CCL A;  3KD7 A;  4MI0 A;  4YPA A;  3K5K A;  1QZ2 A;  5JJ0 A;  5DBK A;  3M53 A;  5EX0 A;  1OUV A;  3FFL A;  3CBO A;  4YPU A;  1MUF A;  2AVP A;  3RJW A;  3RQ4 A;  3O48 A;  2Y4U A;  3U3W A;  3KS2 A;  5G05 C;  3ZGQ A;  4J8E A;  4NRH B;  1KT0 A;  3BO5 A;  4J0U A;  2PZI A;  4O6F A;  2JLB A;  1ZKK A;  3ASG A;  3MO2 A;  4N5C A;  3ZHE B;  3M57 A;  3QOU A;  3HNA A;  5BNW A;  4GPK A;  5G04 C;  4IJ8 A;  3CVN A;  4NQ0 A;  1ZU2 A;  4GZ5 A;  1HH8 A;  3CVL A;  4U04 A;  4BT8 A;  3OXL A;  2LNI A;  5JIN A;  5LSX A;  4H7Y A;  1NZN A;  4F3V A;  4N2Q A;  4KBQ A;  3M58 A;  3PE3 A;  4IJD A;  3S7D A;  5KJM A;  5KJK A;  5A6C A;  4RZ0 A;  1NA3 A;  5HQ8 A;  1P5Q A;  4BUP A;  1YA0 A;  2QPW A;  3F9Y A;  3F9W A;  3LY7 A;  3K9I A;  3N71 A;  3ULQ A;  1HZ4 A;  4GZ6 A;  5HI7 A;  4JDS A;  3CVQ A;  1KT1 A;  5F5E A;  2FI7 A;  5BW8 C;  5FZS A;  3DAL A;  4QEN A;  5D0Q D;  2V5F A;  3CEQ A;  3LYA A;  3CKC A;  2PL2 A;  2FEZ A;  5ARF A;  4GA0 A;  2KCK A;  5G04 J;  4BTB A;  4O30 A;  4E47 A;  4LEU A;  2UWJ G;  1A17 A;  2O8J A;  1ML9 A;  1ELR A;  5CCM A;  2FF4 A;  3AS5 A;  4GCO A;  2KAT A;  3OXG A;  3KMJ A;  1QQE A;  2RFI A;  3E4B A;  5FT9 A;  5JJ7 A;  4JLG A;  3PE4 A;  2IGQ A;  3FWV A;  3TG5 A;  2XGS A;  3QWW A;  3ZPJ A;  3TGO A;  5CPR B;  3GW4 A;  4ME2 A;  3KMT A;  2P58 C;  2OND A;  4UQZ A;  2W5Y A;  2GW1 A;  2FBN A;  4HOT A;  5A7D B;  4XI9 A;  2C2L A;  4G2V A;  2DBA A;  3MKR A;  2I6H A;  4APO A;  4U0U A;  3ASH A;  3IEG A;  4UI9 J;  2VGX A;  4WUY A;  2E2E A;  1MVH A;  3SW9 A;  1FCH A;  2VSN A;  1MT6 A;  3IHX A;  4G1T A;  5D0O D;  3QWV A;  4A1S A;  4HOU A;  3RJV A;  1N3J A;  1WAO 1;  5AYF A;  4J7F A;  2KCV A;  4G26 A;  5G05 J;  4BTA A;  2XGM A;  2F69 A;  2HO1 A;  4J8D A;  3M54 A;  3M59 A;  5AYW D;  4AU7 A;  4U07 A;  2R3A A;  4U0S A;  2VSY A;  4EQF A;  1IYG A;  3TAX A;  3EP0 A;  2OOE A;  1KLX A;  4N39 A;  5C1D A;  3NF1 A;  4N2S A;  3JYS A;  3CKB A;  3CV0 A;  3F9Z A;  3RIB A;  4BWR A;  4RG9 A;  4HOS A;  4AY5 A;  3M5A A;  4H7X A;  2UY1 B;  5F6K C;  3CK7 A;  3RU0 A;  2JV0 A;  4N3B A;  3DB5 A;  5KJN A;  5DIZ A;  2Q7F A;  5JHN A;  4YNM A;  4I9C A;  3U4T A;  4YVO A;  2HYZ A;  4I9E A;  4G24 A;  1O9S A;  4NJ5 A;  1XNF A;  2NC9 A;  2VQ2 A;  1NA0 A;  3PDN A;  4MI5 A;  4YPE A;  4W9R A;  3CVP A;  4IN3 B;  3R9A B;  2W5Z A;  2KCL A;  3Q49 B;  4J83 A;  2XEV A;  1Y8M A;  2VGY A;  3ASD A;  3URZ A;  3Q47 B;  3VTX A;  2L6J A;  2LSU A;  2C0L A;  2WQH A;  1PC2 A;  2WPV A;  2J9Q A;  2XCB A;  3GZ2 A;  2MHK A;  4NVQ A;  3GZ1 A;  3CBM A;  1E96 B;  5JIY A;  4GYO A;  3LY9 A;  5T0K A;  5FZQ A;  3SZ7 A;  4WND A;  3RO2 A;  2FO7 A;  4YND A;  3RO3 A;  4GA2 A;  5F6L A;  1XQH A;  3KAE A;  3CK9 A;  4N3A A;  1WM5 A;  1W3B A;  3LKU A;  2VYI A;  5TTF A;  3OXF A;  2BUG A;  3ZHE A;  3QWP A;  5FJY A;  5FTP A;  4JA9 A;  1IHG A;  1ZBP A;  2PQN A;  4KYO B;  4G23 A;  3Q5M A;  3S7J A;  5EG2 A;  2XCC A;  3Q4A B;  1MVX A;  4BT9 A;  4XI0 A;  5LCW C;  4J7I A;  3MO5 A;  3S7F A;  5JJ6 A;  5FZR A;  3MEK A;  4QEP A;  3RKV A;  4GYY A;  4QEO A;  4I2Z A;  3FPD A;  1N6A A;  3UQ3 A;  5T5G A;  4I2W A;  3VTY A;  2KC7 A;  5TEG A;  1PEG A;  4JA7 A;  4CGV A;  4GYW A;  5LSZ A;  4JHR A;  3CK8 A;  4LDG A;  3RAY A;  4I17 A;  4Y6C A;  3TG4 A;  2G46 A;  4G25 A;  3CBP A;  4YVQ C;  4UI9 C;  5T0M A;  3KMA A;  2PQR A;  4U0Z A;  4GCN A;  4B94 A;  3OOI A;  2YHC A;  1N6C A;  2XPI A;  4C1Q A;  3AS4 A;  5LCW J;  3S8P A;  4H12 A;  4YNP A;  2BQZ A;  2IF4 A;  5JJT A;  4JL0 A;  3VUZ A;  4UQY A;  2HR2 A;  4N3C A;  2IFU A;  4AM9 A;  5KJL A;  3QKY A;  3HYM B;  3WXX A;  