3S8PA

Crystal structure of the set domain of human histone-lysine n-methyltransferase suv420h1 in complex with s-adenosyl-l-methionine
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
263
structure length
233
Chain Sequence
MSAKELCENDDLATSLVLDPYLGFQTHKMNTRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKEHVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEENMLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYTCERRGTGAFKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the human histone H4K20 methyltransferases SUV420H1 and SUV420H2.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SUV420H1
total genus 60
structure length 233
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1700 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3s8pA01
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s8pA02
3VUZA 3DB5A 3KMTA 3SW9A 3S8PA 1ZKKA 5HQ8A 5KJMA 5F6LA 3M56A 5EG2A 1PEGA 5JINA 5LSZA 3MO2A 3M57A 4IJDA 5LSXA 3CBOA 4YNPA 3TG5A 1ML9A 5HI7A 3RQ4A 5JJ0A 3QWWA 2W5ZA 3KMJA 3M54A 4YNMA 2BQZA 1N6AA 2IGQA 5CPRB 3M5AA 3OXLA 4FMUA 5JIYA 3MO5A 4JLGA 5AYFA 4E47A 5TTFA 4J83A 4BUPA 5TH7A 1XQHA 2F69A 1N6CA 3TG4A 3N71A 5EX0A 3F9ZA 3MEKA 3RU0A 4QENA 1MT6A 4NJ5A 5ARGA 3CBMA 3M55A 4AU7A 3RIBA 2JV0A 3RJWA 3MO0A 4O30A 4J7IA 3OS5A 4WUYA 4YPUA 3IHXA 2QPWA 5F5EA 4QEOA 4C1QA 5F6KC 4J8OA 3CBPA 4O6FA 1MVHA 1O9SA 3RAYA 5KJNA 4NVQA 5TEGA 5KJKA 5CCMA 3F9XA 2RFIA 3S7FA 4RZ0A 3QWPA 4JDSA 3DALA 1H3IA 3M59A 4YNDA 5JHNA 3KMAA 4I51A 4YPEA 3OPEA 3OXGA 3QWVA 3F9YA 4YPAA 5T0KA 1N3JA 3BO5A 5T5GA 5CCLA 2W5YA 3SWCA 5KJLA 3F9WA 4J7FA 4MI5A 3S7JA 3PDNA 5T0MA 3OOIA 2O8JA 4MI0A 1MUFA 3HNAA 3K5KA 3M58A 3VV0A 3S7DA 4Z4PA 4H12A 5ARFA 4IJ8A 1MVXA 3EP0A 3OXFA 5F59A 2R3AA 3S7BA 4QEPA 3FPDA 2G46A 5EX3A 3M53A 4LDGA
chains in the Genus database with same CATH superfamily
4B3XA 2K27A 1RUNA 4B09A 1MSEC 5H20A 4S0HB 4CCMA 2H09A 2MW8A 2E2HJ 2CH0A 4A3CJ 4P9FA 1R5ID 3KEOA 1O3SA 4XLNF 4ZYAA 4PJMA 3JAMZ 1TC3C 3TG5A 2ESNA 1JXSA 1FNNA 2Q1ZB 4GO1A 2MC4A 1KQ0A 4O6JA 3TGNA 1BJZA 1U5TC 3CCLI 3VFZA 2E2JJ 2E19A 4UV9A 2RNJA 3I0TA 3DPLC 4M6YA 5EJCA 4E47A 1XB4A 3R6SA 2FQ3A 2KJBA 2DYSH 2XGXA 3WTUC 3FXRA 1XQHA 2FNAA 4N4NB 2ACJA 3LSKA 4IRHA 4UXNA 1FOWA 2PMZN 3WTTC 2JRTA 4P5OA 2E35A 2B9SA 3CMAI 2AHQA 2R7SA 1HDPA 3G1OA 5TJJA 2Q8KA 4C2MJ 3C3WA 1XSXA 4ZYGA 2JV0A 3CUQC 1QBJA 1A31A 4WUYA 2PQ8A 3LSRA 4YIFA 1MNEA 1QA6A 3K10A 2NVTJ 1BI3A 2K4BA 3HRUA 4O3MA 1GVDA 4ZYEA 2XF7A 4PFPA 2V79A 2MLGA 2LMDA 2RFIA 1QO0D 5LRRA 2M34A 5FD6A 4OAZA 1ZYRF 2UXNA 3RI4A 3GX4X 5CYVA 2EWNA 3EYIA 4NB5A 5L3EA 3KP6A 1K6OA 3D5SC 3DALA 1LFUP 1Y8RB 2F5EA 3VB2A 2F4IA 5A2QZ 3M59A 5FROA 4YELA 1SFEA 3N97A 1LVAA 1A36A 3PNYA 4BJ6C 3BWGA 4XBFA 2O7OA 2DMUA 4EJUA 1ZRDA 3BCAA 2FUG2 4XLFA 3ZMZA 4IX7A 4DIQA 5K7FA 1YFHA 2CQQA 1O57A 2Z5UA 3S7JA 1IF1A 3QOEA 1UAAA 4WX9A 1W4MA 3OOIA 4BH9A 3DQVC 1YIOA 2F4OB 4ETSA 4C2UA 3KX2A 3WODF 1ETKA 3F72A 3TW6A 2EK5A 5FO5A 2H6CA 3K9TA 1XC5A 4BEHB 5IYCJ 4XLAA 4I2OA 3QP6A 3CLQA 4WXCA 3R4KA 2Y31A 2W48A 3LWFA 1JI8A 1AWCA 2EZLA 3HHGA 3S8PA 3VODA 3BJ6A 3LA2A 5BOXA 2UUZA 4FETA 3QWLA 3F8CA 1AU7A 1R6RA 1RI7A 2QQAA 1J5YA 3OMYA 3ZQIA 1VQLI 2E7XA 4EM1A 1USTA 4AD9A 4A3DJ 2NOJB 5F0HA 5CLSA 5L3BA 3I4PA 4Y17A 1Y6IA 2WAFA 3VYRB 2OUMA 2XHKA 3RZOJ 1RESA 2PN6A 2EILH 2NAZA 5CPRB 4FMUA 4EJWA 4KIFA 3A0BC 4W97A 2WY8Q 4FISA 1R23A 4DZPA 4HLXA 1J9IA 3D5RC 2DBBA 3CF5F 2EA4A 5JI6A 2A5YB 3DPTA 3SEZA 3L2VA 4YEJA 4UUVA 2VJ5A 3A1YA 2HVSA 3E6BA 5IPAA 3VYUB 5A2QK 1QVTA 1SMTA 2XUBA 2JQ7A 1SVOA 4QENA 3BZKA 5EEGA 3LSMA 2A05A 3OYBA 2CQXA 5HOOA 4S04A 3M55A 1IDYA 2R5YB 1PYVA 4NDLA 2R7TA 2RQPA 4G12A 5J3LA 1GVJA 4PJLA 1FP2A 3DF8A 3GF2A 1AOYA 2E1MB 2NNNA 3S3NA 4CCOA 3DTKA 1DP7P 4HG2A 2DDBA 2ZMEC 3HRSA 2LDUA 1WQ2A 1DU6A 5IP6A 3G73A 4XN3A 3JRHA 3TBIA 1B59A 3BDDA 4PK4A 3BZCA 3OS0A 4ANJA 3S2WA 3K4MA 1G3WA 3WTVC 4ZJZA 3CO7C 3S15J 4NQWB 2EFOA 4LK1F 5DTDA 3OXGA 5K5OA 1X1CA 4EJOA 1LDJA 5T0KA 5K7HA 2M5WA 4QIWN 1P4WA 1IUFA 1ZN2A 2X6XA 4KNYA 4RLFA 2NOGA 1MGTA 1J59A 2QSHX 2Q2EB 3ABTA 3JRGA 3QPSA 1LE8A 2X9DA 2XPVA 2L01A 4XLHA 5DYMA 4FTHA 3ZQ7A 3BG6A 1LDKB 1R7JA 2DTZA 2DI3A 2I8DA 1XCBA 2JVGA 3SQNA 2ZBKA 4BGDA 5JR3A 5HODA 3LSJA 1FSHA 1QHHD 5M5XJ 3SFIA 2YU9J 3DBLB 1VTNC 2DFHA 3F8NA 5FKMA 3PNVA 1K4SA 2L9RA 4M9ZA 1ZGAA 3H0DA 1SMYF 2EB7A 1SD6A 3SDGA 4HSRA 4HAMA 3MKYB 2HVRA 1YJ9I 4KUMA 4PDKA 3WTSC 3GO5A 1G2HA 2DA1A 2NS8A 4ZH4F 3DEEA 1STZA 4LLNA 3G1LA 1G8XA 5HS8A 3BG7A 3TP3A 1E0EA 4M74A 2P5LC 1ONVA 3QPTA 5J1RA 2JA2A 2XSJC 2ELJA 2ZO4A 2OU2A 5FLMJ 2OCEA 3CUOA 4U88A 5CQGA 1UB9A 1MZBA 2FMLA 5LHIA 1AKHB 3JW4A 5JFRA 4IHTA 1HF0A 1IAWA 3CMMA 2F6CA 1FMVA 3V8KA 3WGGA 3N71A 3AG3H 3CDHA 5EX0A 2WB1N 2FMYA 1XX5A 1J2XA 2V6CA 5HLGA 4RM2A 1BIAA 2TRTA 1QQIA 4UB6C 2JA6J 4JP0A 1KU2A 2FSWA 3CBMA 1OKRA 4HRIA 1TT5B 4ESFA 1R1TA 1RR8C 2RVCA 2V26A 3IHXA 4ENKA 1YRNA 3I9V2 3ECHA 3O3KA 1T8IA 2BXYA 3CBPA 3BR0A 4BE2A 2M1BA 1J75A 1VF9A 4CUGA 3M8JA 5TEGA 1VZ0A 1MJ9A 3TEDA 1HKSA 3ECOA 1ZH5A 1UMQA 3WTWC 3RPUD 3ZQGA 4L5JA 4E7KA 4K2EA 3S7FA 2V7FA 4PJ0C 3LNQA 5BMZA 1YS7A 2HPIA 2IRFG 1T39A 1EV7A 5HVQC 1U9NA 1YX5A 4N9HA 2CQ7A 1D1CA 1ETVA 3BTJA 3Q5FA 3T5XA 5DD8A 2JA8J 4HV5A 3QWVA 3OSGA 4D0PA 2YU3A 2XKOA 3ISPA 4HF2A 1Y0UA 3ZQQA 5D8LB 4OIOF 2PMZA 3WG9A 1SANA 3MCZA 4U7BA 3IAS2 2XDVA 4UVAA 3V8LA 1Y8QB 1PDNC 5KJLA 2B7EA 1D5YA 2H8RA 3FX3A 1X4OA 3QODA 1MMAA 4MI0A 3BJOA 3WU1B 3CC7I 3E7LA 2DLLA 1V4RA 1BOAA 3HSFA 2GXAA 4E7HA 2COBA 5IP7J 3UR3C 3GTLJ 1ZHFA 3J7AO 1FSEA 4N4OB 4OU0A 1ETOA 2A6EF 3KZIC 3LSHA 4CCNA 3EP0A 4MO7A 2VLAA 2ZFWA 2X51A 5BPIA 2LY9A 1IGNA 1O3RA 1DU0A 1G4DA 5J8CA 3IH2A 4D5FA 2GXGA 1E3HA 1B4AA 1WJDA 2FE3A 2LBFA 3LFUA 2ZB9A 4I09A 3ZP5A 2RDPA 2OV7A 4RAFA 1USSA 4MHGA 1XGMA 3H1CA 4A2UA 1VQ6I 1EKEA 3V7SA 5LSZA 3JRAA 1N75A 2E1OA 2JUCA 5DUIA 4IHYA 4IJDA 3CBOA 1XMAA 4M3DA 2GOXB 1R71A 1FYLA 4UVCA 4CYDA 3OYNA 1X4PA 3BJAA 2QUFA 3EQLF 5D5WB 1Z77A 2ADUA 2XRLA 2QBYB 3PO2J 3L7WA 3X2QH 1R00A 3HPHA 1VQ9I 1TW3A 4F52A 1OLTA 4CXFA 