2IGQA

Human euchromatic histone methyltransferase 1
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
260
structure length
251
Chain Sequence
b'ERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGSCRCGSPKCRHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords euchromatic histone methyltransferase 1
molecule tags Transferase
source organism Homo sapiens
publication title Structural biology of human H3K9 methyltransferases
pubmed doi rcsb
total genus 62
structure length 251
sequence length 260
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2006-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2igqA00
3RIBA 4NJ5A 4BUPA 5JINA 3N71A 3K5KA 5KJNA 4QENA 4C1QA 5CPRB 3M53A 4YNMA 5T5GA 3MO0A 3KMJA 5HI7A 4Z4PA 3SWCA 1H3IA 4QEPA 1MUFA 3DB5A 5AYFA 4YPEA 4AU7A 4I51A 3HNAA 3M56A 3OS5A 3SW9A 3M59A 3IHXA 4QEOA 5KJLA 5ARGA 3M54A 4RZ0A 3OXFA 3MEKA 2W5ZA 3EP0A 2JV0A 3S7FA 3F9XA 3RQ4A 5F59A 4YNPA 5CCLA 3OXGA 3BO5A 5CCMA 3S7BA 3OOIA 3QWWA 3CBPA 5F6LA 3KMAA 3KMTA 3RU0A 3M55A 3DALA 3S7JA 5HQ8A 4IJ8A 3RAYA 3TG5A 3OPEA 3CBMA 5JHNA 3M58A 4WUYA 1MVXA 3F9WA 4YNDA 2O8JA 3RJWA 5JIYA 3S7DA 5TH7A 5EG2A 4NVQA 4O6FA 5EX0A 2BQZA 3MO2A 4YPUA 4IJDA 5T0KA 2QPWA 5T0MA 3QWVA 1XQHA 3M57A 3FPDA 3VV0A 4JLGA 3PDNA 3M5AA 5TTFA 2F69A 1N6CA 3F9ZA 5LSZA 4O30A 4FMUA 1O9SA 3MO5A 5TEGA 4YPAA 3TG4A 4J7FA 5JJ0A 4H12A 1ML9A 1ZKKA 3OXLA 2G46A 5ARFA 5KJKA 5F5EA 4J7IA 4J83A 5EX3A 4LDGA 4JDSA 2R3AA 2W5YA 5F6KC 5KJMA 5LSXA 4MI0A 3CBOA 1MT6A 4J8OA 2IGQA 2RFIA 4E47A 3S8PA 3QWPA 1MVHA 4MI5A 1PEGA 1N6AA 3F9YA 1N3JA 3VUZA
chains in the Genus database with same CATH superfamily
3RIBA 4NJ5A 4BUPA 5JINA 3N71A 3K5KA 5KJNA 4QENA 4C1QA 5CPRB 3M53A 4YNMA 5T5GA 3MO0A 3KMJA 5HI7A 4Z4PA 3SWCA 1H3IA 4QEPA 1MUFA 3DB5A 5AYFA 4YPEA 4AU7A 4I51A 3HNAA 3M56A 3OS5A 3SW9A 3M59A 3IHXA 4QEOA 5KJLA 5ARGA 3M54A 4RZ0A 3OXFA 3MEKA 2W5ZA 3EP0A 2JV0A 3S7FA 3F9XA 3RQ4A 5F59A 4YNPA 5CCLA 3OXGA 3BO5A 5CCMA 3S7BA 3OOIA 3QWWA 3CBPA 5F6LA 3KMAA 3KMTA 3RU0A 3M55A 3DALA 3S7JA 5HQ8A 4IJ8A 3RAYA 3TG5A 3OPEA 3CBMA 5JHNA 3M58A 4WUYA 1MVXA 3F9WA 4YNDA 2O8JA 3RJWA 5JIYA 3S7DA 5TH7A 5EG2A 4NVQA 4O6FA 5EX0A 2BQZA 3MO2A 4YPUA 4IJDA 5T0KA 2QPWA 5T0MA 3QWVA 1XQHA 3M57A 3FPDA 3VV0A 4JLGA 3PDNA 3M5AA 5TTFA 2F69A 1N6CA 3F9ZA 5LSZA 4O30A 4FMUA 1O9SA 3MO5A 5TEGA 4YPAA 3TG4A 4J7FA 5JJ0A 4H12A 1ML9A 1ZKKA 3OXLA 2G46A 5ARFA 5KJKA 5F5EA 4J7IA 4J83A 5EX3A 4LDGA 4JDSA 2R3AA 2W5YA 5F6KC 5KJMA 5LSXA 4MI0A 3CBOA 1MT6A 4J8OA 2IGQA 2RFIA 4E47A 3S8PA 3QWPA 1MVHA 4MI5A 1PEGA 1N6AA 3F9YA 1N3JA 3VUZA
chains in the Genus database with same CATH topology