4AY6 A;  3VV0 A;  3SWC A;  3UPV A;  3ASF A;  5TH7 A;  5F59 A;  5EX3 A;  4J8F A;  5M72 A;  4J8O A;  2XGO A;  3ESK A;  2R5S A;  1TJC A;  4I1A A;  4CDR A;  4CGW A;  1H3I A;  4RG6 A;  4HOR A;  4FMU A;  3UUX A;  3MO0 A;  3OPE A;  4WNG A;  3ZN3 A;  3S7B A;  3SF4 A;  3QDN A;  1ELW A;  5BT1 A;  4Z4P A;  3F9X A;  2C0M A;  4HOQ A;  3LPZ A;  5EKQ D;  4KXK B;  3MA5 A;  4WNE A;  4WNF A;  3LY8 A;  4UI9 K;  2QFC A;  3FP3 A;  3MV3 B;  1HXI A;  1B89 A;  3LCA A;  2UY1 A;  2VGX B;  2Y4T A;  2YQ8 A;  3ZFW A;  3GYZ A;  3M56 A;  2LSV A;  3MV2 B;  5CHE E;  3M55 A;  4Y6W A;  4ABN A;  4GZ3 A;  3EDT B;  3AS8 A;  4AIF A;  4GA1 A;  3BEE A;  3OS5 A;  4I51 A;  5ARG A;  3Q15 A;  4UQX A; 
#chains in the Genus database with same CATH topology
 2J49 A;  3KD7 A;  3T5V A;  3J5P A;  3UIP C;  3M53 A;  2A5E A;  1OUV A;  2X6I A;  3PVL A;  1MUF A;  5EIL A;  4FLH A;  3RQ4 A;  3O48 A;  2Y4U A;  3PZ2 A;  3ZGQ A;  1E7V A;  4NRH B;  1G3N B;  4UWG A;  2KM4 A;  1N52 A;  3P2B A;  3MO2 A;  2EIM E;  5ENQ D;  3HNA A;  3EHN A;  2GGF A;  5BNW A;  4UWL A;  4IJ8 A;  3ASO E;  4NQ0 A;  5KCM A;  1SQM A;  3C3O A;  4C0M A;  3ZYM A;  5EID A;  3C98 A;  5G2N A;  1MZC A;  4O1O A;  3L6A A;  1S63 A;  1NZN A;  4ACL A;  4F3V A;  2ZGG A;  2LO6 A;  3KEA A;  3Q75 A;  3PE3 A;  4APF A;  2GRO B;  5LP0 A;  3R7Q A;  1P5Q A;  1TNY A;  1YA0 A;  4DK5 A;  2QPW A;  3LY7 A;  5HS0 A;  2WXG A;  3FUL A;  3N71 A;  3ULQ A;  3DSX A;  4CDN A;  1HZ4 A;  2X38 A;  4JDS A;  3CVQ A;  5CRU A;  5BW8 C;  1XGW A;  3DAL A;  4JPS A;  2R17 C;  3CKC A;  4MBG A;  3APC A;  5BV1 A;  1TR4 A;  5ARF A;  3JUI A;  1HF8 A;  4GZC A;  1OCO E;  1DCE A;  4E47 A;  4GTS A;  2X6J A;  1A17 A;  3TWQ A;  3U9W A;  3B7B A;  2J4B A;  4GCO A;  2VSO E;  2KAT A;  4U95 D;  3G2V A;  1N94 A;  1TNO A;  2MOW A;  4AVX A;  3TG5 A;  3ZPJ A;  3ISM C;  3ZVV A;  3SHF A;  1SZA A;  4BEP A;  2P58 C;  2OND A;  4L9P A;  3IBE A;  4JXT A;  5CRV A;  5FQ4 A;  2QYJ A;  4U63 A;  5AIJ A;  4HOT A;  2RG8 A;  2ZU6 B;  4XI9 A;  2L9B A;  3CSF A;  2I6H A;  3ASH A;  4ZHB A;  1JWF A;  2RD0 A;  3HRA A;  5B3S E;  2VGX A;  1MVH A;  5KNG A;  1FCH A;  3QJZ A;  3DXM G;  3FUN A;  4G1T A;  5D0O D;  2RKK A;  3QWV A;  3MKQ A;  1N3J A;  1WAO 1;  4U8H A;  1GW6 A;  5G05 J;  2IO2 C;  1OT8 A;  4HRM B;  4GB9 A;  4A3V A;  3M59 A;  3AU4 A;  4DLQ A;  2R3A A;  1D9S A;  3TJP A;  1WY6 A;  3CHR A;  3L82 A;  2OOE A;  5C1D A;  4N2S A;  3JYS A;  3T5X A;  5IY5 E;  1LTX A;  3UKU G;  4RG9 A;  4AY5 A;  4H7X A;  4FJY A;  5KNH D;  4O1P A;  3G2S A;  2JV0 A;  4N3B A;  4MRU A;  3E37 A;  3G2T A;  2X6F A;  5JHN A;  1D8E A;  4GMJ A;  1D8D A;  1UOH A;  4G24 A;  1IHB A;  3RK6 A;  5AAO A;  1O9S A;  4NJ5 A;  3IHV A;  1NA0 A;  2J08 A;  3R9A B;  1SA5 A;  4RSY A;  5G55 A;  2C0L A;  3NOC D;  1MYO A;  4GU5 A;  1PC2 A;  3UMV A;  3V79 K;  2Y69 E;  2MHK A;  4B89 A;  5JIY A;  3V2O A;  5AQ7 A;  2V4L A;  4WND A;  5CEC B;  2FO7 A;  4YND A;  2XEH A;  5F6L A;  3L22 A;  1XQH A;  2P9U G;  3FU0 A;  4A3T A;  1X81 A;  3CK9 A;  1W3B A;  3OXF A;  4WWO A;  4NIK A;  2KXP C;  1K3Z D;  3QWP A;  5ENO D;  2PQN A;  4E6H A;  3Q5M A;  2PM7 A;  3CLJ A;  5EG2 A;  1BI7 B;  3Q4A B;  2I1K A;  3L08 A;  2WXK A;  1FVF A;  4Z68 A;  5FZR A;  4GYY A;  1JPL A;  4DX1 A;  2DWZ A;  1N6A A;  3FEY A;  3FUF A;  3FUK A;  4CGV A;  3UIN C;  2WXM A;  1HG5 A;  4FUL A;  5ENS D;  2CHZ A;  2L0T B;  2WXF A;  1L5J A;  4HI9 A;  1O5M A;  2WXN A;  4TV3 A;  4G25 A;  4CYM D;  4JHJ A;  4UI9 C;  4FAD A;  2YHC A;  4PDX A;  4C1Q A;  3AS4 A;  3U64 A;  4H12 A;  4YNP A;  2IQC A;  3CHS A;  4YDO A;  1N4P