2BEOA 2JZYA 1IRGA 3C2HA 2IS4A 1E3PA 5GP9A 4MTEA 1WGXA 2EZKA 1RKTA 1J0RA 2ISZA 3QPHA 2IA0A 2F69A 2BY3A 4XN0A 5BQTA 5HLHA 2E2IJ 1V55H 5E18F 4RB3C 1XN7A 3LSGA 2H27A 1XSDA 4G7OF 2L4AA 4PUSA 5DM7F 2DMNA 2L9NA 4XLEA 3HC7A 4XNFA 1DUXC 1S6LA 1G3YA 3CUQA 4FCYA 4DJAA 4LITA 5ILSA 1AHDP 3FZVA 1HCRA 1VQOI 3S16J 2M0CA 5AONA 1WJ5A 2KQRA 2W7NA 4UUSA 2FF4A 3EUAA 5F5EA 1U78A 3CTAA 3W6KB 5GAGJ 4BU2A 4P96A 3J80K 1UHWA 1SFKA 3DU5A 5KJKA 5H6QA 1WH5A 4UUSB 3PJRA 4LIVA 2P4WA 1T6SA 5JHFA 4XKWA 5FRNA 3H5RA 5HLTA 1ETQA 3HGYA 2EPFA 2LC2A 2YUSA 5HDNA 5ED4A 2VQHA 4Y13A 4EQQA 4ZTFA 3IKTA 1NG6A 1KU3A 3CMYA 4OMZA 5J40A 3VOEA 2HDCA 5CVRA 2MD0A 4Y52J 1WI9A 1JKOC 3V4GA 3FMQA 4IQJA 2DOEA 5IYBJ 1N78A 1I50J 2X48A 3NWTA 5EZGA 4EV0A 1JKPC 2DJNA 1U3EM 4YIRX 1RPWA 3E6MA 4KITB 2DYRH 5KVRA 4E6KG 5LLQA 5B1BH 1MJAA 2V9KA 3JRCA 4B47A 2P8TA 2HI3A 1IXSB 4DYRA 3VV0A 3PIOF 1U2WA 2M4GA 4I99C 1SAUA 2X6WA 5F04A 2Z99A 5J6XA 2N8GA 3FMRA 1T2KA 2HPMA 2DCEA 2PEXA 4BXXJ 2KLOA 3SYTA 1BR4A 2W25A 2HYGD 2EINH 1FTZA 3JREA 3DB5A 1HW2A 1ZREA 1IN5A 1MBJA 3WTZA 2L5QA 1YS6A 2PFBA 2VPRA 5KJMA 1R5HA 1LQ1A 5FLVA 1GXPA 2EH3A 1W7PA 5AIQA 1PEGA 1IO2A 2CQNA 3L2UA 2PX9A 3QU6A 3ZMSA 2F5CA 2JSPA 4JX5A 4V2GA 4C3JJ 4YNPA 3ZR8X 3MWMA 4IO9F 3ABMH 1MMSA 1XS9A 4G94A 2KIMA 2M3AA 4CHUA 2HR3A 3BC8A 5K5RA 2E34A 3R0AA 1OR7C 2IGKA 2V9PA 1S7AA 4FE7A 4HDUA 1FLIA 3RPUA 3MO5A 2QENA 1MIJA 4A0XA 2YPRA 4I0BA 3OSFA 5JVGF 1YITI 1ZQ3P 2EV5A 1XGNA 3K69A 3KEQA 5J4VA 4M72A 1TWAJ 2P0WA 5IYDJ 4BL0B 2CS3A 3KP3A 2OA4A 4O5VA 1GLNA 2Y75A 3MD2A 2LF8A 2VASA 3ZMDA 4CA0A 1N6CA 3CCUI 3VWBA 1JUSA 4LIUA 3VPRA 1EA3A 2VBYA 1AA7A 4RGXA 2R5ZB 4ZDLA 2NXNB 3GBGA 3FXJA 3HKZA 1U9OA 4L5EA 3SHFA 2CRGA 1RNLA 4C9YA 1TNSA 1Y1WJ 1UHSA 4E7ZA 1VQPI 5CVIA 4HLYA 2P6SA 2MH2A 2X1DA 5F64A 4ON0A 3OYEA 1JUMA 1QZYA 3LQRA 3PSFA 4G6QA 3S1NJ 4QEOA 2KMUA 2HOEA 2Y30A 2MLKA 4XRSA 2VQLA 5HNHA 2A68F 2WADA 1FBSA 3PQJA 3K70C 1D8JA 4A93J 1A6IA 1YJNI 3RYRA 2JT1A 2PJPA 1D1BA 2E5ZA 4XM3A 2M8GX 4RGSA 4CH7A 5DCMB 2RC4A 2ZXIA 2KHMA 1IG7A 1MMNA 1OCZH 4ESBA 3TO7A 3J81Z 2HYFA 2R7XA 5GTHC 4Y4RA 2XB0X 4HX8A 4F3QA 2OZUA 4R79A 3M3YJ 1ZG1A 3MZ8A 3PUFA 4OWRB 3HNAA 3MKLA 1QZEA 2GWRA 4EATA 1ETXA 1T95A 5D6EA 3HOUJ 3BPVA 2NVXJ 4HNTA 1VFCA 2VXZA 2CJJA 3GTMJ 4G6TB 3S32A 3EETA 3FM5A 5J1YA 1REPC 2HXIA 2EFWA 4FE4A 1WJCA 3CCYA 5EX3A 3O2PE 5FGMA 3VUZA 4AC0A 3KMTA 2WAQA 4WK8F 3SW9A 3OYLA 3HJEA 4U0WA 4LB6B 2QSGX 3BOQA 2JA5J 1DPUA 4IRIA 3MKZA 5M5YJ 2X4HA 1NHAA 2BHZA 3G1MA 2E1MC 3BR1A 3L2WA 2X85A 1FBQA 1MMGA 1JJ8C 2OCCH 1TLHB 1B1BA 1U6GA 2Y9ZA 2EZIA 5HS9A 5FKOA 2XAQA 3OYCA 2Z3YA 4B4CA 2L7ZA 2NS0A 1ZGJA 3Q0WA 5EF6A 1PP7U 2HOSA 3OYMA 2LNBA 3CDIA 5JIYA 5BS6A 3CF2A 4JYKA 5HS7A 5JLXA 5FFZA 5KCMA 1I6XA 3M1EA 2FD5A 2L9SA 2NNYA 4LJZF 2IPQX 2XPUA 2EIJH 1E2XA 1R58A 1YQAA 2LSOA 1Z9CA 1WKMA 2K9QA 4YRVA 2CW7A 2KRCA 2KKOA 4I02A 1UZCA 4QTRA 3GTKJ 2ICWG 4HYEA 3FM3A 3HOZJ 3K4BA 2VI6A 4BQOA 4XICA 4PGGA 1MBGA 3SZGA 2FBIA 2LVSA 2DA7A 1IW7F 2QA4I 3KP4A 3D0SA 3L00A 2LY2A 2R93J 2Q0OA 5EGOB 2AXTC 3IWZA 3LSIA 2HKOA 1WJBA 2ZXJA 5EG0B 3JSPA 4B48A 3GW2A 1W36C 1JTXA 5AIPA 2XVCA 2STTA 1B8IB 2K7LA 4RZ0A 5K7ZA 4I6ZA 4BKXA 3BT9A 3JTGA 4IPAA 4KMFA 1LVKA 4BXUA 1FZPB 1R1VA 2YS9A 4CYCA 3BTLA 4G9YA 4MNUA 2GOMA 5C4JJ 4YNDA 2KPMA 3GUDA 1DGRM 3WTXC 1QRYA 3AKZA 3EDPA 1UFMA 2WAQN 5FRMA 2GLOA 1SEUA 2V4JC 4WF2A 1K4TA 1FOKA 2DAOA 2RN7A 1N3JA 2DA4A 4RAZA 3E6CC 2IXSA 4IOAF 2W5YA 4I01A 1R4NB 3GFLA 1QNTA 3WE3A 3PDNA 2UZKA 5L3DA 3I64A 2K85A 4L9TA 3AG1H 1M1EB 2BV6A 3BLYA 2STWA 2FU4A 2ME0A 5C44J 5LD2C 3CJQB 5EDNA 4H12A 3BZ6A 1LDDA 1IRXA 2K02A 3ONQA 4FQGA 2QWWA 4IF4A 1Z1DA 2V1DA 2X1CA 2PJRA 1CF7B 3K4CA 1MNMC 1I5ZA 5LEKA 1OISA 3H92A 4U7DA 4KIGA 4HDVA 3ABUA 2E5NA 1ERDA 2HYJA 5DUKA 3Q0VA 1X3UA 1HXDA 1MMDA 5JLWA 2HWVA 4I0AA 3S3MA 2DPUA 1IUYA 1BIBA 5L3FA 2Z9OA 1XDSA 2L2OA 3B73A 2G7UA 3PNTA 2JJ7A 2NS7A 3DCFA 4L9JA 3ZOBA 1W5SA 5EEAA 1ZKGA 2CQKA 3D5LA 2HQ5A 1ACIA 2HVQA 4MFEA 1VQ8I 2WA0A 5LGNA 3SJMA 3I71A 5GAHJ 3G4SI 2AO9A 1Z7UA 2JPBA 4ZC3A 2WB1A 1OCCH 1HA8A 3LMMA 2OZ6A 4XONA 3BG5A 2ZCWA 2EFQA 1U5TB 2W4SA 1UCRA 2GIZA 4MEYF 2V1NA 1S7EA 2OJED 1MBKA 3TG4A 4DBQA 3IV5A 1AKHA 3RU0A 1MNDA 1L0OC 2ZXWH 3QP5A 3VSKA 2XF6A 4OMYA 3RJWA 4BDZA 3E97A 3MFKA 1XSVA 3V7CA 3AG4H 5EG0A 1O3TA 3BPXA 2ZKZA 4KYWA 1P9QC 1O3QA 3GTOJ 3L9FA 4NVQA 3OV8A 2X1EA 3K4NA 1ETYA 1JT0A 3FXQA 3I5UA 1Z6RA 3HXLA 3WGIA 1MBEA 2ISYA 2IVMA 5F6FA 4A3JJ 5IOZA 4YFKF 1NK2P 1VQNI 1FBUA 2FQ4A 2KZGA 2JTVA 2XAFA 1X3ZB 2E60A 2DA2A 2ZNZA 4A3GJ 4B8XA 3J7ZI 1OYIA 2R7ZJ 3MEXA 3OPEA 3S2HJ 3DKWA 1X3WB 3ROUA 2B0LA 3GFIA 1PVEA 3ZN1A 4CCKA 1EJ9A 2LY1A 4CO8A 4A3LJ 3MMYB 4ESJA 2R7DA 4MI5A 5DS9A 1FT9A 4HV6A 2DDAA 2R3SA 1ZR2A 4HZFA 5D5XB 1WPKA 5ICEA 1PUFB 1N25A 1J7KA 2AXLA 2JWTA 1R5GA 3A4CA 1Y39A 3JRFA 2Y9YA 3FXUA 1YW9A 1EH8A 3VYTB 2QKMB 4A3MJ 2CMPA 2V6EA 3BTCA 5FKLA 3HOYJ 3WG7H 4LLGF 5LGTA 1MDMA 2FA5A 2CWEA 2OPTA 2LD5A 1J09A 2EV0A 2AS5F 3DLAA 4FASD 2DO7A 4ENJA 3H3ZA 3F8BA 3OY9A 4DBRA 3Q0UA 4RA2A 1KZHA 2GA1A 1F36A 4M73A 3H5NA 2W57A 3ZQLA 2HQAA 4R8HA 2Y2ZA 3QYEA 4U87A 4XKVA 1OMIA 3KETA 1TW2A 1JKQC 4BBSJ 1QZZA 2DMTA 3FKJA 3RQ4A 4PSWA 3RKQA 2XROA 4FX4A 3FXMA 2QCOA 1MDMB 5E1XA 2LOOA 2KZVA 2GQQA 3M1CA 3OWTA 2QZ8A 5LBQA 5TGTA 3C2BA 3ZMTA 3A02A 3L09A 4IEJA 1A5JA 2D5VA 3LL7A 2GIVA 2R7WA 1TL8A 2ZJQF 5B5EC 1SFXA 1JHHA 4XIDA 2K3FA 4XR6A 5TTFA 3TO6A 1SD5A 3F6VA 2M9HA 3VYSB 1LFPA 2JMWA 2V1XA 1TQMA 4U0YA 1WFXA 2ZSHB 3ZXSA 3F9ZA 5K1YA 4ENNA 1KGSA 4IHWA 4IKFA 4A3FJ 2MBFA 4NJ5A 2IJLA 5ARGA 2QEXI 2VJ4A 3GZ6A 4RS8A 3J81K 4LOCA 1FOXA 4YPUA 2VKVA 3B02A 1WSUA 4KIBA 1Z0XA 1UG0A 1U8BA 4XRSG 3GWZA 1OPCA 4DQ2A 3Q3SA 3CDLA 2COMA 4NUBA 4G8XA 5GAEJ 1Z05A 3U1KA 2DFIA 4WXHA 4EJVA 4ZTJA 1HW5A 4WXDA 4OIPF 1CF7A 3CCJI 1IDZA 1DP3A 2ZFUA 1Z3YA 1H9GA 2CV1A 3KP2A 3BQZA 1H9TA 2FJ1A 1QGPA 3K6GA 5D4SA 4BE0A 3BR6A 2ZMEA 3KYLA 2IS6A 2WAEA 5F1RA 1OCTC 4YPAA 2R92J 1MH4A 4D1QA 4OINF 4IQ4A 2R7OA 5T5GA 2L7KA 3GVAA 3O8HA 3OL3A 2R4GA 1XMKA 2CU7A 1H88C 1B9MA 2FBKA 3VEPA 3SFZA 1RUOA 1MUFA 1I27A 3GMEA 