3QWWA

Crystal structure of histone lysine methyltransferase smyd2 in complex with the methyltransferase inhibitor sinefungin
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
430
structure length
430
Chain Sequence
b'AEARGGLERFCSAGKGRGLRALRPFHVGDLLFSCPAYACVLTVGERGHHCECCFARKEGLSKCGRCKQAFYCDVECQKEDWPLHKLECSSMVVLGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVREFESHLDKLDNEKKDLIQSDIAALHQFYSKYLEFPDHSSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGDEVFTSYIDLLYPTEDRNDRLRDSYFFTCECRECTTKDKDKAKVEVRKLSSPPQAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALKYGQKIIKPYSKHYPVYSLNVASMWLKLGRLYMGLENKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SET and MYND domain-containing protein 2
publication title Crystal structures of histone and p53 methyltransferase SmyD2 reveal a conformational flexibility of the autoinhibitory C-terminal domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 150
structure length 430
sequence length 430
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3qwwA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3qwwA01
5G04J 3CKCA 4J8OA 4I9CA 3LPZA 1ELRA 3BEEA 2V5FA 4J0UA 3URZA 3GZ2A 3DALA 2NC9A 4N2SA 5A6CA 1TJCA 2OOEA 2PZIA 5HI7A 4YPEA 4YPAA 1NA3A 2I6HA 3IEGA 3CVPA 4U07A 3LY9A 4WUYA 1HH8A 4IJDA 4IJ8A 5BT1A 3S7JA 3M5AA 1IYGA 1N6AA 2MHKA 2FBNA 1QZ2A 4GYYA 3UPVA 1O9SA 2KCVA 3KAEA 4AU7A 1NA0A 3MV2B 4U0ZA 5FZQA 3F9WA 3CKBA 4JA7A 5CPRB 4NVQA 5DIZA 3RJWA 2UY1B 3TG5A 3KMJA 5FJYA 1XQHA 3EDTB 3CV0A 5F5EA 2LSUA 1N6CA 3CK8A 3UUXA 4NJ5A 3ASFA 1H3IA 4G24A 4WNGA 4KYOB 2JV0A 3AS4A 5KJMA 4NRHB 3QOUA 3LYAA 4U04A 4YNMA 4QEPA 1P5QA 2KC7A 3SZ7A 5T0MA 5FZSA 3U4TA 1E96B 3ULQA 4N3BA 3AS5A 4XI9A 4N3AA 2L6JA 4HOQA 4WNEA 3PDNA 3CK9A 1MVHA 2XGSA 4BUPA 5FTPA 4I2WA 4U0UA 5T5GA 5LCWJ 3SWCA 5A7DB 3Q47B 3M57A 5LCWC 3R9AB 4YNPA 4I1AA 4WNFA 4GPKA 3ESKA 1ELWA 2IGQA 3U3WA 4B94A 4H7XA 4GZ6A 3QWWA 2W5ZA 3E4BA 3M56A 4Z4PA 4J83A 1ML9A 2XCCA 1B89A 2R5SA 5BW8C 3KMTA 4J7FA 1KT0A 3M54A 5JINA 5EX0A 4UQXA 4FMUA 3BO5A 3RU0A 1N3JA 4QENA 4GZ5A 2QPWA 4MI5A 2FF4A 3M55A 3SF4A 3GW4A 5F6LA 2LNIA 4C1QA 3IHXA 5G04C 5CCLA 5DBKA 2HO1A 3N71A 3F9XA 5EKQD 2PL2A 5JJTA 4RZ0A 4J8EA 3Q15A 4YVQC 4UQYA 3FPDA 4AY5A 3F9YA 5T0KA 4LDGA 5HQ8A 2XCBA 3ZN3A 3K5KA 4G26A 4UI9K 3OOIA 4N5CA 1PC2A 2ONDA 3EP0A 4JLGA 5JIYA 5M72A 3ASDA 5LSXA 5EX3A 3M58A 5TTFA 2IFUA 4G2VA 3PE3A 3CVNA 2HR2A 2VSYA 2LSVA 3CVLA 4HORA 3S8PA 4CDRA 1YA0A 1ZBPA 3Q4AB 4G23A 2Q7FA 3QDNA 3ZPJA 3FP3A 4IN3B 5KJLA 2G46A 1HXIA 4XI0A 4BWRA 4UQZA 5CHEE 3LCAA 4KXKB 3MO2A 5G05J 2UWJG 2VQ2A 5D0QD 1NZNA 3VV0A 4JDSA 2FO7A 3Q5MA 1KT1A 3CBOA 1KLXA 4UI9J 3OXFA 4N2QA 2XGMA 4ME2A 5C1DA 3DB5A 2WPVA 4GA2A 4I17A 3RO2A 1FCHA 3MV3B 2BQZA 3RKVA 2BUGA 4N39A 1W3BA 2PQRA 3GYZA 3ASGA 3RQ4A 5JJ0A 3QKYA 4ABNA 3QWVA 2JLBA 5KJKA 4GYOA 3NF1A 4O30A 3CBPA 2GW1A 4XIFA 3M53A 4I51A 2P58C 3RJVA 2E2EA 5F6KC 4H7YA 5FZRA 3K9IA 5JJ6A 2YHCA 1IHGA 4RG6A 4YPUA 2XPIA 2C0LA 4J8FA 4LEUA 2Y4UA 4GCNA 4AM9A 4Y6WA 3MA5A 1MVXA 3KS2A 2FEZA 2O8JA 5TEGA 1Y8MA 3UQ3A 4BTAA 5F59A 1PEGA 4E47A 5AYFA 2AVPA 4YVOA 3M59A 2Y4TA 3CVQA 3TGOA 3S7DA 4JHRA 4HOTA 3RIBA 2VGXB 1ZU2A 5FT9A 3ASHA 2VGXA 4U0SA 3FFLA 3VUZA 4HOSA 4MI0A 5ARFA 4WNDA 3HNAA 2HYZA 2KCKA 3RO3A 1XNFA 3HYMB 2XGOA 3S7BA 2QFCA 3CK7A 3KD7A 2FI7A 3MEKA 2J9QA 3S7FA 4I2ZA 3TG4A 3ZGQA 4CGVA 3TAXA 4BT9A 3AS8A 5LSZA 2RFIA 2IF4A 3MO5A 4BTBA 4J8DA 2UY1A 3KMAA 5EG2A 4Y6CA 2DBAA 4G1TA 3OS5A 4GZ3A 3LY7A 3ZHEB 2WQHA 3ZHEA 2PQNA 3CBMA 4QEOA 4JA9A 4GA0A 3ZFWA 5G05C 4RG9A 4O6FA 4G25A 1MUFA 3QWPA 4BT8A 1WM5A 3MKRA 5KJNA 4UI9C 3WXXA 1OUVA 4W9RA 4AIFA 3F9ZA 3LY8A 2XEVA 5TH7A 4H12A 4JL0A 3FWVA 2C2LA 4GCOA 4NQ0A 4YNDA 3Q49B 4APOA 3CEQA 5BNWA 5ARGA 2VSNA 3MO0A 4HOUA 3LKUA 4N3CA 3O48A 3PE4A 5AYWD 1QQEA 4I9EA 2VYIA 4AY6A 3JYSA 2C0MA 2R3AA 4EQFA 2W5YA 3OXGA 1ZKKA 3VTXA 4CGWA 3GZ1A 1A17A 1HZ4A 5D0OD 5JHNA 1WAO1 2KATA 5JJ7A 3VTYA 4F3VA 3SW9A 3OXLA 3RAYA 2YQ8A 2KCLA 1MT6A 4J7IA 4KBQA 5CCMA 4GYWA 4A1SA 4GA1A 3OPEA 2VGYA 2F69A
chains in the Genus database with same CATH superfamily
1NI1A 2VSOE 1OCZE 3P1UA 3LPZA 1WDYA 3R9MA 4J0UA 4AEZC 5CBNA 3B7BA 4GPMA 4N2SA 1TJCA 3PZ4A 3CSFA 4CYMD 4L7TA 4FULA 2I6HA 4AXHA 3DPDA 4TRQA 5J08A 4K03A 3I3NA 2XS8A 1NP7A 1IQRA 3S7JA 4B0ZA 1FVFA 5CMYA 3Q75A 1QZ2A 2KCVA 4U0ZA 1HF8A 5CPRB 4NVQA 3VLDA 4EZLA 3TWSA 3C3QA 2ETCA 2V5QC 5FJYA 1XQHA 3QK0A 3TWRA 4NJ5A 4G24A 4WNGA 1MX2A 3NB2A 4CEMA 3LYAA 1HG2A 4QEPA 4L1BA 3DSXA 4JVSA 4A55A 1FVHA 4BX9A 1UN9A 4HOQA 4K0RA 3HXFA 3U9WA 2XGSA 5FTPA 1IKND 3HXDA 3G2VA 3B13A 2WXRA 2R17C 2XRZA 3M57A 5AN8A 3FTZA 3G2SA 4J8SA 2R03A 3HRAA 4B94A 4H7XA 1N94A 4GZ6A 3ZKJA 2W5ZA 1WG0A 4A3VA 5C2YA 2XZTG 2XCCA 1B89A 2XPZA 4J7FA 3EHNA 1OWOA 3M54A 2EINE 4FMUA 3RU0A 1N9AA 4GZDA 3UT8A 4KZ0A 3RRUA 3DEOA 5EIDA 2X6JA 2J09A 3IHXA 3LEWA 5CCLA 2CFUA 2WXQA 2MOWA 3CHOA 4CCAA 3TL5A 1JWGA 5JJTA 3MX3A 4J8EA 5JMND 4UQYA 3ABME 3JQ0A 3T9KA 3JCKC 4PS8A 3KSQA 2IOSA 5J90A 4UI9K 2ONDA 3EP0A 3ASDA 4XKCA 3M58A 1D8EA 3FTXA 4G2VA 2BKKB 2EQXA 1SA5A 3UI2A 5EYLA 3D9JA 4B8AA 4A63B 4AJWA 3V31A 5FIOA 3S8PA 3SGHA 4G23A 1SVXA 5KJLA 3TXNA 3QC1A 4MS6A 3TWTA 5ENNA 2KM4A 4KXKB 4Q94A 1S0PA 2UWJG 4BSXA 4DLOA 1NL4A 4JDSA 3IHYA 3DSWA 2IJGX 3Q5MA 1KT1A 1DC2A 4EZKA 2FO1E 3OXFA 4FLHA 4ME2A 4K5AB 2WPVA 4B89A 3RRMB 3SO8A 3JQ1A 2OEVA 4HRMB 3TWVA 5BPPA 2GRQB 2BUGA 4JZYA 1E90A 1W3BA 3GYZA 3ASGA 2AXVA 4ANXA 4ABNA 3QWVA 3FUHA 3TXMA 3L9TA 3SBTB 2XEEA 2E2EA 5FZRA 4BETA 3QJZA 2LXLA 5JJ6A 1IHGA 1O1RA 5AQ7A 4J8FA 3NOGD 4LEUA 3B95A 1IQUA 2OEWA 1LD7A 2WXFA 5AJLA 3L54A 4J6IA 1H6PA 3UQ3A 3ASOE 1PEGA 3CGHA 2ILRA 4YVOA 2MYOA 2Y4TA 4MKTA 2OV8A 4CDMA 2R02A 2VGXB 5ENPD 2VGXA 5FWQA 3JUIA 3FFLA 3S2AA 4MI0A 3SD5A 4WNDA 4JHJA 4EPZA 1KZOA 4DX2A 4JEUA 3CVYA 1V55E 4RVBA 2WXKA 4MRUA 5EYPF 3PZ1A 4NURA 3KD7A 3DXKG 3S7FA 4I2ZA 3EU5A 2XHEA 4CGVA 1V54E 3AG4E 4ATZD 3AS8A 1Q2ZA 2RFIA 3PNLB 2CHZA 5HKPA 4DX1A 2FULA 2WMOA 1JUQA 5KNHD 2UY1A 3KMAA 5EG2A 4Y6CA 4O60A 4LERA 3LY7A 2WXLA 4OVUA 4UWHA 3NZUA 3CBMA 3HXBA 1N0QA 4O6FA 4U7EB 3UX4A 4F1SA 5KNGA 4PS7A 3ESLA 1WM5A 4UI9C 3R7RA 2I2OA 3F9ZA 3LY8A 4LG6A 2GROB 4H12A 4JL0A 3FWVA 4NQ0A 4X8QA 3G2WA 1K8KG 