3RIBA 4NJ5A 4BUPA 5JINA 3N71A 3K5KA 5KJNA 4QENA 4C1QA 5CPRB 3M53A 4YNMA 5T5GA 3MO0A 3KMJA 5HI7A 4Z4PA 3SWCA 1H3IA 4QEPA 1MUFA 3DB5A 5AYFA 4YPEA 4AU7A 4I51A 3HNAA 3M56A 3OS5A 3SW9A 3M59A 3IHXA 4QEOA 5KJLA 5ARGA 3M54A 4RZ0A 3OXFA 3MEKA 2W5ZA 3EP0A 2JV0A 3S7FA 3F9XA 3RQ4A 5F59A 4YNPA 5CCLA 3OXGA 3BO5A 5CCMA 3S7BA 3OOIA 3QWWA 3CBPA 5F6LA 3KMAA 3KMTA 3RU0A 3M55A 3DALA 3S7JA 5HQ8A 4IJ8A 3RAYA 3TG5A 3OPEA 3CBMA 5JHNA 3M58A 4WUYA 1MVXA 3F9WA 4YNDA 2O8JA 3RJWA 5JIYA 3S7DA 5TH7A 5EG2A 4NVQA 4O6FA 5EX0A 2BQZA 3MO2A 4YPUA 4IJDA 5T0KA 2QPWA 5T0MA 3QWVA 1XQHA 3M57A 3FPDA 3VV0A 4JLGA 3PDNA 3M5AA 5TTFA 2F69A 1N6CA 3F9ZA 5LSZA 4O30A 4FMUA 1O9SA 3MO5A 5TEGA 4YPAA 3TG4A 4J7FA 5JJ0A 4H12A 1ML9A 1ZKKA 3OXLA 2G46A 5ARFA 5KJKA 5F5EA 4J7IA 4J83A 5EX3A 4LDGA 4JDSA 2R3AA 2W5YA 5F6KC 5KJMA 5LSXA 4MI0A 3CBOA 1MT6A 4J8OA 2IGQA 2RFIA 4E47A 3S8PA 3QWPA 1MVHA 4MI5A 1PEGA 1N6AA 3F9YA 1N3JA 3VUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RIB A;  4NJ5 A;  4BUP A;  5JIN A;  3N71 A;  3K5K A;  5KJN A;  4QEN A;  4C1Q A;  5CPR B;  3M53 A;  4YNM A;  5T5G A;  3MO0 A;  3KMJ A;  5HI7 A;  4Z4P A;  3SWC A;  1H3I A;  4QEP A;  1MUF A;  3DB5 A;  5AYF A;  4YPE A;  4AU7 A;  4I51 A;  3HNA A;  3M56 A;  3OS5 A;  3SW9 A;  3M59 A;  3IHX A;  4QEO A;  5KJL A;  5ARG A;  3M54 A;  4RZ0 A;  3OXF A;  3MEK A;  2W5Z A;  3EP0 A;  2JV0 A;  3S7F A;  3F9X A;  3RQ4 A;  5F59 A;  4YNP A;  5CCL A;  3OXG A;  3BO5 A;  5CCM A;  3S7B A;  3OOI A;  3QWW A;  3CBP A;  5F6L A;  3KMA A;  3KMT A;  3RU0 A;  3M55 A;  3DAL A;  3S7J A;  5HQ8 A;  4IJ8 A;  3RAY A;  3TG5 A;  3OPE A;  3CBM A;  5JHN A;  3M58 A;  4WUY A;  1MVX A;  3F9W A;  4YND A;  2O8J A;  3RJW A;  5JIY A;  3S7D A;  5TH7 A;  5EG2 A;  4NVQ A;  4O6F A;  5EX0 A;  2BQZ A;  3MO2 A;  4YPU A;  4IJD A;  5T0K A;  2QPW A;  5T0M A;  3QWV A;  1XQH A;  3M57 A;  3FPD A;  3VV0 A;  4JLG A;  3PDN A;  3M5A A;  5TTF A;  2F69 A;  1N6C A;  3F9Z A;  5LSZ A;  4O30 A;  4FMU A;  1O9S A;  3MO5 A;  5TEG A;  4YPA A;  3TG4 A;  4J7F A;  5JJ0 A;  4H12 A;  1ML9 A;  1ZKK A;  3OXL A;  2G46 A;  5ARF A;  5KJK A;  5F5E A;  4J7I A;  4J83 A;  5EX3 A;  4LDG A;  4JDS A;  2R3A A;  2W5Y A;  5F6K C;  5KJM A;  5LSX A;  4MI0 A;  3CBO A;  1MT6 A;  4J8O A;  2IGQ A;  2RFI A;  4E47 A;  3S8P A;  3QWP A;  1MVH A;  4MI5 A;  1PEG A;  1N6A A;  3F9Y A;  1N3J A;  3VUZ A; 
#chains in the Genus database with same CATH topology