A;  4HBD A;  4ATG A;  3DEP A;  4LER A;  4JL0 A;  3VUZ A;  4UQY A;  2IFU A;  2XEE A;  3RRM B;  3QKY A;  1U3C A;  3UPV A;  2L6B A;  4NAC A;  5TH7 A;  4A63 B;  5CER B;  5FWQ A;  5B1B E;  4ANV A;  3FUJ A;  3CVX A;  3NQP A;  3ESK A;  3PEU B;  1TJC A;  1H3I A;  4ANU A;  1K1B A;  3AU5 A;  4WNG A;  3CVV A;  3S7B A;  3D9L A;  5EYP F;  5T3R A;  3F9X A;  2C0M A;  4HOQ A;  5EKQ D;  4WNE A;  4WNF A;  1HFA A;  3W9F A;  3MV3 B;  1HXI A;  2NXP A;  3LCA A;  5BXU A;  3UI2 A;  4RQI A;  4Q69 A;  2BKK B;  4BY6 A;  5ITZ F;  4L2Y A;  3L9T A;  2IEJ A;  1E8W A;  2EIK E;  5CMW A;  4A55 A;  3GYZ A;  3NZS A;  2BTD A;  3M56 A;  2QC9 A;  3V30 A;  3BUA A;  3EIJ A;  4FHK A;  2F8Y A;  5T4Y A;  4M3O A;  4GZ3 A;  4HXI A;  3EDT B;  5ARG A;  3HG0 D;  4XEI G;  4TRQ A;  3RRN B;  4MI0 A;  4YPA A;  5JJ0 A;  5EX0 A;  2BED A;  4G11 A;  3FFL A;  2V5Q C;  4YPU A;  1BU9 A;  5G05 C;  3QNK A;  1KT0 A;  5BPP A;  3BO5 A;  2GRL A;  4GTV A;  1K8K G;  2JLB A;  1H6P A;  3APF A;  3G2W A;  1ZKK A;  2PM6 A;  3ASG A;  4N5C A;  3B13 A;  4IYP A;  4L23 A;  1OWL A;  5G04 C;  1JUQ A;  1ZU2 A;  2V4H C;  4GZ5 A;  2CFZ A;  2J8S D;  3MGB A;  3C3R A;  4U04 A;  1S0P A;  5LSX A;  3PH0 C;  3HXF A;  2P9P G;  4N2Q A;  1PAQ A;  3V31 A;  1MJ0 A;  5H7P A;  3QAR A;  4DRX E;  4IJD A;  1LD8 A;  4RZ0 A;  4B8A A;  4DJA A;  5HQ8 A;  4BUP A;  3D9J A;  3TWU A;  2XQ0 A;  1OXJ A;  1TJF A;  2MYO A;  2ZIS A;  2LUH A;  4K5B A;  4GZ6 A;  5ANL A;  3PZ4 A;  2FI7 A;  2WMO A;  2EIL E;  3LS8 A;  4TXP A;  2LAI A;  4HVB A;  1JCR A;  4GML A;  3CEQ A;  3FTX A;  3ZU7 B;  3CIA A;  3LYA A;  2H6F A;  1OWP A;  2MRI A;  4PS3 A;  5AJD A;  4L1B A;  4JB8 P;  5JA4 D;  2KCK A;  5G04 J;  1HG2 A;  4R7L A;  4LEU A;  2UWJ G;  3TXM A;  3Q7A A;  2O8J A;  3FH8 A;  5CCM A;  2FF4 A;  1TN8 A;  3CVW A;  3AS5 A;  3NAW A;  4JW1 A;  1UG3 A;  3KSL A;  1QQE A;  1SVX A;  4JLG A;  1O1S A;  3FY4 A;  3MKQ B;  2XGS A;  4XZ4 A;  3HXD A;  4XX5 A;  2P9S G;  3MYV A;  2A5U A;  2OEW A;  3DSU A;  3TWX A;  2NYJ A;  4CT4 A;  3L54 A;  4ME2 A;  3KMT A;  5AQB A;  4UUC A;  3QAQ A;  5JMN D;  4BSZ B;  3DPY A;  4UQZ A;  2OV8 A;  2W5Y A;  2GW1 A;  2GRP B;  4V3I A;  2C2L A;  4LNU D;  3DST A;  2DBA A;  1OY3 D;  4APO A;  2DVW A;  3L16 A;  4GTP A;  1AWC B;  1MT6 A;  5C2Y A;  2FO1 E;  3IHX A;  1SZ9 A;  4EZJ A;  1EF1 C;  5ENP D;  5HKP A;  3RJV A;  4HQD A;  2V8S E;  3B7U X;  3EHR A;  1HU3 A;  1IQR A;  4I43 A;  5B1A E;  5JHA A;  2F69 A;  2HO1 A;  4AU7 A;  4ANX A;  4U0S A;  2VSY A;  4G8L A;  1IYG A;  3TAX A;  3UT4 A;  5BXO A;  5HRY A;  3FEX A;  3NF1 A;  5AQA A;  2AJA A;  2R05 A;  3RIB A;  4BWR A;  4HOS A;  3I5P A;  3CK7 A;  1MX6 A;  3B95 A;  3CHP A;  1PY1 A;  3X2Q E;  4MLP A;  4I9C A;  4DUI A;  4YVO A;  2XRY A;  3APD A;  4QQI A;  1XNF A;  2NC9 A;  3J5Q B;  3SFY A;  3HHM A;  1H2T C;  3PNL B;  4C0E A;  4YPE A;  1SA4 A;  3BQO A;  5BV0 A;  4IN3 B;  3EIQ C;  2W5Z A;  1OCR E;  2XEV A;  3URZ A;  3Q47 B;  4I1O B;  3I4G A;  2OVB A;  5ENT D;  1MHQ A;  5AAR A;  3RRU A;  1TEZ A;  3GZ1 A;  3CBM A;  1E96 B;  5D66 A;  2P2C P;  2XS1 A;  4JEH A;  3PUJ A;  5FZQ A;  3L13 A;  5CEA A;  3RO2 A;  4GA2 A;  2ZIR A;  2YNQ A;  1LD7 A;  1JCS A;  2ETA A;  3LKU A;  5EIB E;  2IO3 C;  4YDE A;  3PUK A;  5FJY A;  5FTP A;  1IHG A;  2HE0 A;  4KMO A;  3SBT B;  4G23 A;  3HXB A;  1H6K A;  4XI0 A;  3CQG B;  3PZ1 A;  3IV0 A;  3T8M A;  1LF8 A;  3MO5 A;  2OCC E;  3MEK A;  4QEP A;  3RKV A;  2EIN E;  1RW2 A;  2WMN A;  2LAH A;  3JCK C;  1OCC E;  3QB2 A;  3DSW A;  2KC7 A;  5TEG A;  1PEG A;  1SW6 A;  1K1A A;  3AG3 E;  4A1G A;  1H2U A;  4GYW