2IGQA

Human euchromatic histone methyltransferase 1
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
260
structure length
251
Chain Sequence
ERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGSCRCGSPKCRHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural biology of human H3K9 methyltransferases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords euchromatic histone methyltransferase 1
total genus 62
structure length 251
sequence length 260
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2006-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2igqA00
5F5EA 3OXGA 3MO0A 5LSZA 2W5ZA 3S7DA 3OXFA 4J7FA 3RIBA 5TH7A 3BO5A 3OOIA 3CBPA 4YPEA 5T0MA 4AU7A 3F9YA 4Z4PA 3RU0A 5F6LA 3OXLA 4RZ0A 5KJKA 3M5AA 4O30A 1N3JA 5F6KC 1N6CA 4MI5A 5HI7A 4IJ8A 5ARGA 5JJ0A 3M59A 3S7JA 3VUZA 3QWVA 5EX3A 1H3IA 4JLGA 3F9XA 5T0KA 4NJ5A 3M53A 3F9WA 4YNPA 5LSXA 3MO5A 4E47A 3S7BA 3N71A 3SWCA 3CBMA 5KJLA 3MEKA 4YNMA 4QENA 5JINA 5T5GA 4MI0A 2O8JA 5AYFA 4QEOA 4C1QA 3CBOA 1PEGA 3TG4A 3RQ4A 1MVHA 5CCMA 3KMTA 3M55A 5F59A 5KJNA 2F69A 5TTFA 4JDSA 3S8PA 2IGQA 1N6AA 4J83A 3HNAA 5ARFA 3DALA 4WUYA 2RFIA 3F9ZA 3K5KA 4J7IA 3EP0A 3MO2A 3OS5A 4I51A 3QWPA 3VV0A 4QEPA 3KMJA 5EG2A 1ZKKA 1MT6A 3S7FA 3OPEA 2R3AA 3IHXA 2W5YA 4YPAA 2BQZA 3TG5A 1O9SA 3SW9A 4YNDA 3KMAA 4O6FA 3M58A 3M56A 4FMUA 4YPUA 5CCLA 1MVXA 2G46A 5TEGA 3RJWA 3RAYA 4BUPA 5EX0A 1XQHA 5JHNA 2JV0A 5CPRB 4IJDA 3M57A 3DB5A 4H12A 5HQ8A 5KJMA 3FPDA 3M54A 1MUFA 4NVQA 4LDGA 5JIYA 3QWWA 1ML9A 3PDNA 4J8OA 2QPWA
chains in the Genus database with same CATH superfamily
5F5EA 3OXGA 3MO0A 5LSZA 2W5ZA 3S7DA 3OXFA 4J7FA 3RIBA 5TH7A 3BO5A 3OOIA 3CBPA 4YPEA 5T0MA 4AU7A 3F9YA 4Z4PA 3RU0A 5F6LA 3OXLA 4RZ0A 5KJKA 3M5AA 4O30A 1N3JA 5F6KC 1N6CA 4MI5A 5HI7A 4IJ8A 5ARGA 5JJ0A 3M59A 3S7JA 3VUZA 3QWVA 5EX3A 1H3IA 4JLGA 3F9XA 5T0KA 4NJ5A 3M53A 3F9WA 4YNPA 5LSXA 3MO5A 4E47A 3S7BA 3N71A 3SWCA 3CBMA 5KJLA 3MEKA 4YNMA 4QENA 5JINA 5T5GA 4MI0A 2O8JA 5AYFA 4QEOA 4C1QA 3CBOA 1PEGA 3TG4A 3RQ4A 1MVHA 5CCMA 3KMTA 3M55A 5F59A 5KJNA 2F69A 5TTFA 4JDSA 3S8PA 2IGQA 1N6AA 4J83A 3HNAA 5ARFA 3DALA 4WUYA 2RFIA 3F9ZA 3K5KA 4J7IA 3EP0A 3MO2A 3OS5A 4I51A 3QWPA 3VV0A 4QEPA 3KMJA 5EG2A 1ZKKA 1MT6A 3S7FA 3OPEA 2R3AA 3IHXA 2W5YA 4YPAA 2BQZA 3TG5A 1O9SA 3SW9A 4YNDA 3KMAA 4O6FA 3M58A 3M56A 4FMUA 4YPUA 5CCLA 1MVXA 2G46A 5TEGA 3RJWA 3RAYA 4BUPA 5EX0A 1XQHA 5JHNA 2JV0A 5CPRB 4IJDA 3M57A 3DB5A 4H12A 5HQ8A 5KJMA 3FPDA 3M54A 1MUFA 4NVQA 4LDGA 5JIYA 3QWWA 1ML9A 3PDNA 4J8OA 2QPWA
chains in the Genus database with same CATH topology