2VSNA 4FJZA 2DZNA 3LKUA 4N3CA 3PE4A 4G8LA 4HI8A 5EN5D 4I9EA 4U8HA 2VYIA 4F7AA 3JYSA 1D8DA 5FINA 1ZKKA 4CGWA 4ZHBA 1A17A 4HQDA 5JHNA 2BEDA 1Y6IA 1TJFA 3DSSA 1MT6A 4FHKA 4Q69A 3ZXSA 3RRNB 3OPEA 3LVRE 2J49A 3E34A 1Z6TA 4I9CA 1ELRA 3BEEA 2V5FA 3AJIA 3PZ2A 3GZ2A 5D2MC 3V79K 2NC9A 3UXGA 5A6CA 3DWLG 3TWUA 2VGEA 2OOEA 5HI7A 1AWCB 4HXIA 3HXCA 1BLXB 1HG5A 2X38A 3NAWA 4IJDA 4IJ8A 5BT1A 3ULYA 1N4RA 3BG0B 3SY2A 2FBNA 2PNNA 4K5BA 1QBQA 4GTVA 1O9SA 3KAEA 5CECB 4AU7A 3MV2B 5FZQA 4I6GA 3UIOC 3CKBA 3CHPA 3RJWA 2L9BA 3PREA 4EBAG 3UUXA 5AQBA 2WM9A 4RLYA 4R7LA 1D9SA 4NRHB 3IV0A 2I9CA 3QOUA 4YNMA 2KC7A 4GTSA 1ELKA 1YYHA 3C98A 2AXUA 1E96B 2WXGA 3ULQA 1HO8A 3EIJA 3TWWA 5ENTD 4XI9A 4N3AA 4O1PA 2LXMA 3CK9A 4F1PA 4U0UA 2KZTB 3D9KA 3ISMC 2IQCA 5LCWJ 3UT7A 2KZTA 2YNQA 3JXJA 3R9AB 3FU3A 4I1AA 4WNFA 4GPKA 2VJ8A 4PS3A 1UOHA 1ELWA 1DNPA 3FHEA 3FEYA 2A4ZA 5CRUA 3M56A 2XZDG 1JCRA 5CRVA 1ML9A 1Z5SC 4J83A 2R5SA 3APFA 5EDSA 5JINA 1JCQA 2RG8A 1DVPA 5EX0A 4ILIA 3EHQA 3EUVA 5ENSD 2FF4A 2LAHA 4G11A 5F6LA 5G04C 2WMNA 1N4QA 4O1OA 5CERB 3PRZA 3ENEA 4UWLA 4XZ4A 4RZ0A 4C0MA 3Q15A 4YVQC 4DUIA 2F8XK 5T0KA 2XCBA 4UUCA 3VLEA 3CVWA 4E85A 4HLLA 3ZYKA 1UW4B 4N5CA 1SA4A 1PC2A 5AQ9A 3AU4A 1OWMA 4JLGA 1FT2A 1HU3A 5LSXA 1XGWA 3ABKE 2IFUA 3FUIA 3CVNA 1BPOA 2P9NG 4M3OA 4IULA 3HVEB 2P9PG 4WWOA 3KSLA 4U63A 3HVEA 3HXEA 3EHMA 4HORA 1YA0A 4FJYA 3V2OA 3Q4AB 3QDNA 5AIJA 3LVQE 3EU9A 1MQSA 4XX5A 5CHEE 3FH8A 3LCAA 3MO2A 2VQ2A 5LP0A 5D0QD 1NZNA 3VV0A 3D9IA 2J08A 4RSYA 4BESA 1K1AA 3CBOA 1KLXA 2GRRB 4N2QA 3DB5A 3MCXA 4NACA 4HBDA 3NQPA 1FCHA 1BI8B 1U3DA 4KVMA 2ZXWE 3MV3B 3APDA 3FU6A 3RKVA 2J8SD 5ANRA 3RQ4A 5JJ0A 2JLBA 3BQOA 5KJKA 3NF1A 3CBPA 3ZYQA 4I51A 3R7QA 1EPUA 5D66A 2XPIA 2WXPA 3WG7E 3UM0A 3KS2A 3C72A 2PM6A 2GRLA 5TEGA 5T8IA 3LJNA 4ANUA 1JCSA 1HX8A 1TNYA 5AYFA 5AQAA 3JXIA 3DXMG 3Q79A 4ANVA 1INZA 1U3CA 3CVQA 4HVBA 4JW1A 2AWIA 1UJKA 3ASHA 2JEKA 4GAAA 5EILA 4U0SA 3FDHA 4TXRA 2GRNB 2ETBA 2KCKA 2GRPB 3PVLA 5EIBE 4QQIA 3Q78A 2F8YA 1XNFA 2QYJA 3CK7A 4HNAD 1OY3D 3FUEA 1H2TC 2YHEA 1FPPA 1H0AA 4XE0A 3ZGQA 4BERA 4FLBA 1KPSB 3J5QB 5LSZA 3JUEA 4BEPA 4BTBA 4J8DA 1K1BA 3PEVB 3O4ZA 3Q7AA 3ONKA 2DBAA 4G1TA 3Q9NC 3OS5A 4GZCA 3ZFWA 3C3RA 5G05C 2RKKA 4L23A 4RG9A 4DLQA 4G25A 1MUFA 3QWPA 4UWKA 1EF1C 3WXXA 1OUVA 2OCCE 4U8YD 2X6IA 4A1GA 5TH7A 2XEHA 4KZCA 1PY1A 5AARA 3MGBA 2PM7A 1MZCA 5BNWA 5ARGA 2H6GA 4TV3A 4MBGA 2QYUA 3O48A 4JPSA 3FTYA 4TUMA 1WY6A 4LUNU 2CG2A 1N4SA 5CEAA 4OAUC 2AJAA 3QAQA 2W5YA 3OXGA 2IO2C 1LD8A 1OWPA 3GZ1A 4GMLA 3C5RA 4DRXE 3SFZA 2KATA 5JJ7A 1U2VG 2WXNA 3BU8A 4EZJA 4I6JA 3SW9A 2V4HC 2YQ8A 2R2LA 4DPRA 4J7IA 4BFRA 5CCMA 3EHRA 2VGYA 3CKCA 3UT4A 3ZVVA 4J8OA 3RK6A 3Q73A 3URZA 1A5EA 3D9PA 4GTPA 2XQ0A 4JHKA 4PH4B 5T3RA 4YPAA 1NA3A 2J4BA 3ZW3A 3CVPA 2A5EA 3LY9A 4WUYA 3E30A 3UIPC 3L22A 5AAOA 2CHXA 3SQVA 1N6AA 5CEDB 1QYMA 2HE0A 3ML8A 4GYYA 3UPVA 2IO3C 4DI4A 4GMJA 4DK5A 4JA7A 2P9LG 4Q96A 2UY1B 3TG5A 5FQ4A 1MJ0A 3CV0A 5F5EA 2LSUA 1N6CA 1UG3A 1TR4A 3ASFA 2JV0A 3AS4A 1G3NB 1E7VA 4P29A 3DBSA 1P5QA 5FZSA 4OYSA 4N3BA 1NFIE 5JA4D 2L6JA 3PDNA 5B1AE 5B1BE 3ULEG 3T8KA 1H6KA 1MX6A 3FUMA 5A7DB 3Q47B 5LCWC 4YNPA 1TNBA 4L2LA 3HIZA 3SFYA 2IGQA 3U64A 4OAVB 2HM8A 3D9NA 1H2UA 5KBAA 3U3WA 2I1JA 4LCTA 4GTOA 1X5BA 1Z3XA 5BV0A 2I1KA 4Z4PA 3GZSA 3I4RB 5BW8C 1SZAA 1N11A 1MHQA 3KMTA 2H6HA 1KT0A 2CG3A 3B7SA 2H6IA 4GZ5A 2AW6A 3FTSA 3CVUA 1N0RA 2LNIA 2GGFA 2NYJA 3MZLB 3FH7A 5AJDA 5FQ6A 3IBEA 4N5QA 1SZ9A 4LDGA 5HQ8A 3ZN3A 3AG2E 3J5PA 3D9OA 3K5KA 3Q9UC 3LXUX 5H7PA 4G26A 3FUFA 4HRLA 5BV1A 4L2YA 4RQIA 4PUCA 4FHJA 1TNOA 1LF8A 5M72A 2AXZA 1LTXA 3PUJA 5EX3A 5BXUA 1H6OA 3PEUB 2HR2A 2VSYA 2A5UA 4KMOA 2GRMA 2P9SG 2RFAA 1RZ4A 4GTTA 3HDXA 3PZDA 2LSVA 4A3TA 2ZGGA 4B93B 1ZBPA 4HFGA 2WXJA 3IHVA 3FUNA 2Q7FA 3ZPJA 3FP3A 4IN3B 3CHMA 1TN7A 2CFZA 4ACKA 3FTWA 4UQZA 2KXPC 3G2TA 4AV7A 2Y0BG 4LNBA 3DRAA 3CQGB 3QARA 4UWFA 4AVXA 3W9FA 4YDYA 4I43A 3FULA 4UI9J 1TNZA 4ILGA 2IY0C 2IEJA 5C1DA 4AP2A 3ZEFA 2DIWA 4GTMA 3T5XA 1SQMA 4I17A 3RO2A 2QY7A 3CHSA 4LRZA 3SBSA 3MYVA 4JC8A 2PQRA 2L0TB 3QKYA 4GYOA 2WVIA 2XRYA 2GW1A 4XIFA 3M53A 5F6KC 3FTVA 2WQ6A 3LJ3A 4J7WA 2YHCA 1MYOA 3SI5A 4RG6A 4HRNA 4YPUA 4URKA 2C0LA 1ZB1A 4KVOA 2L0IA 2BKGA 2ETAA 4GCNA 3HHMA 2CHWA 3V30A 4AM9A 2KBXA 5JHAA 3MA5A 2B0OE 1MVXA 2FEZA 2O8JA 4CRWA 1Y8MA 1H19A 3DEPA 3ZXPA 1EDUA 3OTNA 4E6HA 3CVVA 3ZIMA 2QC9A 3UM2A 3TGOA 2IU1A 2X6HA 3S7DA 4HOTA 2BTDA 3RIBA 1ZU2A 5HRYA 1FT1A 4KT6B 4FC8A 3W9GA 4HOSA 2DZOA 3ZRHA 3HYMB 2WXMA 2XGOA 1OCOE 3CHRA 1RW2A 4HB5A 2WB2A 4J8YA 2FI7A 3MEKA 2EILE 2R59A 3QB2A 1O1TA 4B8CB 2DYSE 3TAXA 1GW6A 3DPYA 1MX4A 4JB8P 2V8SE 1IXVA 3AAAC 5G55A 3X2QE 3FUJA 3NZSA 2IF4A 3MO5A 2Y3AA 3OAWA 4FP7A 5LX8A 5FQ7A 4GZ3A 3SHFA 3CIAA 2WQHA 5LOZA 2B6CA 3U66A 1E8YA 4HI9A 3NOCD 3MKRA 2EIKE 4CDNA 2X6KA 4CT0A 1OCRE 2XEVA 4JD2G 3AG1E 3L08A 4FA6A 3MO0A 4HOUA 3CHQA 4HLEA 1QQEA 4FADA 1TN8A 2X6FA 4AY6A 2Y1LE 2R3AA 3LS8A 4EQFA 1E7UA 2XPYA 3VTXA 1HE8A 1HZ4A 1VDYA 5D0OD 2JABA 3DSUA 4G8KA 4JEHA 4DX6D 4F3VA 3D9HA 2DYRE 1TNUA 3OXLA 3RAYA 4OVVA 3CR3A 4GA1A 2ZGDA 5G04J 2RFMA 1QNFA 1DCEA 2J4DA 1O1SA 1BI7B 4F6RD 4LNUD 3ZUVB 5KCMA 2V0PA 4ZFHA 3DALA 3FUDA 1O5MA 5CMWA 2PZIA 4YPEA 3IEGA 3CQCB 4U07A 1HH8A 1N4PA 3ML9A 3VLFA 1HS6A 3QNKA 3M5AA 1IYGA 2H6FA 2MHKA 5E76A 3ZU7B 1N95A 1S64A 2LAIA 2MRIA 1NA0A 3F9WA 5E75A 4PDXA 5DIZA 1OWLA 1HFAA 4M7CA 2WXIA 3KMJA 3AU5A 3EDTB 3Q7FA 3CK8A 1H3IA 2IONA 4KYOB 5KJMA 2QZAA 4U04A 4YDEA 2R05A 4NIKA 3SZ7A 4JXTA 5T0MA 3U4TA 3I5PA 2IOLA 3FEXA 3B7UX 3AS5A 1JPLA 4DX5D 2LUHA 2ZIRA 4WNEA 1MVHA 4BUPA 1E8XA 4I2WA 5IY5E 4DX7D 2VTBB 3ONLA 5T5GA 3SWCA 2VTBA 2V4LA 5ENOD 4QFVA 3ABLE 3ESKA 4LSZE 2L6BA 3QWWA 1JWFA 1OXJA 4F53A 4ATGA 4MLPA 3E4BA 3TJPA 2XS1A 4C48B 4AOFA 3L17A 2J07A 2WXHA 1BD8A 1N54A 2WQ7A 3NBNB 1KZPA 1E8ZA 4UQXA 3BO5A 3I4GA 1N3JA 4QENA 2QPWA 4MI5A 3M55A 3SF4A 3GW4A 2NXPA 4C1QA 3FTUA 1IHBA 1OCCE 5DBKA 2HO1A 3N71A 3F9XA 3FU0A 5G2NA 5EKQD 1H2VC 2PL2A 3FY4A 4EHMA 3CSTA 4V3IA 3FPDA 4AY5A 3F9YA 4EBAA 1UJJA 1L5JA 3DSVA 3V2XA 5CBOA 3TWXA 2P9KG 3OOIA 3D9LA 4C0EA 1PAQA 2RD0A 2OVFA 4K5CA 5JIYA 4GB9A 4ILHB 5T4YA 1SW6A 3APCA 5TTFA 3IKOB 3PE3A 3UMVA 2LO6A 3KEZA 2M63A 2VSXE 4L9PA 3CVLA 