A;  2DCP A;  1O1R A;  2CG3 A;  5LSZ A;  4GAA A;  4JHR A;  3CK8 A;  3PEV B;  4LDG A;  2CHW A;  2ZGD A;  3FUH A;  2WXJ A;  2G46 A;  4ILH B;  4JVS A;  3ABM E;  3SGH A;  2IOL A;  3DBS A;  4GCN A;  3DRA A;  1N6C A;  4HI8 A;  2E0I A;  4ILI A;  4LUN U;  5LCW J;  5ENN A;  1N54 A;  2BKG A;  3UXG A;  2BQZ A;  2IF4 A;  2YIN A;  3VLD A;  5JJT A;  2ION A;  2A4Z A;  3LJN A;  1DVP A;  4PS8 A;  2F8X K;  3VV0 A;  3FUI A;  3BG1 B;  3ASN E;  4GZD A;  2ETC A;  3EJN A;  2QY7 A;  4AJW A;  2I2O A;  2VJ8 A;  4HFG A;  4M7C A;  2WQ6 A;  1BI8 B;  3WG7 E;  4OVV A;  2AXV A;  4HOR A;  2I9C A;  4KVO A;  4FMU A;  4N5Q A;  2R03 A;  2GRR B;  4URK A;  3MA5 A;  2H6I A;  4UI9 K;  4F6R D;  3ZYL A;  3ZIM A;  3SNX A;  4XKB A;  4KT6 B;  3DWL G;  1N0R A;  1H6O A;  3CQC B;  4DLO A;  4GTT A;  3ZFW A;  2NSZ A;  2VTB A;  3FTY A;  4RLY A;  4F53 A;  4U8V D;  3MV2 B;  4Y6W A;  4HNA D;  1E90 A;  3ZYQ A;  3B7R L;  4FHJ A;  3OS5 A;  4I51 A;  3LVQ E;  3QK0 A;  2GRQ B;  2AWI A;  3ABL E;  4UQX A;  3IKO B;  4GTM A;  3PS6 A;  3K5K A;  2DYR E;  4G8K A;  3CBO A;  4I1M A;  2WVI A;  3Q9U C;  2AVP A;  3RJW A;  4KVM A;  4WAF A;  3KS2 A;  4F7A A;  3ULE G;  3HIZ A;  4J8E A;  3NZU A;  2PZI A;  2WXO A;  4JD2 G;  4O6F A;  1IXV A;  3IHY A;  1FT1 A;  2RFM A;  1BLX B;  1QYM A;  4GPK A;  3CVN A;  3D9O A;  4EBA G;  2P9L G;  1E7U A;  4KZ0 A;  3ZKJ A;  4HRN A;  5CBN A;  4F1S A;  1EPU A;  3OXL A;  2LNI A;  5JIN A;  1H0A A;  3JQ1 A;  4H7Y A;  4KBQ A;  3TWS A;  3FTW A;  5D2M C;  3UM2 A;  2X3M A;  2I1J A;  2ILR A;  5KJK A;  5A6C A;  1NA3 A;  1QBQ A;  1BD8 A;  5AJL A;  3LXU X;  3F9Y A;  2DYS E;  2CFU A;  4JEU A;  5HI7 A;  1TYQ G;  2HM8 A;  3JXI A;  2BF0 X;  4OVU A;  3CST A;  3ONL A;  5FZS A;  5D0Q D;  2V5F A;  1Z6T A;  4U96 D;  2XHE A;  2FEZ A;  3EU9 A;  1NI1 A;  3ZXP A;  4GA0 A;  4L2L A;  4BTB A;  1N4R A;  4E85 A;  1OWO A;  3QC1 A;  3FTV A;  2OEV A;  1ELK A;  3R9M A;  3KMJ A;  3E4B A;  2QZA A;  5JJ7 A;  4LG6 A;  1OCZ E;  4J8S A;  5CPR B;  1OWM A;  2WXQ A;  3GW4 A;  3Q78 A;  3S2A A;  4AEZ C;  5E76 A;  3RSE G;  4ATZ D;  2R02 A;  4IUL A;  3Q9N C;  4BFR A;  1TNZ A;  4DI4 A;  3W9G A;  2LXM A;  4I6J A;  1FVH A;  1UJJ A;  3DSV A;  4ACK A;  3CHQ A;  2IY0 C;  4XKC A;  3IEG A;  3LJ3 A;  1DC2 A;  4WUY A;  2E2E A;  3AAA C;  3F6Q A;  2AXU A;  2VSN A;  3RAU A;  3PZ3 A;  4KZC A;  1YMP A;  4HOU A;  4LCT A;  2XZD G;  4YDY A;  1V55 E;  2KCV A;  4G26 A;  3I3N A;  2B6C A;  3PRZ A;  5FQ7 A;  2XGM A;  4J8D A;  3M54 A;  5AYW D;  3ZEF A;  2IOS A;  2VGE A;  3D9N A;  4U07 A;  3FU3 A;  4ANW A;  2VSX E;  4GTO A;  3EP0 A;  1KLX A;  4HLE A;  3CKB A;  4DPR A;  3CV0 A;  4MKT A;  4B0Z A;  3E32 A;  1BPO A;  4MS6 A;  1A5E A;  1Z5S C;  3DB5 A;  5KJN A;  2Q7F A;  4BET A;  2CG2 A;  2IJG X;  3U4T A;  3FUM A;  4I9E A;  3HVE B;  3BG0 B;  2VQ2 A;  3PDN A;  4W9R A;  3B7S A;  3Q49 B;  1MX2 A;  4J83 A;  1Y8M A;  2VGY A;  3DXK G;  4Q96 A;  3SFZ A;  3VTX A;  3E34 A;  1OWN A;  1NFI E;  2L6J A;  4FLB A;  2WQH A;  5BUZ A;  2WPV A;  2PNN A;  1TNU A;  4OAV B;  3GZ2 A;  3ESL A;  3PNT B;  2XPY A;  2J09 A;  1S70 B;  1N4Q A;  5LOZ A;  3DPD A;  3RO3 A;  1U3D A;  3C5R A;  1MQS A;  4DX7 D;  3EHQ A;  5TTF A;  2BUG A;  3ZHE A;  3OAW A;  1JWG A;  2F0Y A;  2DZO A;  4JA9 A;  3ML8 A;  4KYO B;  4BER A;  5FQ8 A;  4CEM A;  3JXJ A;  1NL4 A;  1MVX A;  4BT9 A;  2CHX A;  3SQV A;  5LCW C;  4J7I A;  3S7F A;  5JJ6 A;  3TL5 A;  1N95 A;  3CR3 A;  3TWW A;  4BX9 A;  4QEO A;  1EDU A;  3FPD A;  3UQ3 A;  4TXQ A;  3SY2 A;  4LNB A;  3RAY A;  4I17 A;  4Y6C A;  1KZO A;  3TG4 A;  3HXE A;  3UKR G;  4YVQ C;  1UW4 B;  5T0M A;  2WQ7 A;  2P9K G;  4U0Z A;  3OOI A;  4JHK A;  2FUL A;  3S8P A;  4J8Y A;  4ZFH A;  1WG0 A;  4RVB A;  3AG4 E;  2DZN A;  4N3C A;  4BSX A;  4AM9 A;  1YYH A;  4JC8 A;  3HYM B;  3WXX A;  4P29 A;  4YDW A;  1IKN D;  5EX3 A;  4J8F A;  5M72 A;  4J8O A;  1DCQ A;  3D9P A;  4TUM A;  2YHE A;  2WXR A;  3TWR A;  3CHO A;  5FQ6 A;  4CDR A;  4X8Q A;  5KWD A;  4RG6 A;  1YCS B;  3UUX A;  3MO0 A;  3OPE A;  1Y6I A;  3SF4 A;  1ELW A;  2P9N G;  5BT1 A;  5CMY A;  1KPS B;  4KXK B;  3UX4 A;  1JCQ A;  3PRE A;  4IRU A;  3LY8 A;  2QFC A;  1WDY A;  3FP3 A;  4DX6 D;  1MX4 A;  1AP7 A;  1B89 A;  1N11 A;  3FU6 A;  4UWK A;  3D9K A;  3UM1 A;  2YQ8 A;  2GRM A;  3FUD A;  1Z3X A;  2GRN B;  1FPP A;  3ULY A;  3D9H A;  3DEO A;  2LSV A;  1TN6 A;  3LVR E;  2X6K A;  4AIF A;  4GA1 A;  2J4D A;  3BEE A;  3AG1 E;  1N0Q A;  3ZYK A;  3Q15 A;  4XIF A;  4C48 B;  5CCL A;  2XS8 A;  3EHM A;  1INZ A;  1QZ2 A;  4JZY A;  4AXH A;  3JUE A;  2EQX A;  5DBK A;  4BES A;  3ZUV B;  4C9B B;  2VTB B;  4O60 A;  4HRL A;  3ZXS A;  3U3W A;  4XE0 A;  4GTQ A;  5EN5 D;  4J0U A;  3MZL B;  3D3M A;  3CHM A;  3SO8 A;  1UJK A;  3FTZ A;  3ZHE B;  3M57 A;  3QOU A;  2H6H A;  3R7R A;  4I6G A;  4B93 B;  1HH8 A;  3CVL A;  4CT0 A;  4LSZ E;  3E33 A;  2XEN A;  4BT8 A;  5JHB A;  3MCX A;  5J08 A;  3LEW A;  2B0O E;  3M58 A;  1HX8 A;  2AW6 A;  3FU5 A;  3S7D A;  3AG2 E;  4CDM A;  5KJM A;  3MX3 A;  3CGH A;  2ETB A;  4GTR A;  4ILG A;  2JEK A;  3F9W A;  3K9I A;  3OTN A;  3HVE A;  4EPZ A;  3JQ0 A;  3ZNG A;  2Y3A A;  1KT1 A;  4FC8 A;  5F5E A;  3VLE A;  2M63 A;  3ZRH A;  3AJI A;  4QEN A;  2KZT B;  4AV7 A;  4UWH A;  3UTM A;  2PL2 A;  1V54 E;  3ABK E;  2J07 A;  1NP7 A;  4K0R A;  5KBA A;  4O30 A;  5LFA A;  1ML9 A;  1ELR A;  3Q7F A;  3I4R B;  3V2X A;  4TXR A;  3OXG A;  2V0P A;  4PS7 A;  2RFI A;  3HXC A;  5FT9 A;  4EZL A;  3PE4 A;  2IGQ A;  3FWV A;  3QWW A;  1Z3Y A;  4GMR A;  3TGO A;  2XPZ A;  4UWF A;  1TN7 A;  3D9M A;  4AP2 A;  5FIN A;  2FBN A;  5A7D B;  4HLL A;  4G2V A;  1H19 A;  3MKR A;  4CRW A;  4U0U A;  1E8Z A;  4OAU C;  2OVF A;  2LXL A;  3KSQ A;  3UIO C;  4UI9 J;  2Y0B G;  3SW9 A;  2KBX A;  3SD5 A;  2KZT A;  4F1P A;  4A1S A;  4TUU A;  5AYF A;  4J7F A;  4BTA A;  3LDZ A;  1HO8 A;  3C3Q A;  3TWV A;  1UN8 A;  3Q73 A;  1EYH A;  4BX8 A;  2XZT G;  3T9K A;  4EQF A;  2XRZ A;  4Q94 A;  4N39 A;  3SFX A;  4D10 C;  4WWP A;  4CZ2 D;  4PUC A;  3F9Z A;  3M5A A;  3FH5 A;  2UY1 B;  3FTS A;  5F6K C;  3RU0 A;  2JAB A;  2WXI A;  4HB5 A;  5DIZ A;  2R59 A;  4YNM A;  2WXL A;  1O1T A;  1HE8 A;  2HYZ A;  5A23 A;  3IXE A;  3SBS A;  5ANR A;  2WXP A;  4MI5 A;  3CVP A;  2EIJ E;  4U8Y D;  3FUE A;  4FA6 A;  2KCL A;  2ZXW E;  3ASD A;  3ENE A;  5AQ9 A;  3KEZ A;  2LSU A;  4GPM A;  2QYU A;  2RFA A;  2R2L A;  2J9Q A;  2XCB A;  3UM3 A;  4NVQ A;  1Q2Z A;  3D9I A;  4GYO A;  3O4Z A;  5LX8 A;  3LY9 A;  5T0K A;  1E8Y A;  3SZ7 A;  3U66 A;  4CCA A;  2L0I A;  5ENR D;  5J90 A;  5FIO A;  3L17 A;  3KAE A;  4N3A A;  1WM5 A;  4HS2 A;  2VYI A;  1U2V G;  5AN8 A;  4EZK A;  1RZ4 A;  3FHE A;  1IQU A;  1ZBP A;  1QNF A;  4EEC A;  4EBA A;  3CVU A;  3S7J A;  2WM9 A;  2XCC A;  3FTU A;  1TNB A;  3DSS A;  3TXN A;  3Q79 A;  1H2V C;  3PZD A;  3UT8 A;  4FJZ A;  2H6G A;  2P9I G;  3NOG D;  3HDX A;  4K5A B;  1UN9 A;  4I2Z A;  1N4S A;  5T5G A;  3ZW3 A;  4I2W A;  3VTY A;  5AEN A;  3B7T A;  4JA7 A;  4OYS A;  1N9A A;  3ONK A;  3P1U A;  1HS6 A;  3CVY A;  5E75 A;  3CBP A;  3VLF A;  3MJW A;  2PQR A;  3KMA A;  4B94 A;  3NBN B;  3FDH A;  3EUV A;  2XPI A;  4L7T A;  5T8I A;  4DX5 D;  3FH7 A;  