 3RIB A;  4NJ5 A;  4BUP A;  5JIN A;  3N71 A;  3K5K A;  5KJN A;  4QEN A;  4C1Q A;  5CPR B;  3M53 A;  4YNM A;  5T5G A;  3MO0 A;  3KMJ A;  5HI7 A;  4Z4P A;  3SWC A;  1H3I A;  4QEP A;  1MUF A;  3DB5 A;  5AYF A;  4YPE A;  4AU7 A;  4I51 A;  3HNA A;  3M56 A;  3OS5 A;  3SW9 A;  3M59 A;  3IHX A;  4QEO A;  5KJL A;  5ARG A;  3M54 A;  4RZ0 A;  3OXF A;  3MEK A;  2W5Z A;  3EP0 A;  2JV0 A;  3S7F A;  3F9X A;  3RQ4 A;  5F59 A;  4YNP A;  5CCL A;  3OXG A;  3BO5 A;  5CCM A;  3S7B A;  3OOI A;  3QWW A;  3CBP A;  5F6L A;  3KMA A;  3KMT A;  3RU0 A;  3M55 A;  3DAL A;  3S7J A;  5HQ8 A;  4IJ8 A;  3RAY A;  3TG5 A;  3OPE A;  3CBM A;  5JHN A;  3M58 A;  4WUY A;  1MVX A;  3F9W A;  4YND A;  2O8J A;  3RJW A;  5JIY A;  3S7D A;  5TH7 A;  5EG2 A;  4NVQ A;  4O6F A;  5EX0 A;  2BQZ A;  3MO2 A;  4YPU A;  4IJD A;  5T0K A;  2QPW A;  5T0M A;  3QWV A;  1XQH A;  3M57 A;  3FPD A;  3VV0 A;  4JLG A;  3PDN A;  3M5A A;  5TTF A;  2F69 A;  1N6C A;  3F9Z A;  5LSZ A;  4O30 A;  4FMU A;  1O9S A;  3MO5 A;  5TEG A;  4YPA A;  3TG4 A;  4J7F A;  5JJ0 A;  4H12 A;  1ML9 A;  1ZKK A;  3OXL A;  2G46 A;  5ARF A;  5KJK A;  5F5E A;  4J7I A;  4J83 A;  5EX3 A;  4LDG A;  4JDS A;  2R3A A;  2W5Y A;  5F6K C;  5KJM A;  5LSX A;  4MI0 A;  3CBO A;  1MT6 A;  4J8O A;  2IGQ A;  2RFI A;  4E47 A;  3S8P A;  3QWP A;  1MVH A;  4MI5 A;  1PEG A;  1N6A A;  3F9Y A;  1N3J A;  3VUZ A; 
#chains in the Genus database with same CATH homology
 3RIB A;  4NJ5 A;  4BUP A;  5JIN A;  3N71 A;  3K5K A;  5KJN A;  4QEN A;  4C1Q A;  5CPR B;  3M53 A;  4YNM A;  5T5G A;  3MO0 A;  3KMJ A;  5HI7 A;  4Z4P A;  3SWC A;  1H3I A;  4QEP A;  1MUF A;  3DB5 A;  5AYF A;  4YPE A;  4AU7 A;  4I51 A;  3HNA A;  3M56 A;  3OS5 A;  3SW9 A;  3M59 A;  3IHX A;  4QEO A;  5KJL A;  5ARG A;  3M54 A;  4RZ0 A;  3OXF A;  3MEK A;  2W5Z A;  3EP0 A;  2JV0 A;  3S7F A;  3F9X A;  3RQ4 A;  5F59 A;  4YNP A;  5CCL A;  3OXG A;  3BO5 A;  5CCM A;  3S7B A;  3OOI A;  3QWW A;  3CBP A;  5F6L A;  3KMA A;  3KMT A;  3RU0 A;  3M55 A;  3DAL A;  3S7J A;  5HQ8 A;  4IJ8 A;  3RAY A;  3TG5 A;  3OPE A;  3CBM A;  5JHN A;  3M58 A;  4WUY A;  1MVX A;  3F9W A;  4YND A;  2O8J A;  3RJW A;  5JIY A;  3S7D A;  5TH7 A;  5EG2 A;  4NVQ A;  4O6F A;  5EX0 A;  2BQZ A;  3MO2 A;  4YPU A;  4IJD A;  5T0K A;  2QPW A;  5T0M A;  3QWV A;  1XQH A;  3M57 A;  3FPD A;  3VV0 A;  4JLG A;  3PDN A;  3M5A A;  5TTF A;  2F69 A;  1N6C A;  3F9Z A;  5LSZ A;  4O30 A;  4FMU A;  1O9S A;  3MO5 A;  5TEG A;  4YPA A;  3TG4 A;  4J7F A;  5JJ0 A;  4H12 A;  1ML9 A;  1ZKK A;  3OXL A;  2G46 A;  5ARF A;  5KJK A;  5F5E A;  4J7I A;  4J83 A;  5EX3 A;  4LDG A;  4JDS A;  2R3A A;  2W5Y A;  5F6K C;  5KJM A;  5LSX A;  4MI0 A;  3CBO A;  1MT6 A;  4J8O A;  2IGQ A;  2RFI A;  4E47 A;  3S8P A;  3QWP A;  1MVH A;  4MI5 A;  1PEG A;  1N6A A;  3F9Y A;  1N3J A;  3VUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...