5KWDA 1TN6A 4CDRA 1K3ZD 4UWGA 2ZU6B 3PH0C 3UM1A 3L82A 2EIME 5ANLA 4BY6A 4WAFA 5ITZF 2G46A 1HXIA 1X81A 4XI0A 4EECA 4BWRA 4ACLA 5G05J 5JHBA 4IRUA 1Z3YA 2FO7A 3E37A 1S70B 3AG3E 4D10C 3CLJA 4ANWA 4GMRA 2XGMA 3UM3A 1OWNA 3B7RL 4GA2A 3UTMA 3UKRG 5AENA 2EIJE 3KEAA 2Y69E 2BQZA 2BF0X 4N39A 5HS0A 4GTRA 4FU3A 3BUAA 4O30A 4U8VD 2DCPA 3PS6A 3E33A 4DI3A 2P58C 3ASNE 3RJVA 4H7YA 3K9IA 4WWPA 3ZYLA 3BG1B 2NSZA 4U96D 1DCQA 2Y4UA 4TXQA 4YDOA 4BSZB 4Y6WA 4CT4A 3IXEA 3EIQC 1S63A 1E8WA 4BTAA 2OVBA 5F59A 4XKBA 2E0IA 4E47A 3EJNA 5BXOA 2YINA 4U95D 2AVPA 5ENQD 3M59A 4LNGA 3FH5A 4JHRA 3PNTB 5FQ8A 5FT9A 4BX8A 1EYHA 3VUZA 5ARFA 3FUKA 3HNAA 3B7TA 2HYZA 3RO3A 1OT8A 4TXPA 3S7BA 2QFCA 3MJWA 4APFA 4WWNA 3T8MA 3DSTA 2F0YA 3ZNGA 3E32A 1N52A 2J9QA 3MKQB 3MKQA 4Z68A 1YMPA 3TG4A 4TUUA 2WXOA 3C3OA 3L13A 5A23A 4I1OB 4BT9A 3G2UA 3T5VA 1TEZA 3ZYMA 3CVXA 5LFAA 4C9BB 3ZHEB 2P9IG 3ZHEA 2PQNA 4QEOA 4JA9A 4GA0A 3UKUG 2XENA 4YDWA 4I1MA 2F37A 2P9UG 1AP7A 4BT8A 5KJNA 3FU5A 3PZ3A 4W9RA 3RAUA 4AIFA 4GTQA 4I6EA 4XEIG 2P2CP 3L16A 3SNXA 3LDZA 2C2LA 4GCOA 4GU5A 4YNDA 5B3SE 1YCSB 3Q49B 4APOA 3D3MA 3CEQA 3TWQA 2ZISA 3SFXA 5AYWD 1UN8A 4IYPA 3P2BA 2C0MA 3UINC 3L6AA 4DJAA 3D9MA 3RSEG 5ENRD 3F6QA 1TYQG 1WAO1 3PUKA 2DWZA 4HS2A 3VTYA 5BUZA 2X3MA 4CZ2D 2KCLA 2DVWA 1BU9A 4KBQA 4GYWA 4A1SA 3HG0D 2F69A
chains in the Genus database with same CATH topology
5G04J 3LVRE 2J49A 3CKCA 3UT4A 3ZVVA 1QNFA 2VSOE 1Z6TA 4J8OA 2J4DA 3P1UA 4I9CA 3LPZA 1ELRA 3BEEA 2V5FA 4J0UA 4AEZC 5KCMA 3RK6A 2V0PA 3URZA 3GZ2A 3DALA 2NC9A 3FUDA 5A6CA 4N2SA 1TJCA 3CSFA 3D9PA 5CMWA 4L7TA 2OOEA 2PZIA 2XQ0A 5HI7A 4JHKA 4PH4B 4FULA 5T3RA 4YPAA 4YPEA 1NA3A 2I6HA 4HXIA 2J4BA 4AXHA 1HG5A 3DPDA 3CQCB 3IEGA 3ZW3A 3CVPA 4TRQA 4U07A 3LY9A 4WUYA 5J08A 1HH8A 2X38A 3I3NA 4K03A 4IJDA 3L22A 1NP7A 3ML9A 3VLFA 4IJ8A 5BT1A 1IQRA 1HS6A 3S7JA 4B0ZA 3QNKA 2CHXA 3M5AA 1IYGA 1FVFA 2MHKA 1N6AA 3BG0B 5CMYA 5E76A 2FBNA 3ML8A 1QZ2A 4GYYA 2MRIA 2LAIA 3UPVA 1O9SA 2KCVA 3KAEA 4AU7A 4DI4A 1NA0A 3MV2B 4U0ZA 5FZQA 1HF8A 4I6GA 3F9WA 3CKBA 3CHPA 4GMJA 4JA7A 5E75A 4DK5A 2BQZA 4PDXA 3VLDA 4NVQA 5DIZA 4Q96A 1OWLA 4EZLA 1HFAA 3RJWA 2UY1B 2WXIA 3TG5A 3KMJA 5FQ4A 5FJYA 1XQHA 2L9BA 3QK0A 3AU5A 3PREA 3EDTB 3CV0A 5F5EA 4EBAG 2LSUA 1N6CA 1UG3A 3CK8A 3UUXA 4NJ5A 2WM9A 3ASFA 1H3IA 2IONA 4G24A 4WNGA 4R7LA 4KYOB 2JV0A 3AS4A 5KJMA 4NRHB 3IV0A 2I9CA 4CEMA 3QOUA 3LYAA 1E7VA 4U04A 4P29A 1HG2A 3DBSA 4YNMA 1P5QA 4QEPA 2KC7A 1ELKA 3SZ7A 4L1BA 4JXTA 5T0MA 3C98A 5FZSA 4JVSA 4OYSA 3U4TA 2AXUA 3I5PA 1E96B 4A55A 2WXGA 3ULQA 4N3BA 2IOLA 1FVHA 3FEXA 3B7UX 1HO8A 3AS5A 3EIJA 1JPLA 4BX9A 1UN9A 4N3AA 4XI9A 2L6JA 4HOQA 4WNEA 4K0RA 3PDNA 3CK9A 1MVHA 3U9WA 2XGSA 4BUPA 1E8XA 5FTPA 4I2WA 1H6KA 3G2VA 4U0UA 3ONLA 3B13A 2KZTB 3D9KA 2VTBB 5T5GA 2IQCA 5LCWJ 3SWCA 2VTBA 3UT7A 2KZTA 3FUMA 2WXRA 2YNQA 5A7DB 2R17C 2XRZA 3Q47B 2V4LA 5LCWC 3R9AB 3M57A 4YNPA 4QFVA 3FU3A 4I1AA 4L2LA 4WNFA 4GPKA 3FTZA 2VJ8A 3G2SA 4J8SA 4PS3A 3ESKA 3HIZA 1ELWA 2IGQA 1DNPA 3U64A 2HM8A 3D9NA 1H2UA 3FHEA 4B94A 4H7XA 2I1JA 3U3WA 3FEYA 4GZ6A 3QWWA 1JWFA 2W5ZA 4LCTA 4F53A 4ATGA 4MLPA 3E4BA 1X5BA 1Z3XA 2A4ZA 4A3VA 5BV0A 3M56A 5C2YA 3TJPA 2I1KA 4Z4PA 4J83A 1ML9A 3GZSA 2XCCA 3I4RB 1B89A 2R5SA 3L17A 5BW8C 4AOFA 1SZAA 2XPZA 2J07A 2WXHA 3APFA 1MHQA 3KMTA 4J7FA 1N54A 3EHNA 1KT0A 1OWOA 3M54A 5EDSA 2WQ7A 5JINA 2CG3A 2RG8A 1DVPA 3B7SA 1E8ZA 4UQXA 5EX0A 4FMUA 4ILIA 3RU0A 3BO5A 3I4GA 1N3JA 4QENA 4GZDA 2AW6A 4GZ5A 3UT8A 4KZ0A 2QPWA 4MI5A 2FF4A 2LAHA 3RRUA 3M55A 4G11A 3FTSA 3GW4A 3SF4A 5F6LA 2X6JA 3CVUA 2NXPA 2LNIA 2J09A 2GGFA 4C1QA 3IHXA 3FTUA 5G04C 2WMNA 3LEWA 3MZLB 5CCLA 5DBKA 2HO1A 3N71A 2CFUA 2WXQA 3F9XA 2MOWA 3FU0A 3CHOA 5G2NA 4CCAA 3TL5A 1JWGA 1H2VC 3FH7A 2PL2A 3PRZA 5EKQD 3ENEA 3FY4A 4UWLA 4XZ4A 5JJTA 3MX3A 4J8EA 4C0MA 4RZ0A 5AJDA 5FQ6A 3CSTA 3Q15A 4V3IA 4UQYA 4YVQC 3IBEA 3FPDA 4AY5A 3JQ0A 1SZ9A 3F9YA 4EBAA 1UJJA 4LDGA 5HQ8A 2XCBA 5T0KA 1L5JA 3ZN3A 3JCKC 3D9OA 4PS8A 3K5KA 3VLEA 3CVWA 3LXUX 4E85A 3ZYKA 1UW4B 2IOSA 5J90A 4G26A 4UI9K 3FUFA 3OOIA 4N5CA 3D9LA 5BV1A 1PC2A 4C0EA 2ONDA 4L2YA 3AU4A 4PUCA 3EP0A 1PAQA 1OWMA 2RD0A 2OVFA 4JLGA 4FHJA 5JIYA 4GB9A 4ILHB 1HU3A 5T4YA 1LF8A 5M72A 2AXZA 3ASDA 3APCA 3PUJA 4XKCA 1XGWA 5EX3A 3M58A 5LSXA 5TTFA 2IFUA 3FUIA 3IKOB 4G2VA 3FTXA 3PE3A 3CVNA 2HR2A 2VSYA 2A5UA 2LO6A 1BPOA 3PEUB 4KMOA 2EQXA 3UMVA 4M3OA 4IULA 2GRMA 3HVEB 3KEZA 4WWOA 2M63A 4U63A 3D9JA 3HVEA 4B8AA 2VSXE 3HDXA 4AJWA 3PZDA 2LSVA 3CVLA 4A3TA 3EHMA 4HORA 3S8PA 4CDRA 1YA0A 1ZBPA 4FJYA 4HFGA 4UWGA 2ZU6B 3SGHA 3PH0C 2WXJA 3IHVA 3FUNA 3Q4AB 2Q7FA 3QDNA 4G23A 3LVQE 3FP3A 3ZPJA 5AIJA 4IN3B 5ANLA 5KJLA 3CHMA 3TXNA 4BY6A 4WAFA 2G46A 3QC1A 1HXIA 4MS6A 1MQSA 4XI0A 4XX5A 4EECA 4BWRA 5ENNA 2CFZA 4ACKA 2KM4A 3FTWA 4UQZA 5CHEE 3FH8A 3LCAA 4KXKB 4ACLA 3G2TA 4AV7A 4Q94A 3MO2A 5G05J 5JHBA 1S0PA 2UWJG 2VQ2A 4IRUA 4BSXA 5LP0A 1Z3YA 3CQGB 1NZNA 5D0QD 4DLOA 3VV0A 3QARA 4JDSA 4UWFA 3D9IA 2J08A 3IHYA 4RSYA 4AVXA 2FO7A 2IJGX 3Q5MA 1KT1A 3CBOA 4I43A 1KLXA 4EZKA 3FULA 4D10C 4UI9J 3OXFA 3CLJA 4ANWA 4ILGA 4N2QA 2XGMA 4FLHA 4ME2A 5C1DA 4AP2A 1OWNA 3DB5A 3B7RL 3MCXA 2DIWA 2WPVA 4GA2A 4NACA 3NQPA 3T5XA 3ZEFA 1SQMA 3RRMB 4B89A 4I17A 3RO2A 1FCHA 3JQ1A 5AENA 1U3DA 4KVMA 5BPPA 3MV3B 3APDA 2QY7A 3FU6A 2BUGA 3CHSA 5ANRA 2BF0X 4LRZA 4JZYA 3RKVA 3SBSA 3MYVA 4N39A 4JC8A 1E90A 1W3BA 2PQRA 3GYZA 2L0TB 3ASGA 3RQ4A 5JJ0A 2AXVA 4ANXA 3QKYA 4ABNA 3QWVA 4FU3A 2JLBA 3FUHA 3TXMA 5KJKA 4GYOA 3NF1A 4O30A 3CBPA 3ZYQA 2WVIA 2DCPA 2XRYA 3SBTB 2GW1A 3PS6A 4XIFA 4DI3A 3M53A 4I51A 3R7QA 2P58C 3RJVA 2E2EA 5F6KC 4H7YA 3FTVA 2WQ6A 5FZRA 3K9IA 4WWPA 1EPUA 3ZYLA 3BG1B 3LJ3A 3QJZA 2YHCA 5JJ6A 1IHGA 2NSZA 4RG6A 3SI5A 4YPUA 4URKA 2XPIA 2C0LA 2WXPA 4KVOA 2L0IA 4J8FA 4LEUA 2Y4UA 4GCNA 3HHMA 2CHWA 4AM9A 1IQUA 4Y6WA 5JHAA 3MA5A 1MVXA 3KS2A 4CT4A 2FEZA 2O8JA 2PM6A 2GRLA 5TEGA 5T8IA 4CRWA 1Y8MA 2WXFA 3EIQC 5AJLA 1H19A 3L54A 1E8WA 4J6IA 3UQ3A 4BTAA 2OVBA 5F59A 4XKBA 2E0IA 1PEGA 4E47A 4ANUA 1HX8A 3EJNA 5AYFA 3CGHA 2YINA 2ILRA 2AVPA 4ANVA 1EDUA 3OTNA 4YVOA 4E6HA 3ZIMA 3CVVA 1INZA 3M59A 1U3CA 3FH5A 2Y4TA 3CVQA 4HVBA 2IU1A 4JW1A 3TGOA 2X6HA 2OV8A 4JHRA 4MKTA 2BTDA 3PNTB 5FQ8A 3S7DA 4CDMA 3RIBA 2AWIA 