4B8C B;  1X5B A;  1ZB1 A;  1E8X A;  2HR2 A;  4AOF A;  5KJL A;  3EU5 A;  4AY6 A;  2WB2 A;  3SWC A;  3ASF A;  4NUR A;  5F59 A;  3UT7 A;  4LNG A;  2X6H A;  4QFV A;  4U7E B;  2XGO A;  4J6I A;  3UM0 A;  5EYL A;  2R5S A;  2IU1 A;  5EDS A;  4I1A A;  4CGW A;  1S64 A;  4FP7 A;  4LRZ A;  4DX2 A;  2WXH A;  3BU8 A;  3ZN3 A;  4WWN A;  3QDN A;  3G2U A;  3SI5 A;  4Z4P A;  2DIW A;  4PH4 B;  3ML9 A;  3LPZ A;  3TWT A;  4K03 A;  4J7W A;  2Y1L E;  4FU3 A;  2UY1 A;  1FT2 A;  2VGX B;  5CED B;  3E30 A;  3C72 A;  2F37 A;  2Y4T A;  3T8K A;  1VDY A;  4I6E A;  4K5C A;  2AXZ A;  4EHM A;  5CHE E;  3M55 A;  1KZP A;  3NB2 A;  4ABN A;  1DNP A;  3AS8 A;  3GZS A;  4DI3 A;  5CBO A; 
#chains in the Genus database with same CATH homology
 4XIF A;  2J49 A;  3RRN B;  5CCL A;  3KD7 A;  4MI0 A;  3T5V A;  4YPA A;  3PS6 A;  3EHM A;  1INZ A;  3K5K A;  1QZ2 A;  4JZY A;  4AXH A;  5JJ0 A;  2EQX A;  5DBK A;  3M53 A;  5EX0 A;  4G11 A;  1OUV A;  3FFL A;  3CBO A;  4YPU A;  4I1M A;  2X6I A;  3PVL A;  2WVI A;  4C9B B;  2VTB B;  1MUF A;  2AVP A;  4FLH A;  3RJW A;  4KVM A;  3RQ4 A;  3O48 A;  2Y4U A;  3ZXS A;  3U3W A;  4XE0 A;  4WAF A;  3KS2 A;  3QNK A;  5G05 C;  3ZGQ A;  4F7A A;  1E7V A;  3HIZ A;  4J8E A;  4NRH B;  3NZU A;  4UWG A;  1KT0 A;  5BPP A;  3BO5 A;  4J0U A;  3MZL B;  2KM4 A;  2PZI A;  1N52 A;  2WXO A;  2GRL A;  4O6F A;  3D3M A;  3CHM A;  2JLB A;  3IHY A;  3APF A;  3G2W A;  3P2B A;  1ZKK A;  2PM6 A;  3ASG A;  1UJK A;  3FTZ A;  3MO2 A;  4N5C A;  3B13 A;  4IYP A;  4L23 A;  3QOU A;  3ZHE B;  3EHN A;  3HNA A;  3M57 A;  2GGF A;  5BNW A;  4UWL A;  1OWL A;  4GPK A;  5G04 C;  4IJ8 A;  3CVN A;  4NQ0 A;  3R7R A;  1JUQ A;  3D9O A;  4I6G A;  1ZU2 A;  5KCM A;  4EBA G;  1E7U A;  1SQM A;  4C0M A;  4KZ0 A;  4GZ5 A;  1HH8 A;  3ZYM A;  3CVL A;  3C98 A;  5G2N A;  2CFZ A;  4CT0 A;  3L6A A;  3MGB A;  4F1S A;  1EPU A;  4U04 A;  4BT8 A;  3OXL A;  1S0P A;  2LNI A;  5JHB A;  5JIN A;  5LSX A;  1H0A A;  3JQ1 A;  3PH0 C;  4H7Y A;  1NZN A;  4ACL A;  4F3V A;  4N2Q A;  4KBQ A;  1PAQ A;  3MCX A;  3LEW A;  5J08 A;  3FTW A;  2LO6 A;  2X3M A;  3M58 A;  1HX8 A;  2AW6 A;  3FU5 A;  3QAR A;  2I1J A;  3PE3 A;  3S7D A;  2ILR A;  4APF A;  4CDM A;  5KJM A;  5A6C A;  5KJK A;  4IJD A;  3MX3 A;  4RZ0 A;  1NA3 A;  4B8A A;  5LP0 A;  4DJA A;  5HQ8 A;  3R7Q A;  1P5Q A;  3CGH A;  4BUP A;  5AJL A;  4DK5 A;  1YA0 A;  3LXU X;  2QPW A;  4ILG A;  3F9Y A;  2JEK A;  3F9W A;  3LY7 A;  3D9J A;  3K9I A;  2WXG A;  2CFU A;  2XQ0 A;  3FUL A;  3N71 A;  1TJF A;  3ULQ A;  4JEU A;  4CDN A;  3OTN A;  3HVE A;  1HZ4 A;  4EPZ A;  3JQ0 A;  4GZ6 A;  2X38 A;  5ANL A;  5HI7 A;  4JDS A;  3CVQ A;  2Y3A A;  1KT1 A;  4FC8 A;  5F5E A;  3VLE A;  2FI7 A;  2HM8 A;  2M63 A;  2WMO A;  3ZRH A;  5BW8 C;  1XGW A;  3LS8 A;  2BF0 X;  2LAI A;  4OVU A;  4HVB A;  3CST A;  3ONL A;  5FZS A;  3DAL A;  4QEN A;  2KZT B;  4GML A;  4AV7 A;  5D0Q D;  2V5F A;  3CEQ A;  3FTX A;  4UWH A;  1Z6T A;  3CIA A;  4JPS A;  3LYA A;  2XHE A;  1OWP A;  2R17 C;  2PL2 A;  2FEZ A;  3APC A;  3CKC A;  5BV1 A;  2MRI A;  4PS3 A;  5AJD A;  4L1B A;  5ARF A;  2J07 A;  4GA0 A;  2KCK A;  3JUI A;  5G04 J;  4L2L A;  4BTB A;  1HF8 A;  4GZC A;  1HG2 A;  1NP7 A;  4K0R A;  4O30 A;  4E47 A;  4R7L A;  4LEU A;  2UWJ G;  1OWO A;  4E85 A;  3TXM A;  5LFA A;  2X6J A;  3QC1 A;  1A17 A;  3FTV A;  2O8J A;  1ML9 A;  1ELR A;  3FH8 A;  5CCM A;  3I4R B;  2FF4 A;  3CVW A;  3U9W A;  2J4B A;  3AS5 A;  4GCO A;  2VSO E;  2KAT A;  1ELK A;  2V0P A;  3OXG A;  1UG3 A;  4JW1 A;  3G2V A;  4PS7 A;  3KMJ A;  1QQE A;  2RFI A;  3E4B A;  5FT9 A;  