2IGQA

Human euchromatic histone methyltransferase 1
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
260
structure length
251
Chain Sequence
ERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGSCRCGSPKCRHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural biology of human H3K9 methyltransferases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords euchromatic histone methyltransferase 1
total genus 62
structure length 251
sequence length 260
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2006-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2igqA00
5KJKA 3M5AA 3S7BA 4QENA 3CBMA 2F69A 5JJ0A 5F59A 1MVHA 3MO0A 1N3JA 5EG2A 3VV0A 2JV0A 4MI5A 5EX0A 5LSZA 1XQHA 4YPUA 5CPRB 3OXGA 5T0MA 1ZKKA 3S7DA 3MO2A 5EX3A 3OOIA 2RFIA 4JDSA 5ARFA 3SWCA 3F9YA 3M59A 3M53A 4IJDA 5AYFA 5TEGA 4YNPA 3MO5A 5HQ8A 5KJNA 2O8JA 4YPEA 3OXLA 3RAYA 3RJWA 4MI0A 3DALA 2QPWA 3KMAA 3M56A 3M54A 4RZ0A 2R3AA 5KJLA 5TH7A 1H3IA 3PDNA 5HI7A 2W5ZA 3M57A 4O30A 1MUFA 4J8OA 5T0KA 3TG5A 3EP0A 4J7FA 3RU0A 4WUYA 4H12A 1MT6A 1MVXA 3S7JA 4YPAA 3FPDA 5LSXA 4YNMA 3S7FA 3TG4A 3VUZA 3BO5A 1N6CA 2BQZA 4J7IA 3OPEA 4JLGA 5TTFA 1PEGA 4YNDA 3QWWA 4AU7A 3DB5A 2W5YA 3KMTA 5CCLA 4QEOA 5JHNA 3S8PA 3RQ4A 3F9XA 4I51A 4Z4PA 4FMUA 5KJMA 1N6AA 3M58A 1ML9A 3OXFA 1O9SA 3IHXA 3OS5A 4QEPA 3MEKA 5JIYA 4NJ5A 4LDGA 3HNAA 3RIBA 4J83A 3N71A 4C1QA 5JINA 4NVQA 3F9ZA 4E47A 3SW9A 3KMJA 3CBOA 5CCMA 2IGQA 3QWPA 4BUPA 5F5EA 4IJ8A 3QWVA 5F6KC 3F9WA 5T5GA 3K5KA 5F6LA 3M55A 3CBPA 4O6FA 2G46A 5ARGA
chains in the Genus database with same CATH superfamily
5KJKA 3M5AA 3S7BA 4QENA 3CBMA 2F69A 5JJ0A 5F59A 1MVHA 3MO0A 1N3JA 5EG2A 3VV0A 2JV0A 4MI5A 5EX0A 5LSZA 1XQHA 4YPUA 5CPRB 3OXGA 5T0MA 1ZKKA 3S7DA 3MO2A 5EX3A 3OOIA 2RFIA 4JDSA 5ARFA 3SWCA 3F9YA 3M59A 3M53A 4IJDA 5AYFA 5TEGA 4YNPA 3MO5A 5HQ8A 5KJNA 2O8JA 4YPEA 3OXLA 3RAYA 3RJWA 4MI0A 3DALA 2QPWA 3KMAA 3M56A 3M54A 4RZ0A 2R3AA 5KJLA 5TH7A 1H3IA 3PDNA 5HI7A 2W5ZA 3M57A 4O30A 1MUFA 4J8OA 5T0KA 3TG5A 3EP0A 4J7FA 3RU0A 4WUYA 4H12A 1MT6A 1MVXA 3S7JA 4YPAA 3FPDA 5LSXA 4YNMA 3S7FA 3TG4A 3VUZA 3BO5A 1N6CA 2BQZA 4J7IA 3OPEA 4JLGA 5TTFA 1PEGA 4YNDA 3QWWA 4AU7A 3DB5A 2W5YA 3KMTA 5CCLA 4QEOA 5JHNA 3S8PA 3RQ4A 3F9XA 4I51A 4Z4PA 4FMUA 5KJMA 1N6AA 3M58A 1ML9A 3OXFA 1O9SA 3IHXA 3OS5A 4QEPA 3MEKA 5JIYA 4NJ5A 4LDGA 3HNAA 3RIBA 4J83A 3N71A 4C1QA 5JINA 4NVQA 3F9ZA 4E47A 3SW9A 3KMJA 3CBOA 5CCMA 2IGQA 3QWPA 4BUPA 5F5EA 4IJ8A 3QWVA 5F6KC 3F9WA 5T5GA 3K5KA 5F6LA 3M55A 3CBPA 4O6FA 2G46A 5ARGA
chains in the Genus database with same CATH topology