2R7FA 3ESWB 1A35A 3JSOA 1YG2A 3M9AA 2HGCA 2ME6A 4CCLA 2LKSA 3W2VA 1DDNA 4M6VA 1LPQA 2HQNA 3P7NA 3BR2A 4M3BA 2R3AA 3E0JB 3T1BA 3CC2I 3PFYA 1KONA 4Z2YA 3FPDA 5FB2A 2YSRA 2BY0A 3FXKA 4XLPF 2K3PA 4GGGA 4Y3OA 4A3IJ 6PAXA 2DXIA 1WRJA 1V54H 3P9CA 3LA7A 3P5JA 1HLVA 2ETHA 4XOTA 1FWZA 3QYBA 3JRBA 1WWXA 1UG2A 4J00A 1U8RA 4MFDA 3OR1C 4PZJA 2LKPA 2EBIA 1T56A 2BVLA 3PUBA 4V19K 2F4MB 2D45A 2HDDA 3RIRA 2PBIA 2EIMH 4GYIA 1HBXG 1BI1A 5B66C 1LB2A 1X1PA 5TISC 1N6AA 2VKDA 4EVIA 4JLGA 1H8AC 4MTDA 3CZ6A 3H9JA 2V9VA 4BUPA 5M3FJ 5TH7A 4FX0A 2OD5A 2LYCA 2E7WA 1OJLA 4BY7J 1GDTA 1RIOH 3HOSA 3S1RJ 2DTRA 3ZQCA 2MD5A 1BBYA 2P7CB 1E3OC 1D1AA 3FK7A 2KJCA 2KISA 1ON1A 4KICA 3S1MJ 1XMXA 2Z1DA 4AM3A 1B72A 1HKTA 3DU6A 2XAUA 4RLQA 1WHUA 3PIPF 3ELKA 2CUFA 1K6YA 2LKXA 1P6RA 1JGGA 2O0YA 3J7AY 5J4YA 1SVLA 2R5ZA 3G2BA 2ESHA 1T08B 2HS5A 4M3FA 4HSTA 5LHHA 1FYMA 2CUJA 1H3IA 5BNGA 4AIJA 2C6YA 1X1DA 2NVQJ 3IH4A 4EGYA 2K86A 3H5AA 4A12A 5B1AH 2BW3B 2MFZA 4EM0B 3ZQFA 3Q9SA 3P9KA 1K78A 3OOUA 2CV2A 1X2MA 3JTHA 2VQGA 5LRSA 2EIKH 2O8JA 2UWMA 4RB0A 4JBAA 4DW6A 3GLXA 4LD5A 4RGRA 4LG3A 3R0JA 2HXOA 2VOOA 2ECCA 2BXZA 2CGPA 4E4HA 3LA3A 1RRJA 1WJEA 4AIDA 4RB1A 4QEPA 2YX4A 5DDGA 4IVNA 3G71I 2NVUB 2E71A 2ECBA 1LFBA 2NYXA 2FOKA 1ENHA 3DTEA 3PFIA 2HEOA 1ZKKA 3CD6I 3CJTB 1YW7A 4MIMA 2E1NA 5HLIA 3HHHA 5KAFC 3LOCA 3W6VA 2I5UA 4C2TA 3M57A 4MQVA 1IZ1A 3FKIJ 4J01A 5JJ0A 4BQQA 5F1JA 4IJAA 4HX7A 4D7MA 2E36A 3DP7A 2QYOA 5ERIA 3E5UA 4N9IA 4KN7X 2Y48A 2LK2A 1T0FA 4XQFA 3G6EI 2G0EA 5M5WJ 2M0MA 4XK4A 2WV1A 2G7HA 2F2EA 5ILVA 1PP8F 1T38A 3HG9A 3K0LA 3LAJA 3AL0B 4J83A 5D6FA 4C3IJ 4CZCA 1RZ4A 2IA2A 1S72I 4RM3A 3L2RA 1N77A 1HSTA 2M45A 5KHDA 2RQQA 1S8NA 1JKRC 1K83J 3GTJJ 1NTCA 3WHCA 5FLXZ 2Y0SA 4X0GA 4C30A 3D1NI 1BA5A 1JJ6C 4IRGA 1D5VA 2KDZA 1TBXA 2H1LA 2QQ9A 3E1SA 4RBOA 2W82A 2XIGA 2H6BA 2JSCA 3DKXA 2PLYA 4BHPA 2MC3A 3T0YA 3GTPJ 3EUKL 2A6TA 3I59A 2KRHA 2VQCA 3I3LA 3I54A 1FIAA 3M07A 4M9XA 3BY6A 3RQIA 3KE2A 4F92B 2VBXA 4YFNF 3ASOH 1YOVB 1TWHJ 4D5CA 4EMSA 1B6AA 2CUZA 4ZZDA 1HOMA 1YIJI 3DBHB 1W36D 3BROA 1GV2A 2XV4S 1ORKA 1JGSA 4LK0F 3GCMA 3QYFA 4BHBA 1L3LA 1VQ5I 2A61A 1HC8A 3V8JA 3ZPLA 1X1AA 3DXJF 3E5QA 4JX4A 4X6AJ 5CCLA 2RV8A 2BOLA 2IGOA 1OQYA 1W1WE 4QLCU 3T8TA 4LMYA 2CW8A 2ZJ2A 2LR8A 4YFXF 1TZLA 1P2FA 5H6RA 3KZYA 1SFUA 2HU9A 3H36A 4P1WA 1WZ2A 2HOTA 3C2GA 2BY2A 3FBNB 2D1HA 1MVXA 2HFHA 3LSTA 4E70A 3DFGA 2YR2A 3RYPA 3L2CA 1B72B 2P81A 3CMEI 3NQOA 1YYVA 3H3UA 3NEUA 2D1VA 3HOXJ 4A6EA 3HKZN 4XMYA 1Y0NA 2DN0A 2K9SA 1V5GA 4DZJA 5EG2A 1O7FA 1YO5C 1YX3A 3DEUA 3KYCB 5J8FA 4F93B 1BR2A 3A2KA 3HPGA 2DQLA 5B3SH 1YLFA 1B8IA 3C18A 5D5UB 1EH6A 2XKPA 3K4LA 4ENMA 1R49A 3FDYA 3GZNB 4D7NA 3IUOA 1YRNB 5FLXK 2BQZA 2IGQA 1IXCA 3M5AA 5EEHA 3A01B 3IWFA 3F23A 1WH7A 2O9LA 1V5EA 1GHCA 4AYBN 1IRFA 4M6XA 4UVBA 4C3HJ 3TO9A 1P7JA 3CQZJ 3IKVA 1PJRA 4FHTA 2IBDA 3HYIA 2VIXA 3TL4X 4Y33A 3CLOA 3H9QA 5E1WA 1FC3A 2QLZA 5EYRA 5IP9J 3EUHA 1MT6A 4HQEA 2LLKA 3BR5A 4L18B 1KYWA 4DGWB 3HEFA 1ULYA 3PQKA 1O7LA 3OYHA 3K4KA 2H1KA 3MO0A 2XPWA 2IT0A 3H3VK 2XAGA 4IL6C 3I4NJ 3WU0A 1GV5A 2Z16A 3CCMI 2OAZA 4C1QA 1OCPA 4KT6A 3PSIA 5DD4A 2KP6A 2LFBA 3TQNA 5D8KB 3RSNA 2WV0A 2XAJA 3NARA 1ODDA 4OOIA 3U9GA 1DQUA 2KIQA 2MSYA 1BL0A 5DEQA 2EZHA 2Z33A 2A69F 4AVPA 4E7LA 3OYDA 2M4KA 2WC2A 3HDDA 1Q1HA 1S3JA 1W7PD 5GTIC 5FJ8J 1HKQA 4ZDOA 3L2QA 1T0FC 4ASNA 2F48A 2IGMA 2HTSA 4BJTA 2XAHA 3W2AA 3F21A 1C0WA 4G6DA 3CP8A 5HDGA 3L1PA 1FTTA 3BO5A 4EGZA 3K1NA 1TQIA 3ASNH 1CGPA 4E7IA 3F9WA 2ID3A 4UHTA 5IOYA 1YJWI 4XL9A 2O61A 4JQFA 2JVHA 3M58A 4GYGA 2FRHA 3OYFA 1FMWA 2EQRA 3FXLA 4ABZA 4KT5C 1VQKI 3RTRA 1GT0C 2CO5A 2OTLI 1XPXA 3REOA 3WTYC 3I56I 3M53A 2CYYA 4P9UA 1IN7A 4F55A 4GFBA 4X1EA 4Q4ZF 3N4MA 2R7RA 5F6LA 4L5IA 3M56A 4GRIA 1QHGA 3ZN0A 3FISA 4AIKA 2I10A 3DWLE 2G9WA 3CJNA 3I59B 3WHBA 4M3GA 4DYQA 4BNCA 2QGUA 4Q47A 2OF7A 4AIHA 3ZCOA 3LAPA 4A3BJ 2W5ZA 1O4XA 2RAEA 5KAIC 3E3VA 3I58A 3M54A 2LBFB 1I1SA 2A07F 2DOFA 2QSFX 1W0TA 4HNUA 3QQAA 3O6BB 3IRQA 3QU3A 2PMUA 3H0GJ 2ELKA 2DMQA 2QBYA 1XGOA 3ULQB 2VC1A 5GPAA 2KT0A 4JOMA 5KK1A 4IHSA 1IV8A 4H0EA 3FF5A 1PUFA 1DGWY 2VT2A 1LE8B 2M7AA 3Q9VA 2LF7A 3W2WA 1P4AA 4LGWA 4AU7A 1LJ9A 2VL8A 5EGOA 3ABKH 3AG2H 2B63J 4TV7A 2RKHA 2O8KA 4NC8A 5LFAA 2L0KA 5E8IA 3JRDA 1FEXA 2HDWA 1ZRCA 2M30A 5HNFA 2JK3A 3HTUA 1R9TJ 3M4OJ 4Q5SF 2BVMA 3RAYA 2KDOA 1F1ZA 3ML6A 4UB8C 2BYVE 3BG9A 1OR7A 4F91B 3P9IA 2W84A 4H4KC 2DFFA 2DW4A 4KJZA 4Q48A 2OQRA 3U1DA 2GXBA 5CQEA 2RNGA 1XG1A 2KIUA 4PSXA 1YI2I 4JDSA 2BW3A 2ID6A 2PJRB 4UY8I 1OFCX 2IEKA 3C1DA 3GEZA 3MZHA 1D3YA 1WJFA 4L9VA 4A69C 5JHNA 2VXDA 2XF5A 4AYBA 5E79C 2TCTA 5J47A 1JUPA 1B9NA 1IC8A 4HF1A 2UV1A 2F5DA 4CDGA 3F9YA 2CV0A 4GCVA 2CW0F 1LEBA 1ZLJA 3BTIA 1K7AA 3KYDB 3WE2A 3EPZA 4DOZA 4S05A 4MQ9F 5FD5A 1APLC 1LKXA 3AAFA 4A0ZA 3K2ZA 3TW7A 4XSZF 3RKWA 3HSRA 1Z67A 3T8RA 5GPCA 3OYJA 4M71A 3C7JA 2DFEA 1JHFA 4AWXB 2VONA 2LRDA 5LHGA 2NVYJ 5C4XJ 5F0FA 3S7BA 2DMPA 3G3ZA 1TNTA 4XKBA 4RDUA 2GBYA 3SZTA 3HTSB 4KISA 5E3LA 2DJIA 1HDDC 2VBWA 3GLLA 1HW1A 5E3NA 3HOVJ 1F9NA 1QU3A 2H94A 1XD7A 1P7IA 2BZTA 3ZGKA 4RGUA 2MA3A 2FBHA 3ZMVA 2VBZA 2GA2A 2O3FA 2XGDA 1I6HJ 4GXOA 3GZ5A 1OYYA 4BJ5C 1W5TA 4UNOA 1BW6A 2JUGA 3IRRA 1U5TA 3OYIA 2FNPA 4BE1A 2L54A 1BW5A 4II3A 4AVZA 2CFOA 1D0YA 4Y7NJ 4YNMA 2M2EA 3JAMK 3HUGA 3OR2C 4MEXF 5L3CA 3GFMA 2PI0A 1BI0A 4QSHA 4IOCF 4KN4X 1GXQA 2CUEA 3OIOA 2EV6A 5C3EJ 3COAC 3OOPA 1FX7A 2IP2A 1QVUA 3F8MA 3MQ0A 1KU9A 2VE8A 3PM1A 4E7JA 3DTIA 3FBIB 5CVUA 5BPDA 2AQEA 4HPQA 2BBYA 4IHXA 1MH3A 1A6QA 2M8EA 4Z6YA 3K1MA 2JPCA 2Q2EA 2TDXA 4IZZA 2V1UA 2QF7A 3O8GA 1Z91A 2VKEA 2QM3A 4JX6A 5E3OA 1IV6A 4NQWA 4CICA 4I98B 3S14J 1NH3A 2Y0MA 4O6FA 4ZDPA 3MN2A 1IRZA 1O9SA 4CZZA 2QQ8A 3K2AA 1P92A 5D4RA 5CCMA 1YTYA 2HQRA 2JN6A 3KLNA 3IL2A 4EJTA 3A03A 3KPHA 4W1UA 3HB9A 5DM6F 1FYKA 1YE9A 2R7VA 5FKNA 4F7ZA 2L7MP 2FXAA 2FX0A 1VI0A 2DQRA 4I51A 2KFDA 4CCJA 4YPEA 4UUTA 1TWFJ 2R5YA 4YG2F 4P55A 2DA6A 2DU9A 2W1OA 3S93A 1E17A 4G7HF 3KCCA 2P5VA 4A5MA 3ERED 4CYCB 2K5CA 5T0MA 3V7RA 3CC4I 