4HOTA 2VGXB 1ZU2A 1UJKA 3ASHA 5FT9A 2JEKA 2VGXA 4GAAA 4BX8A 5FWQA 3JUIA 4KT6B 3FDHA 4U0SA 1EYHA 3FFLA 3S2AA 3VUZA 4FC8A 4HOSA 4MI0A 5ARFA 3FUKA 3SD5A 4WNDA 3B7TA 2HYZA 2KCKA 3PVLA 4JHJA 3RO3A 4EPZA 3HNAA 3ZRHA 4JEUA 3CVYA 1XNFA 3HYMB 2WXMA 2XGOA 4RVBA 3CHRA 3S7BA 2WXKA 2QFCA 3CK7A 2WB2A 3MJWA 4MRUA 4APFA 4WWNA 3T8MA 4NURA 3KD7A 3FUEA 1H2TC 2FI7A 2YHEA 3MEKA 1N52A 2J9QA 3MKQB 2R59A 3S7FA 3MKQA 4I2ZA 1H0AA 3QB2A 4XE0A 3TG4A 2XHEA 4TUUA 3ZGQA 2WXOA 4CGVA 4B8CB 3L13A 3TAXA 4I1OB 5A23A 1GW6A 4FLBA 4BT9A 2V8SE 3AS8A 5G55A 3G2UA 5LSZA 2RFIA 3FUJA 3PNLB 3NZSA 5CPRB 2CHZA 2IF4A 2FULA 3MO5A 2WMOA 4BTBA 2Y3AA 1JUQA 3T5VA 4J8DA 1TEZA 3ZYMA 3PEVB 3OAWA 2UY1A 3KMAA 5EG2A 3CVXA 3O4ZA 4FP7A 4Y6CA 3ONKA 2DBAA 4G1TA 4LERA 5LX8A 3OS5A 5FQ7A 5LFAA 4GZ3A 3SHFA 3LY7A 2WXLA 4OVUA 4UWHA 3ZHEB 3CIAA 4C9BB 2WQHA 3NZUA 5LOZA 4GZCA 3ZHEA 2PQNA 3CBMA 4QEOA 4JA9A 4GA0A 3ZFWA 5G05C 4L23A 4RG9A 4O6FA 3U66A 4DLQA 4G25A 4I1MA 3UX4A 4F1SA 3QWPA 4UWKA 1MUFA 1E8YA 1EF1C 4PS7A 3ESLA 1WM5A 4BT8A 3MKRA 4CDNA 5KJNA 3FU5A 4UI9C 3WXXA 2X6KA 1OUVA 3R7RA 4W9RA 4AIFA 2I2OA 4CT0A 4I6EA 2X6IA 3F9ZA 3LY8A 2XEVA 4A1GA 3L16A 3SNXA 3LDZA 5TH7A 4H12A 4JL0A 3FWVA 2C2LA 4GCOA 4GU5A 4KZCA 4NQ0A 4YNDA 3Q49B 1PY1A 4APOA 3L08A 4FA6A 3D3MA 3CEQA 3G2WA 3MGBA 2PM7A 5BNWA 5ARGA 2VSNA 3MO0A 4FJZA 4TV3A 4HOUA 3CHQA 3LKUA 4N3CA 3O48A 4HLEA 4JPSA 3FTYA 3PE4A 5AYWD 1WY6A 1QQEA 4I9EA 1UN8A 4U8HA 4LUNU 4FADA 2CG2A 4IYPA 3P2BA 2VYIA 2X6FA 4F7AA 3JYSA 2C0MA 4AY6A 3QAQA 2R3AA 3LS8A 4EQFA 2W5YA 3L6AA 4DJAA 1E7UA 2XPYA 3OXGA 1ZKKA 3VTXA 4CGWA 1OWPA 3D9MA 3GZ1A 4GMLA 1HE8A 1A17A 1HZ4A 1VDYA 5D0OD 5JHNA 3SFZA 1WAO1 1Y6IA 2KATA 3PUKA 4JEHA 5JJ7A 1TJFA 2WXNA 4EZJA 4I6JA 4HS2A 3VTYA 4F3VA 5BUZA 3SW9A 3OXLA 2X3MA 3RAYA 2YQ8A 2KCLA 4OVVA 3CR3A 4DPRA 4KBQA 1MT6A 4J7IA 4BFRA 5CCMA 4FHKA 4Q69A 4GYWA 4A1SA 4GA1A 3ZXSA 3RRNB 3OPEA 2VGYA 2F69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G04 J;  3CKC A;  4J8O A;  4I9C A;  3LPZ A;  1ELR A;  3BEE A;  2V5F A;  4J0U A;  3URZ A;  3GZ2 A;  3DAL A;  2NC9 A;  4N2S A;  5A6C A;  1TJC A;  2OOE A;  2PZI A;  5HI7 A;  4YPE A;  4YPA A;  1NA3 A;  2I6H A;  3IEG A;  3CVP A;  4U07 A;  3LY9 A;  4WUY A;  1HH8 A;  4IJD A;  4IJ8 A;  5BT1 A;  3S7J A;  3M5A A;  1IYG A;  1N6A A;  2MHK A;  2FBN A;  1QZ2 A;  4GYY A;  3UPV A;  1O9S A;  2KCV A;  3KAE A;  4AU7 A;  1NA0 A;  3MV2 B;  4U0Z A;  5FZQ A;  3F9W A;  3CKB A;  4JA7 A;  5CPR B;  4NVQ A;  5DIZ A;  3RJW A;  2UY1 B;  3TG5 A;  3KMJ A;  5FJY A;  1XQH A;  3EDT B;  3CV0 A;  5F5E A;  2LSU A;  1N6C A;  3CK8 A;  3UUX A;  4NJ5 A;  3ASF A;  1H3I A;  4G24 A;  4WNG A;  4KYO B;  2JV0 A;  3AS4 A;  5KJM A;  4NRH B;  3QOU A;  3LYA A;  4U04 A;  4YNM A;  4QEP A;  1P5Q A;  2KC7 A;  3SZ7 A;  5T0M A;  5FZS A;  3U4T A;  1E96 B;  3ULQ A;  4N3B A;  3AS5 A;  4XI9 A;  4N3A A;  2L6J A;  4HOQ A;  4WNE A;  3PDN A;  3CK9 A;  1MVH A;  2XGS A;  4BUP A;  5FTP A;  4I2W A;  4U0U A;  5T5G A;  5LCW J;  3SWC A;  5A7D B;  3Q47 B;  3M57 A;  5LCW C;  3R9A B;  4YNP A;  4I1A A;  4WNF A;  4GPK A;  3ESK A;  1ELW A;  2IGQ A;  3U3W A;  4B94 A;  4H7X A;  4GZ6 A;  3QWW A;  2W5Z A;  3E4B A;  3M56 A;  4Z4P A;  4J83 A;  1ML9 A;  2XCC A;  1B89 A;  2R5S A;  5BW8 C;  3KMT A;  4J7F A;  1KT0 A;  3M54 A;  5JIN A;  5EX0 A;  4UQX A;  4FMU A;  3BO5 A;  3RU0 A;  1N3J A;  4QEN A;  4GZ5 A;  2QPW A;  4MI5 A;  2FF4 A;  3M55 A;  3SF4 A;  3GW4 A;  5F6L A;  2LNI A;  4C1Q A;  3IHX A;  5G04 C;  5CCL A;  5DBK A;  2HO1 A;  3N71 A;  3F9X A;  5EKQ D;  2PL2 A;  5JJT A;  4RZ0 A;  4J8E A;  3Q15 A;  4YVQ C;  4UQY A;  3FPD A;  4AY5 A;  3F9Y A;  5T0K A;  4LDG A;  5HQ8 A;  2XCB A;  3ZN3 A;  3K5K A;  4G26 A;  4UI9 K;  3OOI A;  4N5C A;  1PC2 A;  2OND A;  3EP0 A;  4JLG A;  5JIY A;  5M72 A;  3ASD A;  5LSX A;  5EX3 A;  3M58 A;  5TTF A;  2IFU A;  4G2V A;  3PE3 A;  3CVN A;  2HR2 A;  2VSY A;  2LSV A;  3CVL A;  4HOR A;  3S8P A;  4CDR A;  1YA0 A;  1ZBP A;  3Q4A B;  4G23 A;  2Q7F A;  3QDN A;  3ZPJ A;  3FP3 A;  4IN3 B;  5KJL A;  2G46 A;  1HXI A;  4XI0 A;  4BWR A;  4UQZ A;  5CHE E;  3LCA A;  4KXK B;  3MO2 A;  5G05 J;  2UWJ G;  2VQ2 A;  5D0Q D;  1NZN A;  3VV0 A;  4JDS A;  2FO7 A;  3Q5M A;  1KT1 A;  3CBO A;  1KLX A;  4UI9 J;  3OXF A;  4N2Q A;  2XGM A;  4ME2 A;  5C1D A;  3DB5 A;  2WPV A;  4GA2 A;  4I17 A;  3RO2 A;  1FCH A;  3MV3 B;  2BQZ A;  3RKV A;  2BUG A;  4N39 A;  1W3B A;  2PQR A;  3GYZ A;  3ASG A;  3RQ4 A;  5JJ0 A;  3QKY A;  4ABN A;  3QWV A;  2JLB A;  5KJK A;  4GYO A;  3NF1 A;  4O30 A;  3CBP A;  2GW1 A;  4XIF A;  3M53 A;  4I51 A;  2P58 C;  3RJV A;  2E2E A;  5F6K C;  4H7Y A;  5FZR A;  3K9I A;  5JJ6 A;  2YHC A;  1IHG A;  4RG6 A;  4YPU A;  2XPI A;  2C0L A;  4J8F A;  4LEU A;  2Y4U A;  4GCN A;  4AM9 A;  4Y6W A;  3MA5 A;  1MVX A;  3KS2 A;  2FEZ A;  2O8J A;  5TEG A;  1Y8M A;  3UQ3 A;  4BTA A;  5F59 A;  1PEG A;  4E47 A;  5AYF A;  2AVP A;  4YVO A;  3M59 A;  2Y4T A;  3CVQ A;  3TGO A;  3S7D A;  4JHR A;  4HOT A;  3RIB A;  2VGX B;  1ZU2 A;  5FT9 A;  3ASH A;  2VGX A;  4U0S A;  3FFL A;  3VUZ A;  4HOS A;  4MI0 A;  5ARF A;  4WND A;  3HNA A;  2HYZ A;  2KCK A;  3RO3 A;  1XNF A;  3HYM B;  2XGO A;  3S7B A;  2QFC A;  3CK7 A;  3KD7 A;  2FI7 A;  3MEK A;  2J9Q A;  3S7F A;  4I2Z A;  3TG4 A;  3ZGQ A;  4CGV A;  3TAX A;  4BT9 A;  3AS8 A;  5LSZ A;  2RFI A;  2IF4 A;  3MO5 A;  4BTB A;  4J8D A;  2UY1 A;  3KMA A;  5EG2 A;  4Y6C A;  2DBA A;  4G1T A;  3OS5 A;  4GZ3 A;  3LY7 A;  3ZHE B;  2WQH A;  3ZHE A;  2PQN A;  3CBM A;  4QEO A;  4JA9 A;  4GA0 A;  3ZFW A;  5G05 C;  4RG9 A;  4O6F A;  4G25 A;  1MUF A;  3QWP A;  4BT8 A;  1WM5 A;  3MKR A;  5KJN A;  4UI9 C;  3WXX A;  1OUV A;  4W9R A;  4AIF A;  3F9Z A;  3LY8 A;  2XEV A;  5TH7 A;  4H12 A;  4JL0 A;  3FWV A;  2C2L A;  4GCO A;  4NQ0 A;  4YND A;  3Q49 B;  4APO A;  3CEQ A;  5BNW A;  5ARG A;  2VSN A;  3MO0 A;  4HOU A;  3LKU A;  4N3C A;  3O48 A;  3PE4 A;  5AYW D;  1QQE A;  4I9E A;  2VYI A;  4AY6 A;  3JYS A;  2C0M A;  2R3A A;  4EQF A;  2W5Y A;  3OXG A;  1ZKK A;  3VTX A;  4CGW A;  3GZ1 A;  1A17 A;  1HZ4 A;  5D0O D;  5JHN A;  1WAO 1;  2KAT A;  5JJ7 A;  3VTY A;  4F3V A;  3SW9 A;  3OXL A;  3RAY A;  2YQ8 A;  2KCL A;  1MT6 A;  4J7I A;  4KBQ A;  5CCM A;  4GYW A;  4A1S A;  4GA1 A;  3OPE A;  2VGY A;  2F69 A; 