2MOW A;  5JJ7 A;  4JLG A;  4EZL A;  3FY4 A;  3PE4 A;  2IGQ A;  4AVX A;  3MKQ B;  3FWV A;  3TG5 A;  2XGS A;  3QWW A;  1Z3Y A;  4XZ4 A;  4XX5 A;  3ZPJ A;  4J8S A;  3MYV A;  3ZVV A;  2A5U A;  3SHF A;  3TGO A;  1SZA A;  5CPR B;  1OWM A;  2WXQ A;  3GW4 A;  3S2A A;  4CT4 A;  3L54 A;  4ME2 A;  2XPZ A;  4UWF A;  4AEZ C;  5E76 A;  3KMT A;  2P58 C;  2OND A;  3IBE A;  3QAQ A;  4JXT A;  5FQ4 A;  3D9M A;  4UQZ A;  2OV8 A;  4AP2 A;  4IUL A;  2W5Y A;  2GW1 A;  4BFR A;  2FBN A;  4U63 A;  5AIJ A;  4HOT A;  5A7D B;  2RG8 A;  2ZU6 B;  4DI4 A;  4V3I A;  4XI9 A;  2C2L A;  2L9B A;  4G2V A;  3CSF A;  4I6J A;  2DBA A;  1H19 A;  1FVH A;  3MKR A;  2I6H A;  1UJJ A;  4APO A;  4CRW A;  4ACK A;  3CHQ A;  4U0U A;  1E8Z A;  3L16 A;  2OVF A;  3ASH A;  1JWF A;  4XKC A;  2RD0 A;  3IEG A;  4UI9 J;  2VGX A;  3LJ3 A;  4WUY A;  2E2E A;  1MVH A;  3SW9 A;  2AXU A;  1FCH A;  2VSN A;  5C2Y A;  1MT6 A;  3IHX A;  4KZC A;  3QJZ A;  1SZ9 A;  3FUN A;  4G1T A;  4EZJ A;  3SD5 A;  1EF1 C;  2KZT A;  5D0O D;  3QWV A;  4A1S A;  4HOU A;  4LCT A;  3MKQ A;  3RJV A;  1N3J A;  1WAO 1;  2V8S E;  3B7U X;  4TUU A;  4U8H A;  4J7F A;  5AYF A;  1HU3 A;  1GW6 A;  1IQR A;  2KCV A;  4G26 A;  4I43 A;  3I3N A;  5G05 J;  4BTA A;  5T0M A;  3LDZ A;  3PRZ A;  5FQ7 A;  1HO8 A;  2XGM A;  5JHA A;  2F69 A;  2HO1 A;  4GB9 A;  4J8D A;  1UN8 A;  4A3V A;  1EYH A;  3M59 A;  5AYW D;  3AU4 A;  3ZEF A;  2IOS A;  3M54 A;  4AU7 A;  4BX8 A;  3D9N A;  4ANX A;  4U07 A;  3FU3 A;  4DLQ A;  2R3A A;  4U0S A;  3TJP A;  2VSY A;  4EQF A;  1IYG A;  4ANW A;  2XRZ A;  2VSX E;  3TAX A;  3EP0 A;  1WY6 A;  3CHR A;  4Q94 A;  2OOE A;  1KLX A;  4N39 A;  3UT4 A;  4HLE A;  4D10 C;  3FEX A;  3NF1 A;  4WWP A;  3JYS A;  3CKB A;  3T5X A;  4DPR A;  5C1D A;  4N2S A;  3CV0 A;  4MKT A;  4PUC A;  4B0Z A;  3F9Z A;  3RIB A;  4RG9 A;  4BWR A;  4AY5 A;  4HOS A;  3M5A A;  3FH5 A;  1BPO A;  3I5P A;  4FJY A;  4H7X A;  4MS6 A;  2UY1 B;  3FTS A;  5F6K C;  3CK7 A;  3RU0 A;  3G2S A;  2JV0 A;  2WXI A;  4N3B A;  3DB5 A;  4MRU A;  3CHP A;  1PY1 A;  5KJN A;  5DIZ A;  4MLP A;  2R59 A;  2Q7F A;  3G2T A;  2X6F A;  5JHN A;  4YNM A;  4I9C A;  2WXL A;  2CG2 A;  4GMJ A;  2IJG X;  3U4T A;  1HE8 A;  4YVO A;  2HYZ A;  2XRY A;  3APD A;  3FUM A;  5A23 A;  4I9E A;  4G24 A;  1O9S A;  3RK6 A;  4NJ5 A;  3HVE B;  1XNF A;  3IHV A;  2NC9 A;  3BG0 B;  2VQ2 A;  1NA0 A;  3PDN A;  3SBS A;  3HHM A;  5ANR A;  2J08 A;  1H2T C;  2WXP A;  3PNL B;  4C0E A;  4MI5 A;  4YPE A;  4W9R A;  3CVP A;  5BV0 A;  3FUE A;  4IN3 B;  4FA6 A;  3B7S A;  3EIQ C;  3R9A B;  2KCL A;  3Q49 B;  2W5Z A;  4J83 A;  2XEV A;  1Y8M A;  2VGY A;  3ASD A;  4Q96 A;  3URZ A;  3ENE A;  3Q47 B;  4I1O B;  4RSY A;  3SFZ A;  3VTX A;  3KEZ A;  1OWN A;  5G55 A;  2L6J A;  2LSU A;  4FLB A;  3I4G A;  2C0L A;  2OVB A;  2WQH A;  4GU5 A;  5BUZ A;  1PC2 A;  2WPV A;  2J9Q A;  1MHQ A;  3RRU A;  1TEZ A;  3UMV A;  2XCB A;  3GZ2 A;  2MHK A;  3ESL A;  4NVQ A;  3GZ1 A;  3CBM A;  1E96 B;  4B89 A;  3PNT B;  3D9I A;  4GYO A;  3O4Z A;  5LX8 A;  5JIY A;  2XPY A;  2J09 A;  2V4L A;  3LY9 A;  3PUJ A;  4JEH A;  5T0K A;  5FZQ A;  1E8Y A;  3L13 A;  4WND A;  3SZ7 A;  3U66 A;  4CCA A;  2L0I A;  3RO2 A;  5LOZ A;  2FO7 A;  4YND A;  3DPD A;  3RO3 A;  4GA2 A;  1U3D A;  5J90 A;  2YNQ A;  5F6L A;  3L22 A;  1XQH A;  3L17 A;  3KAE A;  1MQS A;  3FU0 A;  4A3T A;  3CK9 A;  4N3A A;  1WM5 A;  1W3B A;  3LKU A;  4HS2 A;  2VYI A;  5TTF A;  3OXF A;  3PUK A;  4WWO A;  2BUG A;  3ZHE A;  3OAW A;  4EZK A;  1JWG A;  3QWP A;  5FJY A;  5FTP A;  3FHE A;  1IQU A;  4JA9 A;  1IHG A;  1ZBP A;  