5F5EA 3OXGA 3MO0A 5LSZA 2W5ZA 3S7DA 3OXFA 4J7FA 3RIBA 5TH7A 3BO5A 3OOIA 3CBPA 4YPEA 5T0MA 4AU7A 3F9YA 4Z4PA 3RU0A 5F6LA 3OXLA 4RZ0A 5KJKA 3M5AA 4O30A 1N3JA 5F6KC 1N6CA 4MI5A 5HI7A 4IJ8A 5ARGA 5JJ0A 3M59A 3S7JA 3VUZA 3QWVA 5EX3A 1H3IA 4JLGA 3F9XA 5T0KA 4NJ5A 3M53A 3F9WA 4YNPA 5LSXA 3MO5A 4E47A 3S7BA 3N71A 3SWCA 3CBMA 5KJLA 3MEKA 4YNMA 4QENA 5JINA 5T5GA 4MI0A 2O8JA 5AYFA 4QEOA 4C1QA 3CBOA 1PEGA 3TG4A 3RQ4A 1MVHA 5CCMA 3KMTA 3M55A 5F59A 5KJNA 2F69A 5TTFA 4JDSA 3S8PA 2IGQA 1N6AA 4J83A 3HNAA 5ARFA 3DALA 4WUYA 2RFIA 3F9ZA 3K5KA 4J7IA 3EP0A 3MO2A 3OS5A 4I51A 3QWPA 3VV0A 4QEPA 3KMJA 5EG2A 1ZKKA 1MT6A 3S7FA 3OPEA 2R3AA 3IHXA 2W5YA 4YPAA 2BQZA 3TG5A 1O9SA 3SW9A 4YNDA 3KMAA 4O6FA 3M58A 3M56A 4FMUA 4YPUA 5CCLA 1MVXA 2G46A 5TEGA 3RJWA 3RAYA 4BUPA 5EX0A 1XQHA 5JHNA 2JV0A 5CPRB 4IJDA 3M57A 3DB5A 4H12A 5HQ8A 5KJMA 3FPDA 3M54A 1MUFA 4NVQA 4LDGA 5JIYA 3QWWA 1ML9A 3PDNA 4J8OA 2QPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F5E A;  3OXG A;  3MO0 A;  5LSZ A;  2W5Z A;  3S7D A;  3OXF A;  4J7F A;  3RIB A;  5TH7 A;  3BO5 A;  3OOI A;  3CBP A;  4YPE A;  5T0M A;  4AU7 A;  3F9Y A;  4Z4P A;  3RU0 A;  5F6L A;  3OXL A;  4RZ0 A;  5KJK A;  3M5A A;  4O30 A;  1N3J A;  5F6K C;  1N6C A;  4MI5 A;  5HI7 A;  4IJ8 A;  5ARG A;  5JJ0 A;  3M59 A;  3S7J A;  3VUZ A;  3QWV A;  5EX3 A;  1H3I A;  4JLG A;  3F9X A;  5T0K A;  4NJ5 A;  3M53 A;  3F9W A;  4YNP A;  5LSX A;  3MO5 A;  4E47 A;  3S7B A;  3N71 A;  3SWC A;  3CBM A;  5KJL A;  3MEK A;  4YNM A;  4QEN A;  5JIN A;  5T5G A;  4MI0 A;  2O8J A;  5AYF A;  4QEO A;  4C1Q A;  3CBO A;  1PEG A;  3TG4 A;  3RQ4 A;  1MVH A;  5CCM A;  3KMT A;  3M55 A;  5F59 A;  5KJN A;  2F69 A;  5TTF A;  4JDS A;  3S8P A;  2IGQ A;  1N6A A;  4J83 A;  3HNA A;  5ARF A;  3DAL A;  4WUY A;  2RFI A;  3F9Z A;  3K5K A;  4J7I A;  3EP0 A;  3MO2 A;  3OS5 A;  4I51 A;  3QWP A;  3VV0 A;  4QEP A;  3KMJ A;  5EG2 A;  1ZKK A;  1MT6 A;  3S7F A;  3OPE A;  2R3A A;  3IHX A;  2W5Y A;  4YPA A;  2BQZ A;  3TG5 A;  1O9S A;  3SW9 A;  4YND A;  3KMA A;  4O6F A;  3M58 A;  3M56 A;  4FMU A;  4YPU A;  5CCL A;  1MVX A;  2G46 A;  5TEG A;  3RJW A;  3RAY A;  4BUP A;  5EX0 A;  1XQH A;  5JHN A;  2JV0 A;  5CPR B;  4IJD A;  3M57 A;  3DB5 A;  4H12 A;  5HQ8 A;  5KJM A;  3FPD A;  3M54 A;  1MUF A;  4NVQ A;  4LDG A;  5JIY A;  3QWW A;  1ML9 A;  3PDN A;  4J8O A;  2QPW A; 
#chains in the Genus database with same CATH topology