#chains in the Genus database with same CATH topology
 1NI1 A;  2VSO E;  1OCZ E;  3P1U A;  3LPZ A;  1WDY A;  3R9M A;  4J0U A;  4AEZ C;  5CBN A;  3B7B A;  4GPM A;  4N2S A;  1TJC A;  3PZ4 A;  3CSF A;  4CYM D;  4L7T A;  4FUL A;  2I6H A;  4AXH A;  3DPD A;  4TRQ A;  5J08 A;  4K03 A;  3I3N A;  2XS8 A;  1NP7 A;  1IQR A;  3S7J A;  4B0Z A;  1FVF A;  5CMY A;  3Q75 A;  1QZ2 A;  2KCV A;  4U0Z A;  1HF8 A;  5CPR B;  4NVQ A;  3VLD A;  4EZL A;  3TWS A;  3C3Q A;  2ETC A;  2V5Q C;  5FJY A;  1XQH A;  3QK0 A;  3TWR A;  4NJ5 A;  4G24 A;  4WNG A;  1MX2 A;  3NB2 A;  4CEM A;  3LYA A;  1HG2 A;  4QEP A;  4L1B A;  3DSX A;  4JVS A;  4A55 A;  1FVH A;  4BX9 A;  1UN9 A;  4HOQ A;  4K0R A;  3HXF A;  3U9W A;  2XGS A;  5FTP A;  1IKN D;  3HXD A;  3G2V A;  3B13 A;  2WXR A;  2R17 C;  2XRZ A;  3M57 A;  5AN8 A;  3FTZ A;  3G2S A;  4J8S A;  2R03 A;  3HRA A;  4B94 A;  4H7X A;  1N94 A;  4GZ6 A;  3ZKJ A;  2W5Z A;  1WG0 A;  4A3V A;  5C2Y A;  2XZT G;  2XCC A;  1B89 A;  2XPZ A;  4J7F A;  3EHN A;  1OWO A;  3M54 A;  2EIN E;  4FMU A;  3RU0 A;  1N9A A;  4GZD A;  3UT8 A;  4KZ0 A;  3RRU A;  3DEO A;  5EID A;  2X6J A;  2J09 A;  3IHX A;  3LEW A;  5CCL A;  2CFU A;  2WXQ A;  2MOW A;  3CHO A;  4CCA A;  3TL5 A;  1JWG A;  5JJT A;  3MX3 A;  4J8E A;  5JMN D;  4UQY A;  3ABM E;  3JQ0 A;  3T9K A;  3JCK C;  4PS8 A;  3KSQ A;  2IOS A;  5J90 A;  4UI9 K;  2OND A;  3EP0 A;  3ASD A;  4XKC A;  3M58 A;  1D8E A;  3FTX A;  4G2V A;  2BKK B;  2EQX A;  1SA5 A;  3UI2 A;  5EYL A;  3D9J A;  4B8A A;  4A63 B;  4AJW A;  3V31 A;  5FIO A;  3S8P A;  3SGH A;  4G23 A;  1SVX A;  5KJL A;  3TXN A;  3QC1 A;  4MS6 A;  3TWT A;  5ENN A;  2KM4 A;  4KXK B;  4Q94 A;  1S0P A;  2UWJ G;  4BSX A;  4DLO A;  1NL4 A;  4JDS A;  3IHY A;  3DSW A;  2IJG X;  3Q5M A;  1KT1 A;  1DC2 A;  4EZK A;  2FO1 E;  3OXF A;  4FLH A;  4ME2 A;  4K5A B;  2WPV A;  4B89 A;  3RRM B;  3SO8 A;  3JQ1 A;  2OEV A;  4HRM B;  3TWV A;  5BPP A;  2GRQ B;  2BUG A;  4JZY A;  1E90 A;  1W3B A;  3GYZ A;  3ASG A;  2AXV A;  4ANX A;  4ABN A;  3QWV A;  3FUH A;  3TXM A;  3L9T A;  3SBT B;  2XEE A;  2E2E A;  5FZR A;  4BET A;  3QJZ A;  2LXL A;  5JJ6 A;  1IHG A;  1O1R A;  5AQ7 A;  4J8F A;  3NOG D;  4LEU A;  3B95 A;  1IQU A;  2OEW A;  1LD7 A;  2WXF A;  5AJL A;  3L54 A;  4J6I A;  1H6P A;  3UQ3 A;  3ASO E;  1PEG A;  3CGH A;  2ILR A;  4YVO A;  2MYO A;  2Y4T A;  4MKT A;  2OV8 A;  4CDM A;  2R02 A;  2VGX B;  5ENP D;  2VGX A;  5FWQ A;  3JUI A;  3FFL A;  3S2A A;  4MI0 A;  3SD5 A;  4WND A;  4JHJ A;  4EPZ A;  1KZO A;  4DX2 A;  4JEU A;  3CVY A;  1V55 E;  4RVB A;  2WXK A;  4MRU A;  5EYP F;  3PZ1 A;  4NUR A;  3KD7 A;  3DXK G;  3S7F A;  4I2Z A;  3EU5 A;  2XHE A;  4CGV A;  1V54 E;  3AG4 E;  4ATZ D;  3AS8 A;  1Q2Z A;  2RFI A;  3PNL B;  2CHZ A;  5HKP A;  4DX1 A;  2FUL A;  2WMO A;  1JUQ A;  5KNH D;  2UY1 A;  3KMA A;  5EG2 A;  4Y6C A;  4O60 A;  4LER A;  3LY7 A;  2WXL A;  4OVU A;  4UWH A;  3NZU A;  3CBM A;  3HXB A;  1N0Q A;  4O6F A;  4U7E B;  3UX4 A;  4F1S A;  5KNG A;  4PS7 A;  3ESL A;  1WM5 A;  4UI9 C;  3R7R A;  2I2O A;  3F9Z A;  3LY8 A;  4LG6 A;  2GRO B;  4H12 A;  4JL0 A;  3FWV A;  4NQ0 A;  4X8Q A;  3G2W A;  1K8K G;  2VSN A;  4FJZ A;  2DZN A;  3LKU A;  4N3C A;  3PE4 A;  4G8L A;  4HI8 A;  5EN5 D;  4I9E A;  4U8H A;  2VYI A;  4F7A A;  3JYS A;  1D8D A;  5FIN A;  1ZKK A;  4CGW A;  4ZHB A;  1A17 A;  4HQD A;  5JHN A;  2BED A;  1Y6I A;  1TJF A;  3DSS A;  1MT6 A;  4FHK A;  4Q69 A;  3ZXS A;  3RRN B;  3OPE A;  3LVR E;  2J49 A;  3E34 A;  1Z6T A;  4I9C A;  1ELR A;  3BEE A;  2V5F A;  3AJI A;  3PZ2 A;  3GZ2 A;  5D2M C;  3V79 K;  2NC9 A;  3UXG A;  5A6C A;  3DWL G;  3TWU A;  2VGE A;  2OOE A;  5HI7 A;  1AWC B;  4HXI A;  3HXC A;  1BLX B;  1HG5 A;  2X38 A;  3NAW A;  4IJD A;  4IJ8 A;  5BT1 A;  3ULY A;  1N4R A;  3BG0 B;  3SY2 A;  2FBN A;  2PNN A;  4K5B A;  1QBQ A;  4GTV A;  1O9S A;  3KAE A;  5CEC B;  4AU7 A;  3MV2 B;  5FZQ A;  4I6G A;  3UIO C;  3CKB A;  3CHP A;  3RJW A;  2L9B A;  3PRE A;  4EBA G;  3UUX A;  5AQB A;  2WM9 A;  4RLY A;  4R7L A;  1D9S A;  4NRH B;  3IV0 A;  2I9C A;  3QOU A;  4YNM A;  2KC7 A;  4GTS A;  1ELK A;  1YYH A;  3C98 A;  2AXU A;  1E96 B;  2WXG A;  3ULQ A;  1HO8 A;  3EIJ A;  3TWW A;  5ENT D;  4XI9 A;  4N3A A;  4O1P A;  2LXM A;  3CK9 A;  4F1P A;  4U0U A;  2KZT B;  3D9K A;  3ISM C;  2IQC A;  5LCW J;  3UT7 A;  2KZT A;  2YNQ A;  3JXJ A;  3R9A B;  3FU3 A;  4I1A A;  4WNF A;  4GPK A;  2VJ8 A;  4PS3 A;  1UOH A;  1ELW A;  1DNP A;  3FHE A;  3FEY A;  2A4Z A;  5CRU A;  3M56 A;  2XZD G;  1JCR A;  5CRV A;  1ML9 A;  1Z5S C;  4J83 A;  2R5S A;  3APF A;  5EDS A;  5JIN A;  1JCQ A;  2RG8 A;  1DVP A;  5EX0 A;  4ILI A;  3EHQ A;  3EUV A;  5ENS D;  2FF4 A;  2LAH A;  4G11 A;  5F6L A;  5G04 C;  2WMN A;  1N4Q A;  4O1O A;  5CER B;  3PRZ A;  3ENE A;  4UWL A;  4XZ4 A;  4RZ0 A;  4C0M A;  3Q15 A;  4YVQ C;  4DUI A;  2F8X K;  5T0K A;  2XCB A;  4UUC A;  3VLE A;  3CVW A;  4E85 A;  4HLL A;  3ZYK A;  1UW4 B;  4N5C A;  1SA4 A;  1PC2 A;  5AQ9 A;  3AU4 A;  1OWM A;  4JLG A;  1FT2 A;  1HU3 A;  5LSX A;  1XGW A;  3ABK E;  2IFU A;  3FUI A;  3CVN A;  1BPO A;  2P9N G;  4M3O A;  4IUL A;  3HVE B;  2P9P G;  4WWO A;  3KSL A;  4U63 A;  3HVE A;  3HXE A;  3EHM A;  4HOR A;  1YA0 A;  4FJY A;  3V2O A;  3Q4A B;  3QDN A;  5AIJ A;  3LVQ E;  3EU9 A;  1MQS A;  4XX5 A;  5CHE E;  3FH8 A;  3LCA A;  3MO2 A;  2VQ2 A;  5LP0 A;  5D0Q D;  1NZN A;  3VV0 A;  3D9I A;  2J08 A;  4RSY A;  4BES A;  1K1A A;  3CBO A;  1KLX A;  2GRR B;  4N2Q A;  3DB5 A;  3MCX A;  4NAC A;  4HBD A;  3NQP A;  1FCH A;  1BI8 B;  1U3D A;  4KVM A;  2ZXW E;  3MV3 B;  3APD A;  3FU6 A;  3RKV A;  2J8S D;  5ANR A;  3RQ4 A;  5JJ0 A;  2JLB A;  3BQO A;  5KJK A;  3NF1 A;  3CBP A;  3ZYQ A;  4I51 A;  3R7Q A;  1EPU A;  5D66 A;  2XPI A;  2WXP A;  3WG7 E;  3UM0 A;  3KS2 A;  3C72 A;  2PM6 A;  2GRL A;  5TEG A;  5T8I A;  3LJN A;  4ANU A;  1JCS A;  1HX8 A;  1TNY A;  5AYF A;  5AQA A;  3JXI A;  3DXM G;  3Q79 A;  4ANV A;  1INZ A;  1U3C A;  3CVQ A;  4HVB A;  4JW1 A;  2AWI A;  1UJK A;  3ASH A;  2JEK A;  