2BHYA 1MW7A 2WY7Q 3SDBA 1CQTA 3WGHA 4R1HA 4A3KJ 1EF4A 5FFXA 1F43A 3IH3A 4PGHA 1ZLKA 3WU2C 1V5FA 5ARFA 1OCOH 3K7AJ 2ZMEB 4CSWA 1FJLA 1MBHA 3DLLF 2LH9A 1P4XA 5E17F 5JVTA 3BP8A 4RMNA 1JT6A 3GTGJ 2QKLB 2M87A 5E8GA 4KDPA 3NRVA 3F3XA 5HQ8A 3TDUC 2BGCA 4BBRJ 3GXOA 1BJAA 3HUGB 4OAYA 2DOAA 4MGRA 1G3TA 4ITVA 4QWQA 5JHUA 1BC7C 4HBLA 2K9MA 4II2A 2O8XA 4GDFA 3NAUA 5HI7A 1SD4A 2F5VA 3J7YJ 3KP5A 3KMJA 3DV8A 1BN5A 1ETWA 4BY1J 2Z2SB 2VUMJ 4HF0A 5K5QA 3OYGA 1SC7A 1T98A 1I3QJ 3F6OA 2IA1A 3OIQA 3M8FA 3JR9A 3CO6C 2HOAA 1VQ7I 3E6DA 2KRFA 2H8WA 4M9SA 3IHUA 5AYFA 5F27A 3ZQHA 4XLCA 5LEJA 2HZTA 4N0BA 1D0XA 1I39A 4HQMA 3HBLA 2QVOA 1Y1VJ 5GADJ 3NWSA 3FMSA 2X0LA 3ERMA 3MEKA 2IS1A 2WBMA 3RDIA 4ZYHA 3QRFF 2VC0A 2VB6A 2X6OA 2O03A 4EEFG 3GYHX 3RIBA 3OS2A 2KIFA 2EJRA 1DPRA 4NHJA 3HRTA 2JA7J 5F0CA 2R7UA 2ZXHA 3F22A 2QPWA 5H2FC 3U21A 4DYCA 1NK3P 4BDYA 2J5OA 5KJNA 1IN6A 5DCMA 2OTJI 2GAUA 3M8EA 2EFPA 2UXXA 2IW5A 4XKCA 3FK6A 5E1ZB 4G7ZF 3F9XA 4ZZLA 5KNLA 3CP2A 4PCQA 2MABA 2O6GE 3VDXA 1QPMA 3KZZA 2ELHA 4B3AA 1XGSA 4PFOA 4XRFA 2DPDA 2W85A 3QOPA 3UKGA 5E3MA 1KQ8A 4U0VA 2ZJPF 1HSJA 4QPQA 4DNCA 2DODA 2ZC2A 3RZDJ 4KFCA 1MKMA 3FIWA 3QAHA 1U0JA 1S9HA 3RKXA 2GM4A 2OC6A 1Z7LA 1ZRFA 4WCGA 4L9NA 3MAJA 2P5KA 4HOBA 4BAYA 3F9KA 3MVPA 1FP1D 2L4MA 3TKYA 4LG0B 3FXOA 2VT3A 5J1UA 4EM2A 1IXRC 4RAYA 2WWYA 4IJ8A 3OXFA 2NRAC 4XSXF 4LB5A 2D2WA 3HRMA 4UV8A 1H89C 1QPIA 3CCSI 1XDUA 2DA3A 2VODA 4BACA 1LNWA 1ON2A 3HIFA 1UJ8A 2DA5A 2AQFA 2M7BA 3E5XA 1V3FA 3TOAA 4B43A 5ICGA 4WWCA 1RKWA 3M7GA 5CKTA 1X2NA 3F8FA 3HM5A 1JTYA 3HZJA 4KA4A 3KLOA 4V2FA 1G59A 1K78B 1TTYA 2R0QC 3HOWJ 3MO2A 1FIPA 1R22A 3RCOA 3HSEA 1D8KA 4NC6A 3BCBA 3PL8A 9ANTA 1ML9A 2EFNA 3A01A 5EZHA 3S17J 2IGNA 2BY1A 1Y56A 4BS9A 1PUEE 1W7PB 3W3CA 1R36A 3DKYA 4LG0A 2F5FA 4J19A 3OXLA 1TWCJ 2MGQA 2VOPA 4HW0A 1BR1A 2LREA 3CESA 1ZG3A 2YX7A 5IY5H 3AFHA 1IN8A 3KIOA 3TOBA 1XTAA 1RC9A 5CJ9A 2ZNYA 3JCUC 1LUJB 3GFJA 4PJNA 1F5TA 2IS2A 1VNDA 1JE8A 1D0ZA 1TQPA 2K9NA 2KL4A 1G6NA 4ZYDA 4RB2C 4L0ZB 3CCVI 3GTQJ 1X19A 1NG7A 3S2DJ 2O5RA 1R1UA 1G3SA 3KP7A 4O30A 4J7IA 1TWGJ 2L9VA 2LTPA 4OIRF 2WTEA 4XRMA 3OS5A 1WCMJ 2LP0A 4LLLA 3SZPA 3LFKA 3MZYA 3KEYA 5F6KC 5IT3A 1Q1VA 1ZR4A 2DT6A 2CG4A 1BOBA 4XOPA 1Z3XA 5CVVA 1YHQI 5DV5A 2BE5F 4D9JA 1TT0A 4XORA 3TMOA 4E7SA 1Z6TA 3CJRB 4HNVA 1MSFC 1K79A 1KU7A 2VPLA 1ZARA 2MH9A 3DEWA 2QQBA 5HDKA 2ZSIB 1SD7A 5ICCA 2MYSA 2CSOA 3EYYA 1SFOJ 2DK5A 3BQYA 3F0CA 4I7HA 1SAXA 3K4JA 1S7OA 4IHVA 4KMUX 1IN4A 3CCQI 4HEA2 4NNJA 2K9LA 2P6TA 5TRDA 4A0YA 4L0YB 2J5PA 1ITYA 3TDZC 2R7QA 3I4MJ 2JRMA 2FOWA 3IAM2 3UNGC 4BEHA 3S3OA 1MJBA 3AL0C 3K5KA 2Y69H 1T33A 1X1BA 3OYKA 3VSLA 3S7DA 3KFWX 3FHNA 3DPUA 5FKKA 4FT8A 1HQCA 3BR3A 3OIPA 3I55I 2VE9A 4LDGA 2HNHA 2FEZA 2OBPA 4BQAA 1POGA 3B6AA 4RAGA 4BQNA 1LEAA 4A5NA 4BXFA 3HOTA 1Z21A 2A3SA 1YW8A 1WI3A 3N05A 2L3DA 5D5VB 2XASA 3IP4B 3K1PA 5JINA 1S5LC 2K4JA 4CGZA 2XRNA 1FOYA 5LSXA 2HTJA 1ZELA 5LGUA 2W24A 3TP0A 3QWWA 3DBRB 1S29A 1WVRA 4YIIA 5IT9Z 4AUXA 4BHCA 5E20A 1F4KA 5CVJA 2L7FP 3B6CA 5IT9K 3BG3A 2P7VB 3A0HC 2RREA 2VJIA 1H0MA 3SXYA 3ZRGA 1WJAA 3ABLH 1ZGWA 5L3GA 3FHZA 4MLOA 3QPLA 1ZG5A 3U2RA 4NBQA 1OYWA 5ILUA 2MG4A 4Y15A 2LG4A 2PG4A 3HL2A 3SEQA 2E1CA 4A6DA 1IJWC 2PMHA 3R61A 3MKWB 2GZWA 3J80Z 1UHMA 1XCVA 1ZK8A 4HX4A 3H35A 1SVMA 2A5WA 1FY7A 1RETA 2HZDA 2L02A 1W0UA 3IC7A 4OIQF 1RR7A 1OCRH 2K40A 1MBFA 3K70D 4J8OA 1TP4A 3EUHC 3OYAA 1MVHA 1MD0A 2RGVA 2OQGA 4BYYA 1EH7A 3LSPA 2XSDC 2CFXA 2XC7A 1ZAOA 3V42A 2DK8A 4M3EA 1X58A 2HKXA 1K61A 3QWPA 3CCEI 1KYZA 3CUQB 3R60A 2VJJA 3I53A 1GUUA 4B44A 1VQMI 2ZJRF 1I1GA 4LFUA 3KMAA 4IXAA 2EA2A 4PJJA 3OL4A 3RPQA 5DCFA 2XB5A 1ZTRA 1BM9A 1UELB 4B1RA 3HGGA 1VQ4I 3LQQA 2DT7B 4QPOA 2X6YA 1R4MB 4NC7A 2XGCA 2XGEA 4HA8A 3SWCA 2VN2A 5ICFA 2W00A 4J7FA 3OS1A 3H9GA 5M3MJ 1I3AA 3RJPA 2DT5A 2A6HF 1BI2A 2VKHA 5F08A 3S1QJ 1A04A 4Z4PA 1KA8A 3CCRI 1W5CC 3ZMUA 3RKYA 3JRIA 3W6JB 1KQ9A 2Y0SN 5F59A 2IAIA 4A3EJ 4JK1X 1BC8C 3PO3J 2G46A 1FPQA 3FWEA 4I76A
chains in the Genus database with same CATH topology
2K3PA 4Y3OA 4B3XA 3DB5A 2DXIA 2L5QA 1QU3A 4CCMA 5KJMA 3ZGKA 4XOTA 3QYBA 2CH0A 1PEGA 4J00A 4BJ5C 3OR1C 4ZYAA 3L2UA 2JSPA 4PJMA 4YNPA 3ZR8X 2BVLA 3PUBA 3TG5A 2JUGA 2Q1ZB 2MC4A 3OYIA 4BE1A 2M3AA 4YNMA 3BC8A 4II3A 2CFOA 1D0YA 4AVZA 1N6AA 1OR7C 3OR2C 2IGKA 2VKDA 3MO5A 4JLGA 3DPLC 3CZ6A 4E47A 3H9JA 4BUPA 5TH7A 1XQHA 2P0WA 2LYCA 4BL0B 2CS3A 4N4NB 3LSKA 1GLNA 3MD2A 2VASA 4CA0A 3HOSA 4E7JA 1N6CA 3DTIA 3VWBA 3FBIB 4LIUA 2AQEA 4HPQA 1EA3A 1AA7A 4P5OA 4ZDLA 3GBGA 1D1AA 2R7SA 3HKZA 4IZZA 4C9YA 2JV0A 4E7ZA 2X1DA 2Z1DA 4WUYA 3OYEA 3PSFA 4QEOA 2KMUA 3DU6A 4O6FA 1MNEA 2XAUA 4RLQA 2VQLA 3K10A 4ZDPA 5HNHA 1O9SA 2WADA 1K6YA 2XF7A 4PFPA 3J7AY 5CCMA 2RFIA 3K70C 3G2BA 4OAZA 4HSTA 3D5SC 1D1BA 1YE9A 2CUJA 2E5ZA 4XM3A 2R7VA 1H3IA 2F4IA 3DALA 3M59A 1X1DA 5FROA 4YELA 4CH7A 4I51A 4CCJA 3PNYA 3H5AA 4BJ6C 4YPEA 2ZXIA 2KHMA 2BW3B 2MFZA 1MMNA 3BCAA 2FUG2 4XLFA 4IX7A 4DIQA 2W1OA 3S93A 2R7XA 3OOUA 2CV2A 4Y4RA 2VQGA 4F3QA 3S7JA 1UAAA 3QOEA 2K5CA 4R79A 5T0MA 3OOIA 2O8JA 3DQVC 1MW7A 2UWMA 2WY7Q 3SDBA 4OWRB 3HNAA 4EATA 4C2UA 4LG3A 1T95A 3KX2A 4HNTA 1V5FA 5ARFA 2VXZA 4BEHB 4E4HA 4XLAA 4G6TB 3S32A 1WJEA 4CSWA 4QEPA 1WJCA 5EX3A 2LH9A 3VUZA 4RMNA 2QKLB 1JI8A 3KMTA 2WAQA 3DTEA 3S8PA 3OYLA 3SW9A 1ZKKA 5HQ8A 2UUZA 4FETA 3HUGB 1R6RA 4OAYA 3MKZA 2DOAA 3L2WA 2E1MC 3OMYA 2X85A 4ITVA 1MMGA 3M57A 4C2TA 2K9MA 4II2A 2NOJB 5HI7A 4J01A 1Y6IA 2F5VA 2WAFA 4BQQA 5JJ0A 3KMJA 3VYRB 2OUMA 2Z2SB 3OYCA 3OYGA 5CPRB 4XQFA 3OIQA 3OYMA 4FMUA 5JIYA 3CF2A 2M0MA 2WY8Q 5AYFA 5KCMA 3D5RC 3HG9A 4XLCA 3AL0B 4J83A 3DPTA 2L9SA 3SEZA 4CZCA 1D0XA 4YEJA 3L2VA 4RM3A 2VJ5A 3L2RA 1N77A 5KHDA 3A1YA 2RQQA 2HVSA 3VYUB 4YRVA 2CW7A 2KRCA 3NWSA 3MEKA 2IS1A 2WBMA 4QENA 4X0GA 2Y0SA 4C30A 3LSMA 3K4BA 3OYBA 2VB6A 4BQOA 5HOOA 3M55A 3RIBA 3SZGA 3OS2A 1PYVA 3E1SA 2R7TA 2R7UA 2W82A 2ZXHA 3DKXA 2QPWA 3U21A 2LY2A 4PJLA 2E1MB 3S3NA 4BDYA 4CCOA 3EUKL 5KJNA 3DTKA 4HG2A 2A6TA 3LSIA 2KRHA 1WJBA 2VQCA 4XKCA 3F9XA 4B48A 1W36C 