1QNF A;  4KMO A;  3ML8 A;  2PQN A;  3SBT B;  4E6H A;  4KYO B;  4EEC A;  4EBA A;  4G23 A;  5FQ8 A;  3CVU A;  4CEM A;  3Q5M A;  2PM7 A;  3CLJ A;  3S7J A;  5EG2 A;  2WM9 A;  2XCC A;  3Q4A B;  3FTU A;  2I1K A;  3L08 A;  1MVX A;  1H6K A;  4BT9 A;  2CHX A;  4XI0 A;  3CQG B;  2WXK A;  2WQ7 A;  3IV0 A;  1FVF A;  3TXN A;  3T8M A;  5LCW C;  1LF8 A;  3MO5 A;  3S7F A;  5JJ6 A;  1H2V C;  4J7I A;  3PZD A;  3UT8 A;  5FZR A;  3MEK A;  3TL5 A;  4FJZ A;  4QEP A;  3RKV A;  4GYY A;  1JPL A;  2WMN A;  3CR3 A;  4BX9 A;  2LAH A;  3HDX A;  4QEO A;  1UN9 A;  1EDU A;  4I2Z A;  3JCK C;  3UQ3 A;  1N6A A;  3FPD A;  5T5G A;  3QB2 A;  3ZW3 A;  3FEY A;  3FUF A;  4I2W A;  3VTY A;  5AEN A;  2KC7 A;  3B7T A;  5TEG A;  1PEG A;  3FUK A;  4JA7 A;  4A1G A;  4CGV A;  1H2U A;  4GYW A;  4OYS A;  2DCP A;  2WXM A;  2CG3 A;  1HG5 A;  2CHZ A;  4GAA A;  4FUL A;  5LSZ A;  4JHR A;  3CK8 A;  3PEV B;  4LDG A;  2L0T B;  2WXF A;  4I17 A;  3RAY A;  1L5J A;  2CHW A;  4Y6C A;  3ONK A;  2WXN A;  3FUH A;  2WXJ A;  4TV3 A;  3P1U A;  4G25 A;  4ILH B;  3TG4 A;  2G46 A;  1HS6 A;  4JVS A;  3CVY A;  5E75 A;  3CBP A;  4YVQ C;  3SGH A;  4JHJ A;  2IOL A;  1UW4 B;  3DBS A;  4UI9 C;  3VLF A;  4FAD A;  3MJW A;  2PQR A;  4U0Z A;  4GCN A;  4B94 A;  4JHK A;  2YHC A;  4PDX A;  1N6C A;  3FDH A;  3OOI A;  2XPI A;  2E0I A;  4C1Q A;  3AS4 A;  4ILI A;  4LUN U;  3U64 A;  2FUL A;  5LCW J;  3S8P A;  4L7T A;  5T8I A;  4H12 A;  5ENN A;  4YNP A;  1N54 A;  2IQC A;  3FH7 A;  3CHS A;  4B8C B;  2BQZ A;  4ATG A;  1X5B A;  4RVB A;  2IF4 A;  2YIN A;  3VLD A;  5JJT A;  4LER A;  1E8X A;  4JL0 A;  3VUZ A;  4UQY A;  2HR2 A;  4AOF A;  4N3C A;  2IFU A;  4BSX A;  4AM9 A;  3RRM B;  2ION A;  2A4Z A;  4JC8 A;  3QKY A;  5KJL A;  1DVP A;  3HYM B;  3WXX A;  4P29 A;  4PS8 A;  4AY6 A;  3VV0 A;  3FUI A;  1U3C A;  2WB2 A;  3SWC A;  3UPV A;  3ASF A;  3BG1 B;  4NAC A;  4NUR A;  5TH7 A;  5F59 A;  3UT7 A;  4GZD A;  4J8F A;  5EX3 A;  5M72 A;  4J8O A;  2X6H A;  3D9P A;  3EJN A;  4QFV A;  2QY7 A;  4AJW A;  5FWQ A;  2YHE A;  4ANV A;  2XGO A;  4J6I A;  2WXR A;  2I2O A;  2VJ8 A;  3FUJ A;  3CVX A;  3NQP A;  3ESK A;  2R5S A;  2IU1 A;  3PEU B;  4HFG A;  5EDS A;  3CHO A;  5FQ6 A;  1TJC A;  2WQ6 A;  4I1A A;  4CDR A;  4CGW A;  4FP7 A;  1H3I A;  4ANU A;  4LRZ A;  4RG6 A;  4OVV A;  3AU5 A;  2AXV A;  4HOR A;  2I9C A;  4KVO A;  4FMU A;  3UUX A;  3MO0 A;  2WXH A;  3OPE A;  1Y6I A;  4WNG A;  3CVV A;  3ZN3 A;  3S7B A;  3D9L A;  4WWN A;  3SF4 A;  3QDN A;  5T3R A;  3G2U A;  1ELW A;  3SI5 A;  5BT1 A;  4Z4P A;  3F9X A;  2DIW A;  4URK A;  2C0M A;  4PH4 B;  3ML9 A;  3LPZ A;  4HOQ A;  5CMY A;  5EKQ D;  4KXK B;  3UX4 A;  3MA5 A;  3PRE A;  4WNF A;  4WNE A;  4IRU A;  3LY8 A;  4UI9 K;  2QFC A;  1HFA A;  3FP3 A;  3ZYL A;  3ZIM A;  3MV3 B;  1HXI A;  4K03 A;  3SNX A;  4XKB A;  2NXP A;  1B89 A;  3LCA A;  4FU3 A;  4KT6 B;  4Q69 A;  2UY1 A;  4BY6 A;  3FU6 A;  4L2Y A;  4UWK A;  2VGX B;  3D9K A;  3CQC B;  4DLO A;  1E8W A;  2Y4T A;  2YQ8 A;  5CMW A;  1VDY A;  2GRM A;  3ZFW A;  2NSZ A;  3FUD A;  1Z3X A;  3GYZ A;  4A55 A;  2VTB A;  3NZS A;  4I6E A;  2BTD A;  3M56 A;  3FTY A;  2LSV A;  2AXZ A;  3EIJ A;  4FHK A;  4F53 A;  3LVR E;  3MV2 B;  5CHE E;  5T4Y A;  4M3O A;  4Y6W A;  3M55 A;  1E90 A;  2X6K A;  4GZ3 A;  4HXI A;  3ZYQ A;  1DNP A;  3EDT B;  3AS8 A;  3B7R L;  4ABN A;  4GA1 A;  4AIF A;  3KMA A;  2J4D A;  3BEE A;  3GZS A;  4FHJ A;  3OS5 A;  4DI3 A;  5ARG A;  4I51 A;  4TRQ A;  3LVQ E;  3ZYK A;  3QK0 A;  2AWI A;  3Q15 A;  4UQX A;  3IKO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...