4GAA A;  5EIL A;  4U0S A;  3FDH A;  4TXR A;  2GRN B;  2ETB A;  2KCK A;  2GRP B;  3PVL A;  5EIB E;  4QQI A;  3Q78 A;  2F8Y A;  1XNF A;  2QYJ A;  3CK7 A;  4HNA D;  1OY3 D;  3FUE A;  1H2T C;  2YHE A;  1FPP A;  1H0A A;  4XE0 A;  3ZGQ A;  4BER A;  4FLB A;  1KPS B;  3J5Q B;  5LSZ A;  3JUE A;  4BEP A;  4BTB A;  4J8D A;  1K1B A;  3PEV B;  3O4Z A;  3Q7A A;  3ONK A;  2DBA A;  4G1T A;  3Q9N C;  3OS5 A;  4GZC A;  3ZFW A;  3C3R A;  5G05 C;  2RKK A;  4L23 A;  4RG9 A;  4DLQ A;  4G25 A;  1MUF A;  3QWP A;  4UWK A;  1EF1 C;  3WXX A;  1OUV A;  2OCC E;  4U8Y D;  2X6I A;  4A1G A;  5TH7 A;  2XEH A;  4KZC A;  1PY1 A;  5AAR A;  3MGB A;  2PM7 A;  1MZC A;  5BNW A;  5ARG A;  2H6G A;  4TV3 A;  4MBG A;  2QYU A;  3O48 A;  4JPS A;  3FTY A;  4TUM A;  1WY6 A;  4LUN U;  2CG2 A;  1N4S A;  5CEA A;  4OAU C;  2AJA A;  3QAQ A;  2W5Y A;  3OXG A;  2IO2 C;  1LD8 A;  1OWP A;  3GZ1 A;  4GML A;  3C5R A;  4DRX E;  3SFZ A;  2KAT A;  5JJ7 A;  1U2V G;  2WXN A;  3BU8 A;  4EZJ A;  4I6J A;  3SW9 A;  2V4H C;  2YQ8 A;  2R2L A;  4DPR A;  4J7I A;  4BFR A;  5CCM A;  3EHR A;  2VGY A;  3CKC A;  3UT4 A;  3ZVV A;  4J8O A;  3RK6 A;  3Q73 A;  3URZ A;  1A5E A;  3D9P A;  4GTP A;  2XQ0 A;  4JHK A;  4PH4 B;  5T3R A;  4YPA A;  1NA3 A;  2J4B A;  3ZW3 A;  3CVP A;  2A5E A;  3LY9 A;  4WUY A;  3E30 A;  3UIP C;  3L22 A;  5AAO A;  2CHX A;  3SQV A;  1N6A A;  5CED B;  1QYM A;  2HE0 A;  3ML8 A;  4GYY A;  3UPV A;  2IO3 C;  4DI4 A;  4GMJ A;  4DK5 A;  4JA7 A;  2P9L G;  4Q96 A;  2UY1 B;  3TG5 A;  5FQ4 A;  1MJ0 A;  3CV0 A;  5F5E A;  2LSU A;  1N6C A;  1UG3 A;  1TR4 A;  3ASF A;  2JV0 A;  3AS4 A;  1G3N B;  1E7V A;  4P29 A;  3DBS A;  1P5Q A;  5FZS A;  4OYS A;  4N3B A;  1NFI E;  5JA4 D;  2L6J A;  3PDN A;  5B1A E;  5B1B E;  3ULE G;  3T8K A;  1H6K A;  1MX6 A;  3FUM A;  5A7D B;  3Q47 B;  5LCW C;  4YNP A;  1TNB A;  4L2L A;  3HIZ A;  3SFY A;  2IGQ A;  3U64 A;  4OAV B;  2HM8 A;  3D9N A;  1H2U A;  5KBA A;  3U3W A;  2I1J A;  4LCT A;  4GTO A;  1X5B A;  1Z3X A;  5BV0 A;  2I1K A;  4Z4P A;  3GZS A;  3I4R B;  5BW8 C;  1SZA A;  1N11 A;  1MHQ A;  3KMT A;  2H6H A;  1KT0 A;  2CG3 A;  3B7S A;  2H6I A;  4GZ5 A;  2AW6 A;  3FTS A;  3CVU A;  1N0R A;  2LNI A;  2GGF A;  2NYJ A;  3MZL B;  3FH7 A;  5AJD A;  5FQ6 A;  3IBE A;  4N5Q A;  1SZ9 A;  4LDG A;  5HQ8 A;  3ZN3 A;  3AG2 E;  3J5P A;  3D9O A;  3K5K A;  3Q9U C;  3LXU X;  5H7P A;  4G26 A;  3FUF A;  4HRL A;  5BV1 A;  4L2Y A;  4RQI A;  4PUC A;  4FHJ A;  1TNO A;  1LF8 A;  5M72 A;  2AXZ A;  1LTX A;  3PUJ A;  5EX3 A;  5BXU A;  1H6O A;  3PEU B;  2HR2 A;  2VSY A;  2A5U A;  4KMO A;  2GRM A;  2P9S G;  2RFA A;  1RZ4 A;  4GTT A;  3HDX A;  3PZD A;  2LSV A;  4A3T A;  2ZGG A;  4B93 B;  1ZBP A;  4HFG A;  2WXJ A;  3IHV A;  3FUN A;  2Q7F A;  3ZPJ A;  3FP3 A;  4IN3 B;  3CHM A;  1TN7 A;  2CFZ A;  4ACK A;  3FTW A;  4UQZ A;  2KXP C;  3G2T A;  4AV7 A;  2Y0B G;  4LNB A;  3DRA A;  3CQG B;  3QAR A;  4UWF A;  4AVX A;  3W9F A;  4YDY A;  4I43 A;  3FUL A;  4UI9 J;  1TNZ A;  4ILG A;  2IY0 C;  2IEJ A;  5C1D A;  4AP2 A;  3ZEF A;  2DIW A;  4GTM A;  3T5X A;  1SQM A;  4I17 A;  3RO2 A;  2QY7 A;  3CHS A;  4LRZ A;  3SBS A;  3MYV A;  4JC8 A;  2PQR A;  2L0T B;  3QKY A;  4GYO A;  2WVI A;  2XRY A;  2GW1 A;  4XIF A;  3M53 A;  5F6K C;  3FTV A;  2WQ6 A;  3LJ3 A;  4J7W A;  2YHC A;  1MYO A;  3SI5 A;  4RG6 A;  4HRN A;  4YPU A;  4URK A;  2C0L A;  1ZB1 A;  4KVO A;  2L0I A;  2BKG A;  2ETA A;  4GCN A;  3HHM A;  2CHW A;  3V30 A;  4AM9 A;  2KBX A;  5JHA A;  3MA5 A;  2B0O E;  1MVX A;  2FEZ A;  2O8J A;  4CRW A;  1Y8M A;  1H19 A;  3DEP A;  3ZXP A;  1EDU A;  3OTN A;  4E6H A;  3CVV A;  3ZIM A;  2QC9 A;  3UM2 A;  3TGO A;  2IU1 A;  2X6H A;  3S7D A;  4HOT A;  2BTD A;  3RIB A;  1ZU2 A;  5HRY A;  1FT1 A;  4KT6 B;  4FC8 A;  3W9G A;  4HOS A;  2DZO A;  3ZRH A;  3HYM B;  2WXM A;  2XGO A;  1OCO E;  3CHR A;  1RW2 A;  4HB5 A;  2WB2 A;  4J8Y A;  2FI7 A;  3MEK A;  2EIL E;  2R59 A;  3QB2 A;  1O1T A;  4B8C B;  2DYS E;  3TAX A;  1GW6 A;  3DPY A;  1MX4 A;  4JB8 P;  2V8S E;  1IXV A;  3AAA C;  5G55 A;  3X2Q E;  3FUJ A;  3NZS A;  2IF4 A;  3MO5 A;  2Y3A A;  3OAW A;  4FP7 A;  5LX8 A;  5FQ7 A;  4GZ3 A;  3SHF A;  3CIA A;  2WQH A;  5LOZ A;  2B6C A;  3U66 A;  1E8Y A;  4HI9 A;  3NOC D;  3MKR A;  2EIK E;  4CDN A;  2X6K A;  4CT0 A;  1OCR E;  2XEV A;  4JD2 G;  3AG1 E;  3L08 A;  4FA6 A;  3MO0 A;  4HOU A;  3CHQ A;  4HLE A;  1QQE A;  4FAD A;  1TN8 A;  2X6F A;  4AY6 A;  2Y1L E;  2R3A A;  3LS8 A;  4EQF A;  1E7U A;  2XPY A;  3VTX A;  1HE8 A;  1HZ4 A;  1VDY A;  5D0O D;  2JAB A;  3DSU A;  4G8K A;  4JEH A;  4DX6 D;  4F3V A;  3D9H A;  2DYR E;  1TNU A;  3OXL A;  3RAY A;  4OVV A;  3CR3 A;  4GA1 A;  2ZGD A;  5G04 J;  2RFM A;  1QNF A;  1DCE A;  2J4D A;  1O1S A;  1BI7 B;  4F6R D;  4LNU D;  3ZUV B;  5KCM A;  2V0P A;  4ZFH A;  3DAL A;  3FUD A;  1O5M A;  5CMW A;  2PZI A;  4YPE A;  3IEG A;  3CQC B;  4U07 A;  1HH8 A;  1N4P A;  3ML9 A;  3VLF A;  1HS6 A;  3QNK A;  3M5A A;  1IYG A;  2H6F A;  2MHK A;  5E76 A;  3ZU7 B;  1N95 A;  1S64 A;  2LAI A;  2MRI A;  1NA0 A;  3F9W A;  5E75 A;  4PDX A;  5DIZ A;  1OWL A;  1HFA A;  4M7C A;  2WXI A;  3KMJ A;  3AU5 A;  3EDT B;  3Q7F A;  3CK8 A;  1H3I A;  2ION A;  4KYO B;  5KJM A;  2QZA A;  4U04 A;  4YDE A;  2R05 A;  4NIK A;  3SZ7 A;  4JXT A;  5T0M A;  3U4T A;  3I5P A;  2IOL A;  3FEX A;  3B7U X;  3AS5 A;  1JPL A;  4DX5 D;  2LUH A;  2ZIR A;  4WNE A;  1MVH A;  4BUP A;  1E8X A;  4I2W A;  5IY5 E;  4DX7 D;  2VTB B;  3ONL A;  5T5G A;  3SWC A;  2VTB A;  2V4L A;  5ENO D;  4QFV A;  3ABL E;  3ESK A;  4LSZ E;  2L6B A;  3QWW A;  1JWF A;  1OXJ A;  4F53 A;  4ATG A;  4MLP A;  3E4B A;  3TJP A;  2XS1 A;  4C48 B;  4AOF A;  3L17 A;  2J07 A;  2WXH A;  1BD8 A;  1N54 A;  2WQ7 A;  3NBN B;  1KZP A;  1E8Z A;  4UQX A;  3BO5 A;  3I4G A;  1N3J A;  4QEN A;  2QPW A;  4MI5 A;  3M55 A;  3SF4 A;  3GW4 A;  2NXP A;  4C1Q A;  3FTU A;  1IHB A;  1OCC E;  5DBK A;  2HO1 A;  3N71 A;  3F9X A;  3FU0 A;  5G2N A;  5EKQ D;  1H2V C;  2PL2 A;  3FY4 A;  4EHM A;  3CST A;  4V3I A;  3FPD A;  4AY5 A;  3F9Y A;  4EBA A;  1UJJ A;  1L5J A;  3DSV A;  3V2X A;  5CBO A;  3TWX A;  2P9K G;  3OOI A;  3D9L