3I3LA 5KNLA 3CP2A 2MABA 4RZ0A 4XN3A 3TBIA 4PK4A 3VDXA 4F92B 3OS0A 4ANJA 4PFOA 1LVKA 3K4MA 2CUZA 2GOMA 4ZJZA 4YNDA 4QPQA 1W36D 2KPMA 1DGRM 3AKZA 4NQWB 3OXGA 1X1CA 3QYFA 5T0KA 1U0JA 5FRMA 1S9HA 2V4JC 1N3JA 1X1AA 5CCLA 2IXSA 2W5YA 2OC6A 2BOLA 2IGOA 2X6XA 3PDNA 1Z7LA 4RLFA 2CW8A 2Q2EB 1TZLA 3F9KA 3BLYA 5LD2C 3CJQB 2HU9A 4H12A 4XLHA 4P1WA 1IRXA 3ONQA 3C2GA 3FBNB 1LDKB 3BG6A 2JVGA 2I8DA 1MVXA 3OXFA 4BGDA 2X1CA 2PJRA 1QHHD 3K4CA 4BACA 2AQFA 2M7BA 3PNVA 4B43A 2E5NA 4XMYA 1ERDA 5CKTA 3H0DA 1V5GA 5EG2A 1G59A 4HSRA 1YX3A 1MMDA 3MKYB 2HVRA 3MO2A 3RCOA 4F93B 3S3MA 1BR2A 3BCBA 3PL8A 3A2KA 3HPGA 1ML9A 2IGNA 1Y56A 3DEEA 4BS9A 3K4LA 1G8XA 3BG7A 3FDYA 3W3CA 2L2OA 3DKYA 3IUOA 3PNTA 1E0EA 2BQZA 2IGQA 3M5AA 3OXLA 3D5LA 2JA2A 1V5EA 2ELJA 1BR1A 2HVQA 2LREA 3CESA 2WA0A 2XSJC 3AFHA 4ZC3A 2WB1A 1HA8A 3LMMA 5CQGA 1PJRA 4XONA 2W4SA 3CMMA 2VIXA 3TL4X 2F6CA 1FMVA 2V1NA 4Y33A 3TG4A 3N71A 3H9QA 4PJNA 4DBQA 5EX0A 2IS2A 1D0ZA 3RU0A 4RM2A 1MNDA 1MT6A 2KL4A 3VSKA 2XF6A 4DGWB 1X19A 3CBMA 1NG7A 3OYHA 2O5RA 3K4KA 4HRIA 3RJWA 4BDZA 3MO0A 4O30A 4J7IA 2V26A 3OS5A 3IHXA 2Z16A 3I9V2 3KEYA 4C1QA 5F6KC 3CBPA 1P9QC 4BE2A 4KT6A 3PSIA 2KP6A 3RSNA 4NVQA 4CUGA 2DT6A 3M8JA 5TEGA 1VZ0A 2X1EA 1BOBA 3K4NA 4XOPA 3RPUD 1Z3XA 1DQUA 3HXLA 4E7KA 3S7FA 2V7FA 4D9JA 4E7LA 3OYDA 1TT0A 2M4KA 4XORA 2HPIA 3TMOA 4E7SA 3CJRB 5HVQC 2VPLA 1YX5A 4ZDOA 2E60A 3L2QA 1T0FC 1D1CA 2IGMA 4BJTA 2ZSIB 3W2AA 2MYSA 3OPEA 3QWVA 3ZQQA 3CP8A 2PMZA 3K4JA 3BO5A 4U7BA 4CCKA 3IAS2 2LY1A 2XDVA 2K9LA 4HEA2 3MMYB 4NNJA 4E7IA 5KJLA 3F9WA 4MI5A 2R7QA 1X4OA 3QODA 1MMAA 3AL0C 3IAM2 3UNGC 4BEHA 3S3OA 4XL9A 4MI0A 3K5KA 4JQFA 2JVHA 3M58A 1X1BA 3OYKA 3VSLA 3OYFA 3S7DA 1FMWA 4E7HA 3UR3C 4N4OB 3FHNA 3DPUA 3A4CA 3LSHA 3RTRA 4CCNA 3EP0A 2VLAA 3OIPA 2X51A 3VYTB 2QKMB 3M53A 2CMPA 2V6EA 4LDGA 2HNHA 1WJDA 2LBFA 4BQNA 3LFUA 4F55A 1J09A 4BXFA 3HOTA 3DLAA 1Z21A 2R7RA 5F6LA 4FASD 2OV7A 3M56A 3N05A 4GRIA 4DBRA 3OY9A 1QHGA 3IP4B 5JINA 3H5NA 5LSZA 3DWLE 1N75A 2HQAA 4IJDA 4U87A 5LSXA 3QYEA 4XKVA 3CBOA 2GOXB 3FKJA 1ZELA 3ZCOA 3RQ4A 4PSWA 3QWWA 3OYNA 2W5ZA 1X4PA 3M54A 2LBFB 2LOOA 2KZVA 3M1CA 3OWTA 5TGTA 3HPHA 4F52A 1OLTA 4HNUA 3LL7A 2R7WA 2RREA 2VJIA 3C2HA 4XR6A 3ZRGA 2IS4A 5TTFA 1WJAA 3VYSB 4MLOA 2F69A 4JOMA 1LFPA 4XN0A 3LSGA 1WFXA 2ZSHB 3ZXSA 1DGWY 3F9ZA 2LG4A 4PUSA 3HL2A 3SEQA 4IKFA 2L9NA 4XLEA 4NJ5A 5ARGA 3HC7A 2M7AA 3W2WA 4XNFA 4AU7A 3MKWB 2VJ4A 2VL8A 4DJAA 4LITA 2A5WA 3H35A 2HZDA 4NC8A 4YPUA 5LFAA 1WJ5A 2KQRA 2HDWA 2W7NA 3EUAA 5F5EA 1UG0A 5HNFA 3K70D 4J8OA 3OYAA 3EUHC 4BU2A 2BVMA 1MVHA 3RAYA 2KDOA 1SFKA 3DU5A 4NUBA 4F91B 4H4KC 5KJKA 4KJZA 2XC7A 5CQEA 4LIVA 3V42A 3PJRA 4ZTJA 2RNGA 5JHFA 4XKWA 4PSXA 5FRNA 3H5RA 3QWPA 4JDSA 5HLTA 2BW3A 2PJRB 1DP3A 2LC2A 2ZFUA 1Z3YA 2CV1A 2VQHA 2VJJA 4B44A 4ZTFA 1NG6A 3K6GA 5JHNA 1WJFA 3KMAA 2VXDA 2XF5A 4AYBA 4BE0A 4PJJA 2MD0A 3OL4A 2IS6A 2UV1A 3KYLA 2WAEA 3F9YA 4YPAA 2CV0A 1UELB 4IQJA 4D1QA 1N78A 4IQ4A 2DT7B 2R7OA 4QPOA 3EPZA 2L7KA 2X6YA 3NWTA 4NC7A 4DOZA 5T5GA 3SWCA 1LKXA 3OL3A 2W00A 4J7FA 2R4GA 3OS1A 4KITB 4E6KG 3H9GA 3OYJA 2V9KA 1MUFA 4B47A 2VKHA 3VV0A 4CCLA 4Z4PA 2LRDA 2M4GA 1SAUA 2X6WA 3W2VA 5F59A 2HPMA 2R3AA 3E0JB 4XKBA 3S7BA 2DCEA 3PFYA 1KONA 3FPDA 2KLOA 3SYTA 1BR4A 2G46A 4KISA 4IJ8A 2DJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VUZ A;  3DB5 A;  3KMT A;  3SW9 A;  3S8P A;  1ZKK A;  5HQ8 A;  5KJM A;  5F6L A;  3M56 A;  5EG2 A;  1PEG A;  5JIN A;  5LSZ A;  3MO2 A;  3M57 A;  4IJD A;  5LSX A;  3CBO A;  4YNP A;  3TG5 A;  1ML9 A;  5HI7 A;  3RQ4 A;  5JJ0 A;  3QWW A;  2W5Z A;  3KMJ A;  3M54 A;  4YNM A;  2BQZ A;  1N6A A;  2IGQ A;  5CPR B;  3M5A A;  3OXL A;  4FMU A;  5JIY A;  3MO5 A;  4JLG A;  5AYF A;  4E47 A;  5TTF A;  4J83 A;  4BUP A;  5TH7 A;  1XQH A;  2F69 A;  1N6C A;  3TG4 A;  3N71 A;  5EX0 A;  3F9Z A;  3MEK A;  3RU0 A;  4QEN A;  1MT6 A;  4NJ5 A;  5ARG A;  3CBM A;  3M55 A;  4AU7 A;  3RIB A;  2JV0 A;  3RJW A;  3MO0 A;  4O30 A;  4J7I A;  3OS5 A;  4WUY A;  4YPU A;  3IHX A;  2QPW A;  5F5E A;  4QEO A;  4C1Q A;  5F6K C;  4J8O A;  3CBP A;  4O6F A;  1MVH A;  1O9S A;  3RAY A;  5KJN A;  4NVQ A;  5TEG A;  5KJK A;  5CCM A;  3F9X A;  2RFI A;  3S7F A;  4RZ0 A;  3QWP A;  4JDS A;  3DAL A;  1H3I A;  3M59 A;  4YND A;  5JHN A;  3KMA A;  4I51 A;  4YPE A;  3OPE A;  3OXG A;  3QWV A;  3F9Y A;  4YPA A;  5T0K A;  1N3J A;  3BO5 A;  5T5G A;  5CCL A;  2W5Y A;  3SWC A;  5KJL A;  3F9W A;  4J7F A;  4MI5 A;  3S7J A;  3PDN A;  5T0M A;  3OOI A;  2O8J A;  4MI0 A;  1MUF A;  3HNA A;  3K5K A;  3M58 A;  3VV0 A;  3S7D A;  4Z4P A;  4H12 A;  5ARF A;  4IJ8 A;  1MVX A;  3EP0 A;  3OXF A;  5F59 A;  2R3A A;  3S7B A;  4QEP A;  3FPD A;  2G46 A;  5EX3 A;  3M53 A;  4LDG A; 
#chains in the Genus database with same CATH topology
 4B3X A;  2K27 A;  1RUN A;  4B09 A;  1MSE C;  5H20 A;  4S0H B;  4CCM A;  2H09 A;  2MW8 A;  2E2H J;  2CH0 A;  4A3C J;  4P9F A;  1R5I D;  3KEO A;  1O3S A;  4XLN F;  4ZYA A;  4PJM A;  3JAM Z;  1TC3 C;  3TG5 A;  2ESN A;  1JXS A;  1FNN A;  2Q1Z B;  4GO1 A;  2MC4 A;  1KQ0 A;  4O6J A;  3TGN A;  1BJZ A;  1U5T C;  3CCL I;  3VFZ A;  2E2J J;  2E19 A;  4UV9 A;  2RNJ A;  3I0T A;  3DPL C;  4M6Y A;  5EJC A;  4E47 A;  1XB4 A;  3R6S A;  2FQ3 A;  2KJB A;  2DYS H;  2XGX A;  3WTU C;  3FXR A;  1XQH A;  2FNA A;  4N4N B;  2ACJ A;  3LSK A;  4IRH A;  4UXN A;  1FOW A;  2PMZ N;  3WTT C;  2JRT A;  4P5O A;  2E35 A;  2B9S A;  3CMA I;  2AHQ A;  2R7S A;  1HDP A;  3G1O A;  5TJJ A;  2Q8K A;  4C2M J;  3C3W A;  1XSX A;  4ZYG A;  2JV0 A;  3CUQ C;  1QBJ A;  1A31 A;  4WUY A;  2PQ8 A;  3LSR A;  4YIF A;  1MNE A;  1QA6 A;  3K10 A;  2NVT J;  1BI3 A;  2K4B A;  3HRU A;  4O3M A;  1GVD A;  4ZYE A;  2XF7 A;  4PFP A;  2V79 A;  2MLG A;  2LMD A;  2RFI A;  1QO0 D;  5LRR A;  2M34 A;  5FD6 A;  4OAZ A;  1ZYR F;  2UXN A;  3RI4 A;  3GX4 X;  5CYV A;  2EWN A;  3EYI A;  4NB5 A;  5L3E A;  3KP6 A;  1K6O A;  3D5S C;  3DAL A;  1LFU P;  1Y8R B;  2F5E A;  3VB2 A;  2F4I A;  5A2Q Z;  3M59 A;  5FRO A;  4YEL