5KJKA 3M5AA 3S7BA 4QENA 3CBMA 2F69A 5JJ0A 5F59A 1MVHA 3MO0A 1N3JA 5EG2A 3VV0A 2JV0A 4MI5A 5EX0A 5LSZA 1XQHA 4YPUA 5CPRB 3OXGA 5T0MA 1ZKKA 3S7DA 3MO2A 5EX3A 3OOIA 2RFIA 4JDSA 5ARFA 3SWCA 3F9YA 3M59A 3M53A 4IJDA 5AYFA 5TEGA 4YNPA 3MO5A 5HQ8A 5KJNA 2O8JA 4YPEA 3OXLA 3RAYA 3RJWA 4MI0A 3DALA 2QPWA 3KMAA 3M56A 3M54A 4RZ0A 2R3AA 5KJLA 5TH7A 1H3IA 3PDNA 5HI7A 2W5ZA 3M57A 4O30A 1MUFA 4J8OA 5T0KA 3TG5A 3EP0A 4J7FA 3RU0A 4WUYA 4H12A 1MT6A 1MVXA 3S7JA 4YPAA 3FPDA 5LSXA 4YNMA 3S7FA 3TG4A 3VUZA 3BO5A 1N6CA 2BQZA 4J7IA 3OPEA 4JLGA 5TTFA 1PEGA 4YNDA 3QWWA 4AU7A 3DB5A 2W5YA 3KMTA 5CCLA 4QEOA 5JHNA 3S8PA 3RQ4A 3F9XA 4I51A 4Z4PA 4FMUA 5KJMA 1N6AA 3M58A 1ML9A 3OXFA 1O9SA 3IHXA 3OS5A 4QEPA 3MEKA 5JIYA 4NJ5A 4LDGA 3HNAA 3RIBA 4J83A 3N71A 4C1QA 5JINA 4NVQA 3F9ZA 4E47A 3SW9A 3KMJA 3CBOA 5CCMA 2IGQA 3QWPA 4BUPA 5F5EA 4IJ8A 3QWVA 5F6KC 3F9WA 5T5GA 3K5KA 5F6LA 3M55A 3CBPA 4O6FA 2G46A 5ARGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KJK A;  3M5A A;  3S7B A;  4QEN A;  3CBM A;  2F69 A;  5JJ0 A;  5F59 A;  1MVH A;  3MO0 A;  1N3J A;  5EG2 A;  3VV0 A;  2JV0 A;  4MI5 A;  5EX0 A;  5LSZ A;  1XQH A;  4YPU A;  5CPR B;  3OXG A;  5T0M A;  1ZKK A;  3S7D A;  3MO2 A;  5EX3 A;  3OOI A;  2RFI A;  4JDS A;  5ARF A;  3SWC A;  3F9Y A;  3M59 A;  3M53 A;  4IJD A;  5AYF A;  5TEG A;  4YNP A;  3MO5 A;  5HQ8 A;  5KJN A;  2O8J A;  4YPE A;  3OXL A;  3RAY A;  3RJW A;  4MI0 A;  3DAL A;  2QPW A;  3KMA A;  3M56 A;  3M54 A;  4RZ0 A;  2R3A A;  5KJL A;  5TH7 A;  1H3I A;  3PDN A;  5HI7 A;  2W5Z A;  3M57 A;  4O30 A;  1MUF A;  4J8O A;  5T0K A;  3TG5 A;  3EP0 A;  4J7F A;  3RU0 A;  4WUY A;  4H12 A;  1MT6 A;  1MVX A;  3S7J A;  4YPA A;  3FPD A;  5LSX A;  4YNM A;  3S7F A;  3TG4 A;  3VUZ A;  3BO5 A;  1N6C A;  2BQZ A;  4J7I A;  3OPE A;  4JLG A;  5TTF A;  1PEG A;  4YND A;  3QWW A;  4AU7 A;  3DB5 A;  2W5Y A;  3KMT A;  5CCL A;  4QEO A;  5JHN A;  3S8P A;  3RQ4 A;  3F9X A;  4I51 A;  4Z4P A;  4FMU A;  5KJM A;  1N6A A;  3M58 A;  1ML9 A;  3OXF A;  1O9S A;  3IHX A;  3OS5 A;  4QEP A;  3MEK A;  5JIY A;  4NJ5 A;  4LDG A;  3HNA A;  3RIB A;  4J83 A;  3N71 A;  4C1Q A;  5JIN A;  4NVQ A;  3F9Z A;  4E47 A;  3SW9 A;  3KMJ A;  3CBO A;  5CCM A;  2IGQ A;  3QWP A;  4BUP A;  5F5E A;  4IJ8 A;  3QWV A;  5F6K C;  3F9W A;  5T5G A;  3K5K A;  5F6L A;  3M55 A;  3CBP A;  4O6F A;  2G46 A;  5ARG A; 
#chains in the Genus database with same CATH topology