A;  4C0E A;  1PAQ A;  2RD0 A;  2OVF A;  4K5C A;  5JIY A;  4GB9 A;  4ILH B;  5T4Y A;  1SW6 A;  3APC A;  5TTF A;  3IKO B;  3PE3 A;  3UMV A;  2LO6 A;  3KEZ A;  2M63 A;  2VSX E;  4L9P A;  3CVL A;  5KWD A;  1TN6 A;  4CDR A;  1K3Z D;  4UWG A;  2ZU6 B;  3PH0 C;  3UM1 A;  3L82 A;  2EIM E;  5ANL A;  4BY6 A;  4WAF A;  5ITZ F;  2G46 A;  1HXI A;  1X81 A;  4XI0 A;  4EEC A;  4BWR A;  4ACL A;  5G05 J;  5JHB A;  4IRU A;  1Z3Y A;  2FO7 A;  3E37 A;  1S70 B;  3AG3 E;  4D10 C;  3CLJ A;  4ANW A;  4GMR A;  2XGM A;  3UM3 A;  1OWN A;  3B7R L;  4GA2 A;  3UTM A;  3UKR G;  5AEN A;  2EIJ E;  3KEA A;  2Y69 E;  2BQZ A;  2BF0 X;  4N39 A;  5HS0 A;  4GTR A;  4FU3 A;  3BUA A;  4O30 A;  4U8V D;  2DCP A;  3PS6 A;  3E33 A;  4DI3 A;  2P58 C;  3ASN E;  3RJV A;  4H7Y A;  3K9I A;  4WWP A;  3ZYL A;  3BG1 B;  2NSZ A;  4U96 D;  1DCQ A;  2Y4U A;  4TXQ A;  4YDO A;  4BSZ B;  4Y6W A;  4CT4 A;  3IXE A;  3EIQ C;  1S63 A;  1E8W A;  4BTA A;  2OVB A;  5F59 A;  4XKB A;  2E0I A;  4E47 A;  3EJN A;  5BXO A;  2YIN A;  4U95 D;  2AVP A;  5ENQ D;  3M59 A;  4LNG A;  3FH5 A;  4JHR A;  3PNT B;  5FQ8 A;  5FT9 A;  4BX8 A;  1EYH A;  3VUZ A;  5ARF A;  3FUK A;  3HNA A;  3B7T A;  2HYZ A;  3RO3 A;  1OT8 A;  4TXP A;  3S7B A;  2QFC A;  3MJW A;  4APF A;  4WWN A;  3T8M A;  3DST A;  2F0Y A;  3ZNG A;  3E32 A;  1N52 A;  2J9Q A;  3MKQ B;  3MKQ A;  4Z68 A;  1YMP A;  3TG4 A;  4TUU A;  2WXO A;  3C3O A;  3L13 A;  5A23 A;  4I1O B;  4BT9 A;  3G2U A;  3T5V A;  1TEZ A;  3ZYM A;  3CVX A;  5LFA A;  4C9B B;  3ZHE B;  2P9I G;  3ZHE A;  2PQN A;  4QEO A;  4JA9 A;  4GA0 A;  3UKU G;  2XEN A;  4YDW A;  4I1M A;  2F37 A;  2P9U G;  1AP7 A;  4BT8 A;  5KJN A;  3FU5 A;  3PZ3 A;  4W9R A;  3RAU A;  4AIF A;  4GTQ A;  4I6E A;  4XEI G;  2P2C P;  3L16 A;  3SNX A;  3LDZ A;  2C2L A;  4GCO A;  4GU5 A;  4YND A;  5B3S E;  1YCS B;  3Q49 B;  4APO A;  3D3M A;  3CEQ A;  3TWQ A;  2ZIS A;  3SFX A;  5AYW D;  1UN8 A;  4IYP A;  3P2B A;  2C0M A;  3UIN C;  3L6A A;  4DJA A;  3D9M A;  3RSE G;  5ENR D;  3F6Q A;  1TYQ G;  1WAO 1;  3PUK A;  2DWZ A;  4HS2 A;  3VTY A;  5BUZ A;  2X3M A;  4CZ2 D;  2KCL A;  2DVW A;  1BU9 A;  4KBQ A;  4GYW A;  4A1S A;  3HG0 D;  2F69 A; 
#chains in the Genus database with same CATH homology
 5G04 J;  3LVR E;  2J49 A;  3CKC A;  3UT4 A;  3ZVV A;  1QNF A;  2VSO E;  1Z6T A;  4J8O A;  2J4D A;  3P1U A;  4I9C A;  3LPZ A;  1ELR A;  3BEE A;  2V5F A;  4J0U A;  4AEZ C;  5KCM A;  3RK6 A;  2V0P A;  3URZ A;  3GZ2 A;  3DAL A;  2NC9 A;  3FUD A;  5A6C A;  4N2S A;  1TJC A;  3CSF A;  3D9P A;  5CMW A;  4L7T A;  2OOE A;  2PZI A;  2XQ0 A;  5HI7 A;  4JHK A;  4PH4 B;  4FUL A;  5T3R A;  4YPA A;  4YPE A;  1NA3 A;  2I6H A;  4HXI A;  2J4B A;  4AXH A;  1HG5 A;  3DPD A;  3CQC B;  3IEG A;  3ZW3 A;  3CVP A;  4TRQ A;  4U07 A;  3LY9 A;  4WUY A;  5J08 A;  1HH8 A;  2X38 A;  3I3N A;  4K03 A;  4IJD A;  3L22 A;  1NP7 A;  3ML9 A;  3VLF A;  4IJ8 A;  5BT1 A;  1IQR A;  1HS6 A;  3S7J A;  4B0Z A;  3QNK A;  2CHX A;  3M5A A;  1IYG A;  1FVF A;  2MHK A;  1N6A A;  3BG0 B;  5CMY A;  5E76 A;  2FBN A;  3ML8 A;  1QZ2 A;  4GYY A;  2MRI A;  2LAI A;  3UPV A;  1O9S A;  2KCV A;  3KAE A;  4AU7 A;  4DI4 A;  1NA0 A;  3MV2 B;  4U0Z A;  5FZQ A;  1HF8 A;  4I6G A;  3F9W A;  3CKB A;  3CHP A;  4GMJ A;  4JA7 A;  5E75 A;  4DK5 A;  2BQZ A;  4PDX A;  3VLD A;  4NVQ A;  5DIZ A;  4Q96 A;  1OWL A;  4EZL A;  1HFA A;  3RJW A;  2UY1 B;  2WXI A;  3TG5 A;  3KMJ A;  5FQ4 A;  5FJY A;  1XQH A;  2L9B A;  3QK0 A;  3AU5 A;  3PRE A;  3EDT B;  3CV0 A;  5F5E A;  4EBA G;  2LSU A;  1N6C A;  1UG3 A;  3CK8 A;  3UUX A;  4NJ5 A;  2WM9 A;  3ASF A;  1H3I A;  2ION A;  4G24 A;  4WNG A;  4R7L A;  4KYO B;  2JV0 A;  3AS4 A;  5KJM A;  4NRH B;  3IV0 A;  2I9C A;  4CEM A;  3QOU A;  3LYA A;  1E7V A;  4U04 A;  4P29 A;  1HG2 A;  3DBS A;  4YNM A;  1P5Q A;  4QEP A;  2KC7 A;  1ELK A;  3SZ7 A;  4L1B A;  4JXT A;  5T0M A;  3C98 A;  5FZS A;  4JVS A;  4OYS A;  3U4T A;  2AXU A;  3I5P A;  1E96 B;  4A55 A;  2WXG A;  3ULQ A;  4N3B A;  2IOL A;  1FVH A;  3FEX A;  3B7U X;  1HO8 A;  3AS5 A;  3EIJ A;  1JPL A;  4BX9 A;  1UN9 A;  4N3A A;  4XI9 A;  2L6J A;  4HOQ A;  4WNE A;  4K0R A;  3PDN A;  3CK9 A;  1MVH A;  3U9W A;  2XGS A;  4BUP A;  1E8X A;  5FTP A;  4I2W A;  1H6K A;  3G2V A;  4U0U A;  3ONL A;  3B13 A;  2KZT B;  3D9K A;  2VTB B;  5T5G A;  2IQC A;  5LCW J;  3SWC A;  2VTB A;  3UT7 A;  2KZT A;  3FUM A;  2WXR A;  2YNQ A;  5A7D B;  2R17 C;  2XRZ A;  3Q47 B;  2V4L A;  5LCW C;  3R9A B;  3M57 A;  4YNP A;  4QFV A;  3FU3 A;  4I1A A;  4L2L A;  4WNF A;  4GPK A;  3FTZ A;  2VJ8 A;  3G2S A;  4J8S A;  4PS3 A;  3ESK A;  3HIZ A;  1ELW A;  2IGQ A;  1DNP A;  3U64 A;  2HM8 A;  3D9N A;  1H2U A;  3FHE A;  4B94 A;  4H7X A;  2I1J A;  3U3W A;  3FEY A;  4GZ6 A;  3QWW A;  1JWF A;  2W5Z A;  4LCT A;  4F53 A;  4ATG A;  4MLP A;  3E4B A;  1X5B A;  1Z3X A;  2A4Z A;  4A3V A;  5BV0 A;  3M56 A;  5C2Y A;  3TJP A;  2I1K A;  4Z4P A;  4J83 A;  1ML9 A;  3GZS A;  2XCC A;  3I4R B;  1B89 A;  2R5S A;  3L17 A;  5BW8 C;  4AOF A;  1SZA A;  2XPZ A;  2J07 A;  2WXH A;  3APF A;  1MHQ A;  3KMT A;  4J7F A;  1N54 A;  3EHN A;  1KT0 A;  1OWO A;  3M54 A;  5EDS A;  2WQ7 A;  5JIN A;  2CG3 A;  2RG8 A;  1DVP A;  3B7S A;  1E8Z A;  4UQX A;  5EX0 A;  4FMU A;  4ILI A;  3RU0 A;  3BO5 A;  3I4G A;  1N3J A;  4QEN A;  4GZD A;  2AW6 A;  4GZ5 A;  3UT8 A;  4KZ0 A;  2QPW A;  4MI5 A;  2FF4 A;  2LAH A;  3RRU A;  3M55 A;  4G11 A;  3FTS A;  3GW4 A;  3SF4 A;  5F6L A;  2X6J A;  3CVU A;  2NXP A;  2LNI A;  2J09 A;  2GGF A;  4C1Q A;  3IHX A;  3FTU A;  5G04 C;  2WMN A;  3LEW A;  3MZL B;  5CCL A;  5DBK A;  2HO1 A;  3N71 A;  2CFU A;  2WXQ A;  3F9X A;  2MOW A;  3FU0 A;  3CHO A;  5G2N A;  4CCA A;  3TL5 A;  1JWG A;  1H2V C;  3FH7 A;  2PL2 A;  3PRZ A;  5EKQ D;  3ENE A;  3FY4 A;  4UWL A;  4XZ4 A;  5JJT A;  3MX3 A;  4J8E A;  4C0M A;  4RZ0 A;  5AJD A;  5FQ6 A;  3CST A;  3Q15 A;  4V3I A;  4UQY A;  4YVQ C;  3IBE A;  3FPD A;  4AY5 A;  3JQ0 A;  1SZ9 A;  3F9Y A;  4EBA A;  1UJJ A;  4LDG A;  5HQ8 A;  2XCB A;  5T0K A;  1L5J A;  3ZN3 A;  3JCK C;  3D9O A;  4PS8 A;  3K5K A;  3VLE A;  3CVW A;  3LXU X;  4E85 A;  3ZYK A;  1UW4 B;  