A;  1SFE A;  3N97 A;  1LVA A;  1A36 A;  3PNY A;  4BJ6 C;  3BWG A;  4XBF A;  2O7O A;  2DMU A;  4EJU A;  1ZRD A;  3BCA A;  2FUG 2;  4XLF A;  3ZMZ A;  4IX7 A;  4DIQ A;  5K7F A;  1YFH A;  2CQQ A;  1O57 A;  2Z5U A;  3S7J A;  1IF1 A;  3QOE A;  1UAA A;  4WX9 A;  1W4M A;  3OOI A;  4BH9 A;  3DQV C;  1YIO A;  2F4O B;  4ETS A;  4C2U A;  3KX2 A;  3WOD F;  1ETK A;  3F72 A;  3TW6 A;  2EK5 A;  5FO5 A;  2H6C A;  3K9T A;  1XC5 A;  4BEH B;  5IYC J;  4XLA A;  4I2O A;  3QP6 A;  3CLQ A;  4WXC A;  3R4K A;  2Y31 A;  2W48 A;  3LWF A;  1JI8 A;  1AWC A;  2EZL A;  3HHG A;  3S8P A;  3VOD A;  3BJ6 A;  3LA2 A;  5BOX A;  2UUZ A;  4FET A;  3QWL A;  3F8C A;  1AU7 A;  1R6R A;  1RI7 A;  2QQA A;  1J5Y A;  3OMY A;  3ZQI A;  1VQL I;  2E7X A;  4EM1 A;  1UST A;  4AD9 A;  4A3D J;  2NOJ B;  5F0H A;  5CLS A;  5L3B A;  3I4P A;  4Y17 A;  1Y6I A;  2WAF A;  3VYR B;  2OUM A;  2XHK A;  3RZO J;  1RES A;  2PN6 A;  2EIL H;  2NAZ A;  5CPR B;  4FMU A;  4EJW A;  4KIF A;  3A0B C;  4W97 A;  2WY8 Q;  4FIS A;  1R23 A;  4DZP A;  4HLX A;  1J9I A;  3D5R C;  2DBB A;  3CF5 F;  2EA4 A;  5JI6 A;  2A5Y B;  3DPT A;  3SEZ A;  3L2V A;  4YEJ A;  4UUV A;  2VJ5 A;  3A1Y A;  2HVS A;  3E6B A;  5IPA A;  3VYU B;  5A2Q K;  1QVT A;  1SMT A;  2XUB A;  2JQ7 A;  1SVO A;  4QEN A;  3BZK A;  5EEG A;  3LSM A;  2A05 A;  3OYB A;  2CQX A;  5HOO A;  4S04 A;  3M55 A;  1IDY A;  2R5Y B;  1PYV A;  4NDL A;  2R7T A;  2RQP A;  4G12 A;  5J3L A;  1GVJ A;  4PJL A;  1FP2 A;  3DF8 A;  3GF2 A;  1AOY A;  2E1M B;  2NNN A;  3S3N A;  4CCO A;  3DTK A;  1DP7 P;  4HG2 A;  2DDB A;  2ZME C;  3HRS A;  2LDU A;  1WQ2 A;  1DU6 A;  5IP6 A;  3G73 A;  4XN3 A;  3JRH A;  3TBI A;  1B59 A;  3BDD A;  4PK4 A;  3BZC A;  3OS0 A;  4ANJ A;  3S2W A;  3K4M A;  1G3W A;  3WTV C;  4ZJZ A;  3CO7 C;  3S15 J;  4NQW B;  2EFO A;  4LK1 F;  5DTD A;  3OXG A;  5K5O A;  1X1C A;  4EJO A;  1LDJ A;  5T0K A;  5K7H A;  2M5W A;  4QIW N;  1P4W A;  1IUF A;  1ZN2 A;  2X6X A;  4KNY A;  4RLF A;  2NOG A;  1MGT A;  1J59 A;  2QSH X;  2Q2E B;  3ABT A;  3JRG A;  3QPS A;  1LE8 A;  2X9D A;  2XPV A;  2L01 A;  4XLH A;  5DYM A;  4FTH A;  3ZQ7 A;  3BG6 A;  1LDK B;  1R7J A;  2DTZ A;  2DI3 A;  2I8D A;  1XCB A;  2JVG A;  3SQN A;  2ZBK A;  4BGD A;  5JR3 A;  5HOD A;  3LSJ A;  1FSH A;  1QHH D;  5M5X J;  3SFI A;  2YU9 J;  3DBL B;  1VTN C;  2DFH A;  3F8N A;  5FKM A;  3PNV A;  1K4S A;  2L9R A;  4M9Z A;  1ZGA A;  3H0D A;  1SMY F;  2EB7 A;  1SD6 A;  3SDG A;  4HSR A;  4HAM A;  3MKY B;  2HVR A;  1YJ9 I;  4KUM A;  4PDK A;  3WTS C;  3GO5 A;  1G2H A;  2DA1 A;  2NS8 A;  4ZH4 F;  3DEE A;  1STZ A;  4LLN A;  3G1L A;  1G8X A;  5HS8 A;  3BG7 A;  3TP3 A;  1E0E A;  4M74 A;  2P5L C;  1ONV A;  3QPT A;  5J1R A;  2JA2 A;  2XSJ C;  2ELJ A;  2ZO4 A;  2OU2 A;  5FLM J;  2OCE A;  3CUO A;  4U88 A;  5CQG A;  1UB9 A;  1MZB A;  2FML A;  5LHI A;  1AKH B;  3JW4 A;  5JFR A;  4IHT A;  1HF0 A;  1IAW A;  3CMM A;  2F6C A;  1FMV A;  3V8K A;  3WGG A;  3N71 A;  3AG3 H;  3CDH A;  5EX0 A;  2WB1 N;  2FMY A;  1XX5 A;  1J2X A;  2V6C A;  5HLG A;  4RM2 A;  1BIA A;  2TRT A;  1QQI A;  4UB6 C;  2JA6 J;  4JP0 A;  1KU2 A;  2FSW A;  3CBM A;  1OKR A;  4HRI A;  1TT5 B;  4ESF A;  1R1T A;  1RR8 C;  2RVC A;  2V26 A;  3IHX A;  4ENK A;  1YRN A;  3I9V 2;  3ECH A;  3O3K A;  1T8I A;  2BXY A;  3CBP A;  3BR0 A;  4BE2 A;  2M1B A;  1J75 A;  1VF9 A;  4CUG A;  3M8J A;  5TEG A;  1VZ0 A;  1MJ9 A;  3TED A;  1HKS A;  3ECO A;  1ZH5 A;  1UMQ A;  3WTW C;  3RPU D;  3ZQG A;  4L5J A;  4E7K A;  4K2E A;  3S7F A;  2V7F A;  4PJ0 C;  3LNQ A;  5BMZ A;  1YS7 A;  2HPI A;  2IRF G;  1T39 A;  1EV7 A;  5HVQ C;  1U9N A;  1YX5 A;  4N9H A;  2CQ7 A;  1D1C A;  1ETV A;  3BTJ A;  3Q5F A;  3T5X A;  5DD8 A;  2JA8 J;  4HV5 A;  3QWV A;  3OSG A;  4D0P A;  2YU3 A;  2XKO A;  3ISP A;  4HF2 A;  1Y0U A;  3ZQQ A;  5D8L B;  4OIO F;  2PMZ A;  3WG9 A;  1SAN A;  3MCZ A;  4U7B A;  3IAS 2;  2XDV A;  4UVA A;  3V8L A;  1Y8Q B;  1PDN C;  5KJL A;  2B7E A;  1D5Y A;  2H8R A;  3FX3 A;  1X4O A;  3QOD A;  1MMA A;  4MI0 A;  3BJO A;  3WU1 B;  3CC7 I;  3E7L A;  2DLL A;  1V4R A;  1BOA A;  3HSF A;  2GXA A;  4E7H A;  2COB A;  5IP7 J;  3UR3 C;  3GTL J;  1ZHF A;  3J7A O;  1FSE A;  4N4O B;  4OU0 A;  1ETO A;  2A6E F;  3KZI C;  3LSH A;  4CCN A;  3EP0 A;  4MO7 A;  2VLA A;  2ZFW A;  2X51 A;  5BPI A;  2LY9 A;  1IGN A;  1O3R A;  1DU0 A;  1G4D A;  5J8C A;  3IH2 A;  4D5F A;  2GXG A;  1E3H A;  1B4A A;  1WJD A;  2FE3 A;  2LBF A;  3LFU A;  2ZB9 A;  4I09 A;  3ZP5 A;  2RDP A;  2OV7 A;  4RAF A;  1USS A;  4MHG A;  1XGM A;  3H1C A;  4A2U A;  1VQ6 I;  1EKE A;  3V7S A;  5LSZ A;  3JRA A;  1N75 A;  2E1O A;  2JUC A;  5DUI A;  4IHY A;  4IJD A;  3CBO A;  1XMA A;  4M3D A;  2GOX B;  1R71 A;  1FYL A;  4UVC A;  4CYD A;  3OYN A;  1X4P A;  3BJA A;  2QUF A;  3EQL F;  5D5W B;  1Z77 A;  2ADU A;  2XRL A;  2QBY B;  3PO2 J;  3L7W A;  3X2Q H;  1R00 A;  3HPH A;  1VQ9 I;  1TW3 A;  4F52 A;  1OLT A;  4CXF A;  2BEO A;  2JZY A;  1IRG A;  3C2H A;  2IS4 A;  1E3P A;  5GP9 A;  4MTE A;  1WGX A;  2EZK A;  1RKT A;  1J0R A;  2ISZ A;  3QPH A;  2IA0 A;  2F69 A;  2BY3 A;  4XN0 A;  5BQT A;  5HLH A;  2E2I J;  1V55 H;  5E18 F;  4RB3 C;  1XN7 A;  3LSG A;  2H27 A;  1XSD A;  4G7O F;  2L4A A;  4PUS A;  5DM7 F;  2DMN A;  2L9N A;  4XLE A;  3HC7 A;  4XNF A;  1DUX C;  1S6L A;  1G3Y A;  3CUQ A;  4FCY A;  4DJA A;  4LIT A;  5ILS A;  1AHD P;  3FZV A;  1HCR A;  1VQO I;  3S16 J;  2M0C A;  5AON A;  1WJ5 A;  2KQR A;  2W7N A;  4UUS A;  2FF4 A;  3EUA A;  5F5E A;  1U78 A;  3CTA A;  3W6K B;  5GAG J;  4BU2 A;  4P96 A;  3J80 K;  1UHW A;  1SFK A;  3DU5 A;  5KJK A;  5H6Q A;  1WH5 A;  4UUS B;  3PJR A;  4LIV A;  2P4W A;  1T6S A;  5JHF A;  4XKW A;  5FRN A;  3H5R A;  5HLT A;  1ETQ A;  3HGY A;  2EPF A;  2LC2 A;  2YUS A;  5HDN A;  5ED4 A;  2VQH A;  4Y13 A;  4EQQ A;  4ZTF A;  3IKT A;  1NG6 A;  1KU3 A;  3CMY A;  4OMZ A;  5J40 A;  3VOE A;  2HDC A;  5CVR A;  2MD0 A;  4Y52 J;  1WI9 A;  1JKO C;  3V4G A;  3FMQ A;  4IQJ A;  2DOE