 5F5E A;  3OXG A;  3MO0 A;  5LSZ A;  2W5Z A;  3S7D A;  3OXF A;  4J7F A;  3RIB A;  5TH7 A;  3BO5 A;  3OOI A;  3CBP A;  4YPE A;  5T0M A;  4AU7 A;  3F9Y A;  4Z4P A;  3RU0 A;  5F6L A;  3OXL A;  4RZ0 A;  5KJK A;  3M5A A;  4O30 A;  1N3J A;  5F6K C;  1N6C A;  4MI5 A;  5HI7 A;  4IJ8 A;  5ARG A;  5JJ0 A;  3M59 A;  3S7J A;  3VUZ A;  3QWV A;  5EX3 A;  1H3I A;  4JLG A;  3F9X A;  5T0K A;  4NJ5 A;  3M53 A;  3F9W A;  4YNP A;  5LSX A;  3MO5 A;  4E47 A;  3S7B A;  3N71 A;  3SWC A;  3CBM A;  5KJL A;  3MEK A;  4YNM A;  4QEN A;  5JIN A;  5T5G A;  4MI0 A;  2O8J A;  5AYF A;  4QEO A;  4C1Q A;  3CBO A;  1PEG A;  3TG4 A;  3RQ4 A;  1MVH A;  5CCM A;  3KMT A;  3M55 A;  5F59 A;  5KJN A;  2F69 A;  5TTF A;  4JDS A;  3S8P A;  2IGQ A;  1N6A A;  4J83 A;  3HNA A;  5ARF A;  3DAL A;  4WUY A;  2RFI A;  3F9Z A;  3K5K A;  4J7I A;  3EP0 A;  3MO2 A;  3OS5 A;  4I51 A;  3QWP A;  3VV0 A;  4QEP A;  3KMJ A;  5EG2 A;  1ZKK A;  1MT6 A;  3S7F A;  3OPE A;  2R3A A;  3IHX A;  2W5Y A;  4YPA A;  2BQZ A;  3TG5 A;  1O9S A;  3SW9 A;  4YND A;  3KMA A;  4O6F A;  3M58 A;  3M56 A;  4FMU A;  4YPU A;  5CCL A;  1MVX A;  2G46 A;  5TEG A;  3RJW A;  3RAY A;  4BUP A;  5EX0 A;  1XQH A;  5JHN A;  2JV0 A;  5CPR B;  4IJD A;  3M57 A;  3DB5 A;  4H12 A;  5HQ8 A;  5KJM A;  3FPD A;  3M54 A;  1MUF A;  4NVQ A;  4LDG A;  5JIY A;  3QWW A;  1ML9 A;  3PDN A;  4J8O A;  2QPW A; 
#chains in the Genus database with same CATH homology
 5F5E A;  3OXG A;  3MO0 A;  5LSZ A;  2W5Z A;  3S7D A;  3OXF A;  4J7F A;  3RIB A;  5TH7 A;  3BO5 A;  3OOI A;  3CBP A;  4YPE A;  5T0M A;  4AU7 A;  3F9Y A;  4Z4P A;  3RU0 A;  5F6L A;  3OXL A;  4RZ0 A;  5KJK A;  3M5A A;  4O30 A;  1N3J A;  5F6K C;  1N6C A;  4MI5 A;  5HI7 A;  4IJ8 A;  5ARG A;  5JJ0 A;  3M59 A;  3S7J A;  3VUZ A;  3QWV A;  5EX3 A;  1H3I A;  4JLG A;  3F9X A;  5T0K A;  4NJ5 A;  3M53 A;  3F9W A;  4YNP A;  5LSX A;  3MO5 A;  4E47 A;  3S7B A;  3N71 A;  3SWC A;  3CBM A;  5KJL A;  3MEK A;  4YNM A;  4QEN A;  5JIN A;  5T5G A;  4MI0 A;  2O8J A;  5AYF A;  4QEO A;  4C1Q A;  3CBO A;  1PEG A;  3TG4 A;  3RQ4 A;  1MVH A;  5CCM A;  3KMT A;  3M55 A;  5F59 A;  5KJN A;  2F69 A;  5TTF A;  4JDS A;  3S8P A;  2IGQ A;  1N6A A;  4J83 A;  3HNA A;  5ARF A;  3DAL A;  4WUY A;  2RFI A;  3F9Z A;  3K5K A;  4J7I A;  3EP0 A;  3MO2 A;  3OS5 A;  4I51 A;  3QWP A;  3VV0 A;  4QEP A;  3KMJ A;  5EG2 A;  1ZKK A;  1MT6 A;  3S7F A;  3OPE A;  2R3A A;  3IHX A;  2W5Y A;  4YPA A;  2BQZ A;  3TG5 A;  1O9S A;  3SW9 A;  4YND A;  3KMA A;  4O6F A;  3M58 A;  3M56 A;  4FMU A;  4YPU A;  5CCL A;  1MVX A;  2G46 A;  5TEG A;  3RJW A;  3RAY A;  4BUP A;  5EX0 A;  1XQH A;  5JHN A;  2JV0 A;  5CPR B;  4IJD A;  3M57 A;  3DB5 A;  4H12 A;  5HQ8 A;  5KJM A;  3FPD A;  3M54 A;  1MUF A;  4NVQ A;  4LDG A;  5JIY A;  3QWW A;  1ML9 A;  3PDN A;  4J8O A;  2QPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...