2IOS A;  5J90 A;  4G26 A;  4UI9 K;  3FUF A;  3OOI A;  4N5C A;  3D9L A;  5BV1 A;  1PC2 A;  4C0E A;  2OND A;  4L2Y A;  3AU4 A;  4PUC A;  3EP0 A;  1PAQ A;  1OWM A;  2RD0 A;  2OVF A;  4JLG A;  4FHJ A;  5JIY A;  4GB9 A;  4ILH B;  1HU3 A;  5T4Y A;  1LF8 A;  5M72 A;  2AXZ A;  3ASD A;  3APC A;  3PUJ A;  4XKC A;  1XGW A;  5EX3 A;  3M58 A;  5LSX A;  5TTF A;  2IFU A;  3FUI A;  3IKO B;  4G2V A;  3FTX A;  3PE3 A;  3CVN A;  2HR2 A;  2VSY A;  2A5U A;  2LO6 A;  1BPO A;  3PEU B;  4KMO A;  2EQX A;  3UMV A;  4M3O A;  4IUL A;  2GRM A;  3HVE B;  3KEZ A;  4WWO A;  2M63 A;  4U63 A;  3D9J A;  3HVE A;  4B8A A;  2VSX E;  3HDX A;  4AJW A;  3PZD A;  2LSV A;  3CVL A;  4A3T A;  3EHM A;  4HOR A;  3S8P A;  4CDR A;  1YA0 A;  1ZBP A;  4FJY A;  4HFG A;  4UWG A;  2ZU6 B;  3SGH A;  3PH0 C;  2WXJ A;  3IHV A;  3FUN A;  3Q4A B;  2Q7F A;  3QDN A;  4G23 A;  3LVQ E;  3FP3 A;  3ZPJ A;  5AIJ A;  4IN3 B;  5ANL A;  5KJL A;  3CHM A;  3TXN A;  4BY6 A;  4WAF A;  2G46 A;  3QC1 A;  1HXI A;  4MS6 A;  1MQS A;  4XI0 A;  4XX5 A;  4EEC A;  4BWR A;  5ENN A;  2CFZ A;  4ACK A;  2KM4 A;  3FTW A;  4UQZ A;  5CHE E;  3FH8 A;  3LCA A;  4KXK B;  4ACL A;  3G2T A;  4AV7 A;  4Q94 A;  3MO2 A;  5G05 J;  5JHB A;  1S0P A;  2UWJ G;  2VQ2 A;  4IRU A;  4BSX A;  5LP0 A;  1Z3Y A;  3CQG B;  1NZN A;  5D0Q D;  4DLO A;  3VV0 A;  3QAR A;  4JDS A;  4UWF A;  3D9I A;  2J08 A;  3IHY A;  4RSY A;  4AVX A;  2FO7 A;  2IJG X;  3Q5M A;  1KT1 A;  3CBO A;  4I43 A;  1KLX A;  4EZK A;  3FUL A;  4D10 C;  4UI9 J;  3OXF A;  3CLJ A;  4ANW A;  4ILG A;  4N2Q A;  2XGM A;  4FLH A;  4ME2 A;  5C1D A;  4AP2 A;  1OWN A;  3DB5 A;  3B7R L;  3MCX A;  2DIW A;  2WPV A;  4GA2 A;  4NAC A;  3NQP A;  3T5X A;  3ZEF A;  1SQM A;  3RRM B;  4B89 A;  4I17 A;  3RO2 A;  1FCH A;  3JQ1 A;  5AEN A;  1U3D A;  4KVM A;  5BPP A;  3MV3 B;  3APD A;  2QY7 A;  3FU6 A;  2BUG A;  3CHS A;  5ANR A;  2BF0 X;  4LRZ A;  4JZY A;  3RKV A;  3SBS A;  3MYV A;  4N39 A;  4JC8 A;  1E90 A;  1W3B A;  2PQR A;  3GYZ A;  2L0T B;  3ASG A;  3RQ4 A;  5JJ0 A;  2AXV A;  4ANX A;  3QKY A;  4ABN A;  3QWV A;  4FU3 A;  2JLB A;  3FUH A;  3TXM A;  5KJK A;  4GYO A;  3NF1 A;  4O30 A;  3CBP A;  3ZYQ A;  2WVI A;  2DCP A;  2XRY A;  3SBT B;  2GW1 A;  3PS6 A;  4XIF A;  4DI3 A;  3M53 A;  4I51 A;  3R7Q A;  2P58 C;  3RJV A;  2E2E A;  5F6K C;  4H7Y A;  3FTV A;  2WQ6 A;  5FZR A;  3K9I A;  4WWP A;  1EPU A;  3ZYL A;  3BG1 B;  3LJ3 A;  3QJZ A;  2YHC A;  5JJ6 A;  1IHG A;  2NSZ A;  4RG6 A;  3SI5 A;  4YPU A;  4URK A;  2XPI A;  2C0L A;  2WXP A;  4KVO A;  2L0I A;  4J8F A;  4LEU A;  2Y4U A;  4GCN A;  3HHM A;  2CHW A;  4AM9 A;  1IQU A;  4Y6W A;  5JHA A;  3MA5 A;  1MVX A;  3KS2 A;  4CT4 A;  2FEZ A;  2O8J A;  2PM6 A;  2GRL A;  5TEG A;  5T8I A;  4CRW A;  1Y8M A;  2WXF A;  3EIQ C;  5AJL A;  1H19 A;  3L54 A;  1E8W A;  4J6I A;  3UQ3 A;  4BTA A;  2OVB A;  5F59 A;  4XKB A;  2E0I A;  1PEG A;  4E47 A;  4ANU A;  1HX8 A;  3EJN A;  5AYF A;  3CGH A;  2YIN A;  2ILR A;  2AVP A;  4ANV A;  1EDU A;  3OTN A;  4YVO A;  4E6H A;  3ZIM A;  3CVV A;  1INZ A;  3M59 A;  1U3C A;  3FH5 A;  2Y4T A;  3CVQ A;  4HVB A;  2IU1 A;  4JW1 A;  3TGO A;  2X6H A;  2OV8 A;  4JHR A;  4MKT A;  2BTD A;  3PNT B;  5FQ8 A;  3S7D A;  4CDM A;  3RIB A;  2AWI A;  4HOT A;  2VGX B;  1ZU2 A;  1UJK A;  3ASH A;  5FT9 A;  2JEK A;  2VGX A;  4GAA A;  4BX8 A;  5FWQ A;  3JUI A;  4KT6 B;  3FDH A;  4U0S A;  1EYH A;  3FFL A;  3S2A A;  3VUZ A;  4FC8 A;  4HOS A;  4MI0 A;  5ARF A;  3FUK A;  3SD5 A;  4WND A;  3B7T A;  2HYZ A;  2KCK A;  3PVL A;  4JHJ A;  3RO3 A;  4EPZ A;  3HNA A;  3ZRH A;  4JEU A;  3CVY A;  1XNF A;  3HYM B;  2WXM A;  2XGO A;  4RVB A;  3CHR A;  3S7B A;  2WXK A;  2QFC A;  3CK7 A;  2WB2 A;  3MJW A;  4MRU A;  4APF A;  4WWN A;  3T8M A;  4NUR A;  3KD7 A;  3FUE A;  1H2T C;  2FI7 A;  2YHE A;  3MEK A;  1N52 A;  2J9Q A;  3MKQ B;  2R59 A;  3S7F A;  3MKQ A;  4I2Z A;  1H0A A;  3QB2 A;  4XE0 A;  3TG4 A;  2XHE A;  4TUU A;  3ZGQ A;  2WXO A;  4CGV A;  4B8C B;  3L13 A;  3TAX A;  4I1O B;  5A23 A;  1GW6 A;  4FLB A;  4BT9 A;  2V8S E;  3AS8 A;  5G55 A;  3G2U A;  5LSZ A;  2RFI A;  3FUJ A;  3PNL B;  3NZS A;  5CPR B;  2CHZ A;  2IF4 A;  2FUL A;  3MO5 A;  2WMO A;  4BTB A;  2Y3A A;  1JUQ A;  3T5V A;  4J8D A;  1TEZ A;  3ZYM A;  3PEV B;  3OAW A;  2UY1 A;  3KMA A;  5EG2 A;  3CVX A;  3O4Z A;  4FP7 A;  4Y6C A;  3ONK A;  2DBA A;  4G1T A;  4LER A;  5LX8 A;  3OS5 A;  5FQ7 A;  5LFA A;  4GZ3 A;  3SHF A;  3LY7 A;  2WXL A;  4OVU A;  4UWH A;  3ZHE B;  3CIA A;  4C9B B;  2WQH A;  3NZU A;  5LOZ A;  4GZC A;  3ZHE A;  2PQN A;  3CBM A;  4QEO A;  4JA9 A;  4GA0 A;  3ZFW A;  5G05 C;  4L23 A;  4RG9 A;  4O6F A;  3U66 A;  4DLQ A;  4G25 A;  4I1M A;  3UX4 A;  4F1S A;  3QWP A;  4UWK A;  1MUF A;  1E8Y A;  1EF1 C;  4PS7 A;  3ESL A;  1WM5 A;  4BT8 A;  3MKR A;  4CDN A;  5KJN A;  3FU5 A;  4UI9 C;  3WXX A;  2X6K A;  1OUV A;  3R7R A;  4W9R A;  4AIF A;  2I2O A;  4CT0 A;  4I6E A;  2X6I A;  3F9Z A;  3LY8 A;  2XEV A;  4A1G A;  3L16 A;  3SNX A;  3LDZ A;  5TH7 A;  4H12 A;  4JL0 A;  3FWV A;  2C2L A;  4GCO A;  4GU5 A;  4KZC A;  4NQ0 A;  4YND A;  3Q49 B;  1PY1 A;  4APO A;  3L08 A;  4FA6 A;  3D3M A;  3CEQ A;  3G2W A;  3MGB A;  2PM7 A;  5BNW A;  5ARG A;  2VSN A;  3MO0 A;  4FJZ A;  4TV3 A;  4HOU A;  3CHQ A;  3LKU A;  4N3C A;  3O48 A;  4HLE A;  4JPS A;  3FTY A;  3PE4 A;  5AYW D;  1WY6 A;  1QQE A;  4I9E A;  1UN8 A;  4U8H A;  4LUN U;  4FAD A;  2CG2 A;  4IYP A;  3P2B A;  2VYI A;  2X6F A;  4F7A A;  3JYS A;  2C0M A;  4AY6 A;  3QAQ A;  2R3A A;  3LS8 A;  4EQF A;  2W5Y A;  3L6A A;  4DJA A;  1E7U A;  2XPY A;  3OXG A;  1ZKK A;  3VTX A;  4CGW A;  1OWP A;  3D9M A;  3GZ1 A;  4GML A;  1HE8 A;  1A17 A;  1HZ4 A;  1VDY A;  5D0O D;  5JHN A;  3SFZ A;  1WAO 1;  1Y6I A;  2KAT A;  3PUK A;  4JEH A;  5JJ7 A;  1TJF A;  2WXN A;  4EZJ A;  4I6J A;  4HS2 A;  3VTY A;  4F3V A;  5BUZ A;  3SW9 A;  3OXL A;  2X3M A;  3RAY A;  2YQ8 A;  2KCL A;  4OVV A;  3CR3 A;  4DPR A;  4KBQ A;  1MT6 A;  4J7I A;  4BFR A;  5CCM A;  4FHK A;  4Q69 A;  4GYW A;  4A1S A;  4GA1 A;  3ZXS A;  3RRN B;  3OPE A;  2VGY A;  2F69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...