A;  5IYB J;  1N78 A;  1I50 J;  2X48 A;  3NWT A;  5EZG A;  4EV0 A;  1JKP C;  2DJN A;  1U3E M;  4YIR X;  1RPW A;  3E6M A;  4KIT B;  2DYR H;  5KVR A;  4E6K G;  5LLQ A;  5B1B H;  1MJA A;  2V9K A;  3JRC A;  4B47 A;  2P8T A;  2HI3 A;  1IXS B;  4DYR A;  3VV0 A;  3PIO F;  1U2W A;  2M4G A;  4I99 C;  1SAU A;  2X6W A;  5F04 A;  2Z99 A;  5J6X A;  2N8G A;  3FMR A;  1T2K A;  2HPM A;  2DCE A;  2PEX A;  4BXX J;  2KLO A;  3SYT A;  1BR4 A;  2W25 A;  2HYG D;  2EIN H;  1FTZ A;  3JRE A;  3DB5 A;  1HW2 A;  1ZRE A;  1IN5 A;  1MBJ A;  3WTZ A;  2L5Q A;  1YS6 A;  2PFB A;  2VPR A;  5KJM A;  1R5H A;  1LQ1 A;  5FLV A;  1GXP A;  2EH3 A;  1W7P A;  5AIQ A;  1PEG A;  1IO2 A;  2CQN A;  3L2U A;  2PX9 A;  3QU6 A;  3ZMS A;  2F5C A;  2JSP A;  4JX5 A;  4V2G A;  4C3J J;  4YNP A;  3ZR8 X;  3MWM A;  4IO9 F;  3ABM H;  1MMS A;  1XS9 A;  4G94 A;  2KIM A;  2M3A A;  4CHU A;  2HR3 A;  3BC8 A;  5K5R A;  2E34 A;  3R0A A;  1OR7 C;  2IGK A;  2V9P A;  1S7A A;  4FE7 A;  4HDU A;  1FLI A;  3RPU A;  3MO5 A;  2QEN A;  1MIJ A;  4A0X A;  2YPR A;  4I0B A;  3OSF A;  5JVG F;  1YIT I;  1ZQ3 P;  2EV5 A;  1XGN A;  3K69 A;  3KEQ A;  5J4V A;  4M72 A;  1TWA J;  2P0W A;  5IYD J;  4BL0 B;  2CS3 A;  3KP3 A;  2OA4 A;  4O5V A;  1GLN A;  2Y75 A;  3MD2 A;  2LF8 A;  2VAS A;  3ZMD A;  4CA0 A;  1N6C A;  3CCU I;  3VWB A;  1JUS A;  4LIU A;  3VPR A;  1EA3 A;  2VBY A;  1AA7 A;  4RGX A;  2R5Z B;  4ZDL A;  2NXN B;  3GBG A;  3FXJ A;  3HKZ A;  1U9O A;  4L5E A;  3SHF A;  2CRG A;  1RNL A;  4C9Y A;  1TNS A;  1Y1W J;  1UHS A;  4E7Z A;  1VQP I;  5CVI A;  4HLY A;  2P6S A;  2MH2 A;  2X1D A;  5F64 A;  4ON0 A;  3OYE A;  1JUM A;  1QZY A;  3LQR A;  3PSF A;  4G6Q A;  3S1N J;  4QEO A;  2KMU A;  2HOE A;  2Y30 A;  2MLK A;  4XRS A;  2VQL A;  5HNH A;  2A68 F;  2WAD A;  1FBS A;  3PQJ A;  3K70 C;  1D8J A;  4A93 J;  1A6I A;  1YJN I;  3RYR A;  2JT1 A;  2PJP A;  1D1B A;  2E5Z A;  4XM3 A;  2M8G X;  4RGS A;  4CH7 A;  5DCM B;  2RC4 A;  2ZXI A;  2KHM A;  1IG7 A;  1MMN A;  1OCZ H;  4ESB A;  3TO7 A;  3J81 Z;  2HYF A;  2R7X A;  5GTH C;  4Y4R A;  2XB0 X;  4HX8 A;  4F3Q A;  2OZU A;  4R79 A;  3M3Y J;  1ZG1 A;  3MZ8 A;  3PUF A;  4OWR B;  3HNA A;  3MKL A;  1QZE A;  2GWR A;  4EAT A;  1ETX A;  1T95 A;  5D6E A;  3HOU J;  3BPV A;  2NVX J;  4HNT A;  1VFC A;  2VXZ A;  2CJJ A;  3GTM J;  4G6T B;  3S32 A;  3EET A;  3FM5 A;  5J1Y A;  1REP C;  2HXI A;  2EFW A;  4FE4 A;  1WJC A;  3CCY A;  5EX3 A;  3O2P E;  5FGM A;  3VUZ A;  4AC0 A;  3KMT A;  2WAQ A;  4WK8 F;  3SW9 A;  3OYL A;  3HJE A;  4U0W A;  4LB6 B;  2QSG X;  3BOQ A;  2JA5 J;  1DPU A;  4IRI A;  3MKZ A;  5M5Y J;  2X4H A;  1NHA A;  2BHZ A;  3G1M A;  2E1M C;  3BR1 A;  3L2W A;  2X85 A;  1FBQ A;  1MMG A;  1JJ8 C;  2OCC H;  1TLH B;  1B1B A;  1U6G A;  2Y9Z A;  2EZI A;  5HS9 A;  5FKO A;  2XAQ A;  3OYC A;  2Z3Y A;  4B4C A;  2L7Z A;  2NS0 A;  1ZGJ A;  3Q0W A;  5EF6 A;  1PP7 U;  2HOS A;  3OYM A;  2LNB A;  3CDI A;  5JIY A;  5BS6 A;  3CF2 A;  4JYK A;  5HS7 A;  5JLX A;  5FFZ A;  5KCM A;  1I6X A;  3M1E A;  2FD5 A;  2L9S A;  2NNY A;  4LJZ F;  2IPQ X;  2XPU A;  2EIJ H;  1E2X A;  1R58 A;  1YQA A;  2LSO A;  1Z9C A;  1WKM A;  2K9Q A;  4YRV A;  2CW7 A;  2KRC A;  2KKO A;  4I02 A;  1UZC A;  4QTR A;  3GTK J;  2ICW G;  4HYE A;  3FM3 A;  3HOZ J;  3K4B A;  2VI6 A;  4BQO A;  4XIC A;  4PGG A;  1MBG A;  3SZG A;  2FBI A;  2LVS A;  2DA7 A;  1IW7 F;  2QA4 I;  3KP4 A;  3D0S A;  3L00 A;  2LY2 A;  2R93 J;  2Q0O A;  5EGO B;  2AXT C;  3IWZ A;  3LSI A;  2HKO A;  1WJB A;  2ZXJ A;  5EG0 B;  3JSP A;  4B48 A;  3GW2 A;  1W36 C;  1JTX A;  5AIP A;  2XVC A;  2STT A;  1B8I B;  2K7L A;  4RZ0 A;  5K7Z A;  4I6Z A;  4BKX A;  3BT9 A;  3JTG A;  4IPA A;  4KMF A;  1LVK A;  4BXU A;  1FZP B;  1R1V A;  2YS9 A;  4CYC A;  3BTL A;  4G9Y A;  4MNU A;  2GOM A;  5C4J J;  4YND A;  2KPM A;  3GUD A;  1DGR M;  3WTX C;  1QRY A;  3AKZ A;  3EDP A;  1UFM A;  2WAQ N;  5FRM A;  2GLO A;  1SEU A;  2V4J C;  4WF2 A;  1K4T A;  1FOK A;  2DAO A;  2RN7 A;  1N3J A;  2DA4 A;  4RAZ A;  3E6C C;  2IXS A;  4IOA F;  2W5Y A;  4I01 A;  1R4N B;  3GFL A;  1QNT A;  3WE3 A;  3PDN A;  2UZK A;  5L3D A;  3I64 A;  2K85 A;  4L9T A;  3AG1 H;  1M1E B;  2BV6 A;  3BLY A;  2STW A;  2FU4 A;  2ME0 A;  5C44 J;  5LD2 C;  3CJQ B;  5EDN A;  4H12 A;  3BZ6 A;  1LDD A;  1IRX A;  2K02 A;  3ONQ A;  4FQG A;  2QWW A;  4IF4 A;  1Z1D A;  2V1D A;  2X1C A;  2PJR A;  1CF7 B;  3K4C A;  1MNM C;  1I5Z A;  5LEK A;  1OIS A;  3H92 A;  4U7D A;  4KIG A;  4HDV A;  3ABU A;  2E5N A;  1ERD A;  2HYJ A;  5DUK A;  3Q0V A;  1X3U A;  1HXD A;  1MMD A;  5JLW A;  2HWV A;  4I0A A;  3S3M A;  2DPU A;  1IUY A;  1BIB A;  5L3F A;  2Z9O A;  1XDS A;  2L2O A;  3B73 A;  2G7U A;  3PNT A;  2JJ7 A;  2NS7 A;  3DCF A;  4L9J A;  3ZOB A;  1W5S A;  5EEA A;  1ZKG A;  2CQK A;  3D5L A;  2HQ5 A;  1ACI A;  2HVQ A;  4MFE A;  1VQ8 I;  2WA0 A;  5LGN A;  3SJM A;  3I71 A;  5GAH J;  3G4S I;  2AO9 A;  1Z7U A;  2JPB A;  4ZC3 A;  2WB1 A;  1OCC H;  1HA8 A;  3LMM A;  2OZ6 A;  4XON A;  3BG5 A;  2ZCW A;  2EFQ A;  1U5T B;  2W4S A;  1UCR A;  2GIZ A;  4MEY F;  2V1N A;  1S7E A;  2OJE D;  1MBK A;  3TG4 A;  4DBQ A;  3IV5 A;  1AKH A;  3RU0 A;  1MND A;  1L0O C;  2ZXW H;  3QP5 A;  3VSK A;  2XF6 A;  4OMY A;  3RJW A;  4BDZ A;  3E97 A;  3MFK A;  1XSV A;  3V7C A;  3AG4 H;  5EG0 A;  1O3T A;  3BPX A;  2ZKZ A;  4KYW A;  1P9Q C;  1O3Q A;  3GTO J;  3L9F A;  4NVQ A;  3OV8 A;  2X1E A;  3K4N A;  1ETY A;  1JT0 A;  3FXQ A;  3I5U A;  1Z6R A;  3HXL A;  3WGI A;  1MBE A;  2ISY A;  2IVM A;  5F6F A;  4A3J J;  5IOZ A;  4YFK F;  1NK2 P;  1VQN I;  1FBU A;  2FQ4 A;  2KZG A;  2JTV A;  2XAF A;  1X3Z B;  2E60 A;  2DA2 A;  2ZNZ A;  4A3G J;  4B8X A;  3J7Z I;  1OYI A;  2R7Z J;  3MEX A;  3OPE A;  3S2H J;  3DKW A;  1X3W B;  3ROU A;  2B0L A;  3GFI A;  1PVE A;  3ZN1 A;  4CCK A;  1EJ9 A;  2LY1 A;  4CO8 A;  4A3L J;  3MMY B;  4ESJ A;  2R7D A;  4MI5 A;  5DS9 A;  1FT9 A;  4HV6 A;  2DDA A;  2R3S A;  1ZR2 A;  4HZF A;  5D5X B;  1WPK A;  5ICE A;  