 5KJK A;  3M5A A;  3S7B A;  4QEN A;  3CBM A;  2F69 A;  5JJ0 A;  5F59 A;  1MVH A;  3MO0 A;  1N3J A;  5EG2 A;  3VV0 A;  2JV0 A;  4MI5 A;  5EX0 A;  5LSZ A;  1XQH A;  4YPU A;  5CPR B;  3OXG A;  5T0M A;  1ZKK A;  3S7D A;  3MO2 A;  5EX3 A;  3OOI A;  2RFI A;  4JDS A;  5ARF A;  3SWC A;  3F9Y A;  3M59 A;  3M53 A;  4IJD A;  5AYF A;  5TEG A;  4YNP A;  3MO5 A;  5HQ8 A;  5KJN A;  2O8J A;  4YPE A;  3OXL A;  3RAY A;  3RJW A;  4MI0 A;  3DAL A;  2QPW A;  3KMA A;  3M56 A;  3M54 A;  4RZ0 A;  2R3A A;  5KJL A;  5TH7 A;  1H3I A;  3PDN A;  5HI7 A;  2W5Z A;  3M57 A;  4O30 A;  1MUF A;  4J8O A;  5T0K A;  3TG5 A;  3EP0 A;  4J7F A;  3RU0 A;  4WUY A;  4H12 A;  1MT6 A;  1MVX A;  3S7J A;  4YPA A;  3FPD A;  5LSX A;  4YNM A;  3S7F A;  3TG4 A;  3VUZ A;  3BO5 A;  1N6C A;  2BQZ A;  4J7I A;  3OPE A;  4JLG A;  5TTF A;  1PEG A;  4YND A;  3QWW A;  4AU7 A;  3DB5 A;  2W5Y A;  3KMT A;  5CCL A;  4QEO A;  5JHN A;  3S8P A;  3RQ4 A;  3F9X A;  4I51 A;  4Z4P A;  4FMU A;  5KJM A;  1N6A A;  3M58 A;  1ML9 A;  3OXF A;  1O9S A;  3IHX A;  3OS5 A;  4QEP A;  3MEK A;  5JIY A;  4NJ5 A;  4LDG A;  3HNA A;  3RIB A;  4J83 A;  3N71 A;  4C1Q A;  5JIN A;  4NVQ A;  3F9Z A;  4E47 A;  3SW9 A;  3KMJ A;  3CBO A;  5CCM A;  2IGQ A;  3QWP A;  4BUP A;  5F5E A;  4IJ8 A;  3QWV A;  5F6K C;  3F9W A;  5T5G A;  3K5K A;  5F6L A;  3M55 A;  3CBP A;  4O6F A;  2G46 A;  5ARG A; 
#chains in the Genus database with same CATH homology
 5KJK A;  3M5A A;  3S7B A;  4QEN A;  3CBM A;  2F69 A;  5JJ0 A;  5F59 A;  1MVH A;  3MO0 A;  1N3J A;  5EG2 A;  3VV0 A;  2JV0 A;  4MI5 A;  5EX0 A;  5LSZ A;  1XQH A;  4YPU A;  5CPR B;  3OXG A;  5T0M A;  1ZKK A;  3S7D A;  3MO2 A;  5EX3 A;  3OOI A;  2RFI A;  4JDS A;  5ARF A;  3SWC A;  3F9Y A;  3M59 A;  3M53 A;  4IJD A;  5AYF A;  5TEG A;  4YNP A;  3MO5 A;  5HQ8 A;  5KJN A;  2O8J A;  4YPE A;  3OXL A;  3RAY A;  3RJW A;  4MI0 A;  3DAL A;  2QPW A;  3KMA A;  3M56 A;  3M54 A;  4RZ0 A;  2R3A A;  5KJL A;  5TH7 A;  1H3I A;  3PDN A;  5HI7 A;  2W5Z A;  3M57 A;  4O30 A;  1MUF A;  4J8O A;  5T0K A;  3TG5 A;  3EP0 A;  4J7F A;  3RU0 A;  4WUY A;  4H12 A;  1MT6 A;  1MVX A;  3S7J A;  4YPA A;  3FPD A;  5LSX A;  4YNM A;  3S7F A;  3TG4 A;  3VUZ A;  3BO5 A;  1N6C A;  2BQZ A;  4J7I A;  3OPE A;  4JLG A;  5TTF A;  1PEG A;  4YND A;  3QWW A;  4AU7 A;  3DB5 A;  2W5Y A;  3KMT A;  5CCL A;  4QEO A;  5JHN A;  3S8P A;  3RQ4 A;  3F9X A;  4I51 A;  4Z4P A;  4FMU A;  5KJM A;  1N6A A;  3M58 A;  1ML9 A;  3OXF A;  1O9S A;  3IHX A;  3OS5 A;  4QEP A;  3MEK A;  5JIY A;  4NJ5 A;  4LDG A;  3HNA A;  3RIB A;  4J83 A;  3N71 A;  4C1Q A;  5JIN A;  4NVQ A;  3F9Z A;  4E47 A;  3SW9 A;  3KMJ A;  3CBO A;  5CCM A;  2IGQ A;  3QWP A;  4BUP A;  5F5E A;  4IJ8 A;  3QWV A;  5F6K C;  3F9W A;  5T5G A;  3K5K A;  5F6L A;  3M55 A;  3CBP A;  4O6F A;  2G46 A;  5ARG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...