1PUF B;  1N25 A;  1J7K A;  2AXL A;  2JWT A;  1R5G A;  3A4C A;  1Y39 A;  3JRF A;  2Y9Y A;  3FXU A;  1YW9 A;  1EH8 A;  3VYT B;  2QKM B;  4A3M J;  2CMP A;  2V6E A;  3BTC A;  5FKL A;  3HOY J;  3WG7 H;  4LLG F;  5LGT A;  1MDM A;  2FA5 A;  2CWE A;  2OPT A;  2LD5 A;  1J09 A;  2EV0 A;  2AS5 F;  3DLA A;  4FAS D;  2DO7 A;  4ENJ A;  3H3Z A;  3F8B A;  3OY9 A;  4DBR A;  3Q0U A;  4RA2 A;  1KZH A;  2GA1 A;  1F36 A;  4M73 A;  3H5N A;  2W57 A;  3ZQL A;  2HQA A;  4R8H A;  2Y2Z A;  3QYE A;  4U87 A;  4XKV A;  1OMI A;  3KET A;  1TW2 A;  1JKQ C;  4BBS J;  1QZZ A;  2DMT A;  3FKJ A;  3RQ4 A;  4PSW A;  3RKQ A;  2XRO A;  4FX4 A;  3FXM A;  2QCO A;  1MDM B;  5E1X A;  2LOO A;  2KZV A;  2GQQ A;  3M1C A;  3OWT A;  2QZ8 A;  5LBQ A;  5TGT A;  3C2B A;  3ZMT A;  3A02 A;  3L09 A;  4IEJ A;  1A5J A;  2D5V A;  3LL7 A;  2GIV A;  2R7W A;  1TL8 A;  2ZJQ F;  5B5E C;  1SFX A;  1JHH A;  4XID A;  2K3F A;  4XR6 A;  5TTF A;  3TO6 A;  1SD5 A;  3F6V A;  2M9H A;  3VYS B;  1LFP A;  2JMW A;  2V1X A;  1TQM A;  4U0Y A;  1WFX A;  2ZSH B;  3ZXS A;  3F9Z A;  5K1Y A;  4ENN A;  1KGS A;  4IHW A;  4IKF A;  4A3F J;  2MBF A;  4NJ5 A;  2IJL A;  5ARG A;  2QEX I;  2VJ4 A;  3GZ6 A;  4RS8 A;  3J81 K;  4LOC A;  1FOX A;  4YPU A;  2VKV A;  3B02 A;  1WSU A;  4KIB A;  1Z0X A;  1UG0 A;  1U8B A;  4XRS G;  3GWZ A;  1OPC A;  4DQ2 A;  3Q3S A;  3CDL A;  2COM A;  4NUB A;  4G8X A;  5GAE J;  1Z05 A;  3U1K A;  2DFI A;  4WXH A;  4EJV A;  4ZTJ A;  1HW5 A;  4WXD A;  4OIP F;  1CF7 A;  3CCJ I;  1IDZ A;  1DP3 A;  2ZFU A;  1Z3Y A;  1H9G A;  2CV1 A;  3KP2 A;  3BQZ A;  1H9T A;  2FJ1 A;  1QGP A;  3K6G A;  5D4S A;  4BE0 A;  3BR6 A;  2ZME A;  3KYL A;  2IS6 A;  2WAE A;  5F1R A;  1OCT C;  4YPA A;  2R92 J;  1MH4 A;  4D1Q A;  4OIN F;  4IQ4 A;  2R7O A;  5T5G A;  2L7K A;  3GVA A;  3O8H A;  3OL3 A;  2R4G A;  1XMK A;  2CU7 A;  1H88 C;  1B9M A;  2FBK A;  3VEP A;  3SFZ A;  1RUO A;  1MUF A;  1I27 A;  3GME A;  2R7F A;  3ESW B;  1A35 A;  3JSO A;  1YG2 A;  3M9A A;  2HGC A;  2ME6 A;  4CCL A;  2LKS A;  3W2V A;  1DDN A;  4M6V A;  1LPQ A;  2HQN A;  3P7N A;  3BR2 A;  4M3B A;  2R3A A;  3E0J B;  3T1B A;  3CC2 I;  3PFY A;  1KON A;  4Z2Y A;  3FPD A;  5FB2 A;  2YSR A;  2BY0 A;  3FXK A;  4XLP F;  2K3P A;  4GGG A;  4Y3O A;  4A3I J;  6PAX A;  2DXI A;  1WRJ A;  1V54 H;  3P9C A;  3LA7 A;  3P5J A;  1HLV A;  2ETH A;  4XOT A;  1FWZ A;  3QYB A;  3JRB A;  1WWX A;  1UG2 A;  4J00 A;  1U8R A;  4MFD A;  3OR1 C;  4PZJ A;  2LKP A;  2EBI A;  1T56 A;  2BVL A;  3PUB A;  4V19 K;  2F4M B;  2D45 A;  2HDD A;  3RIR A;  2PBI A;  2EIM H;  4GYI A;  1HBX G;  1BI1 A;  5B66 C;  1LB2 A;  1X1P A;  5TIS C;  1N6A A;  2VKD A;  4EVI A;  4JLG A;  1H8A C;  4MTD A;  3CZ6 A;  3H9J A;  2V9V A;  4BUP A;  5M3F J;  5TH7 A;  4FX0 A;  2OD5 A;  2LYC A;  2E7W A;  1OJL A;  4BY7 J;  1GDT A;  1RIO H;  3HOS A;  3S1R J;  2DTR A;  3ZQC A;  2MD5 A;  1BBY A;  2P7C B;  1E3O C;  1D1A A;  3FK7 A;  2KJC A;  2KIS A;  1ON1 A;  4KIC A;  3S1M J;  1XMX A;  2Z1D A;  4AM3 A;  1B72 A;  1HKT A;  3DU6 A;  2XAU A;  4RLQ A;  1WHU A;  3PIP F;  3ELK A;  2CUF A;  1K6Y A;  2LKX A;  1P6R A;  1JGG A;  2O0Y A;  3J7A Y;  5J4Y A;  1SVL A;  2R5Z A;  3G2B A;  2ESH A;  1T08 B;  2HS5 A;  4M3F A;  4HST A;  5LHH A;  1FYM A;  2CUJ A;  1H3I A;  5BNG A;  4AIJ A;  2C6Y A;  1X1D A;  2NVQ J;  3IH4 A;  4EGY A;  2K86 A;  3H5A A;  4A12 A;  5B1A H;  2BW3 B;  2MFZ A;  4EM0 B;  3ZQF A;  3Q9S A;  3P9K A;  1K78 A;  3OOU A;  2CV2 A;  1X2M A;  3JTH A;  2VQG A;  5LRS A;  2EIK H;  2O8J A;  2UWM A;  4RB0 A;  4JBA A;  4DW6 A;  3GLX A;  4LD5 A;  4RGR A;  4LG3 A;  3R0J A;  2HXO A;  2VOO A;  2ECC A;  2BXZ A;  2CGP A;  4E4H A;  3LA3 A;  1RRJ A;  1WJE A;  4AID A;  4RB1 A;  4QEP A;  2YX4 A;  5DDG A;  4IVN A;  3G71 I;  2NVU B;  2E71 A;  2ECB A;  1LFB A;  2NYX A;  2FOK A;  1ENH A;  3DTE A;  3PFI A;  2HEO A;  1ZKK A;  3CD6 I;  3CJT B;  1YW7 A;  4MIM A;  2E1N A;  5HLI A;  3HHH A;  5KAF C;  3LOC A;  3W6V A;  2I5U A;  4C2T A;  3M57 A;  4MQV A;  1IZ1 A;  3FKI J;  4J01 A;  5JJ0 A;  4BQQ A;  5F1J A;  4IJA A;  4HX7 A;  4D7M A;  2E36 A;  3DP7 A;  2QYO A;  5ERI A;  3E5U A;  4N9I A;  4KN7 X;  2Y48 A;  2LK2 A;  1T0F A;  4XQF A;  3G6E I;  2G0E A;  5M5W J;  2M0M A;  4XK4 A;  2WV1 A;  2G7H A;  2F2E A;  5ILV A;  1PP8 F;  1T38 A;  3HG9 A;  3K0L A;  3LAJ A;  3AL0 B;  4J83 A;  5D6F A;  4C3I J;  4CZC A;  1RZ4 A;  2IA2 A;  1S72 I;  4RM3 A;  3L2R A;  1N77 A;  1HST A;  2M45 A;  5KHD A;  2RQQ A;  1S8N A;  1JKR C;  1K83 J;  3GTJ J;  1NTC A;  3WHC A;  5FLX Z;  2Y0S A;  4X0G A;  4C30 A;  3D1N I;  1BA5 A;  1JJ6 C;  4IRG A;  1D5V A;  2KDZ A;  1TBX A;  2H1L A;  2QQ9 A;  3E1S A;  4RBO A;  2W82 A;  2XIG A;  2H6B A;  2JSC A;  3DKX A;  2PLY A;  4BHP A;  2MC3 A;  3T0Y A;  3GTP J;  3EUK L;  2A6T A;  3I59 A;  2KRH A;  2VQC A;  3I3L A;  3I54 A;  1FIA A;  3M07 A;  4M9X A;  3BY6 A;  3RQI A;  3KE2 A;  4F92 B;  2VBX A;  4YFN F;  3ASO H;  1YOV B;  1TWH J;  4D5C A;  4EMS A;  1B6A A;  2CUZ A;  4ZZD A;  1HOM A;  1YIJ I;  3DBH B;  1W36 D;  3BRO A;  1GV2 A;  2XV4 S;  1ORK A;  1JGS A;  4LK0 F;  3GCM A;  3QYF A;  4BHB A;  1L3L A;  1VQ5 I;  2A61 A;  1HC8 A;  3V8J A;  3ZPL A;  1X1A A;  3DXJ F;  3E5Q A;  4JX4 A;  4X6A J;  5CCL A;  2RV8 A;  2BOL A;  2IGO A;  1OQY A;  1W1W E;  4QLC U;  3T8T A;  4LMY A;  2CW8 A;  2ZJ2 A;  2LR8 A;  4YFX F;  1TZL A;  1P2F A;  5H6R A;  3KZY A;  1SFU A;  2HU9 A;  3H36 A;  4P1W A;  1WZ2 A;  2HOT A;  3C2G A;  2BY2 A;  3FBN B;  2D1H A;  1MVX A;  2HFH A;  3LST A;  4E70 A;  3DFG A;  2YR2 A;  3RYP A;  3L2C A;  1B72 B;  2P81 A;  3CME I;  3NQO A;  1YYV A;  3H3U A;  3NEU A;  2D1V A;  3HOX J;  4A6E A;  3HKZ N;  4XMY A;  1Y0N A;  2DN0 A;  2K9S A;  1V5G A;  4DZJ A;  5EG2 A;  1O7F A;  1YO5 C;  1YX3 A;  3DEU A;  3KYC B;  5J8F A;  4F93 B;  1BR2 A;  3A2K A;  3HPG A;  2DQL A;  5B3S H;  1YLF A;  1B8I A;  3C18 A;  5D5U B;  1EH6 A;  2XKP A;  3K4L A;  4ENM A;  1R49 A;  3FDY A;  3GZN B;  4D7N A;  3IUO A;  1YRN B;  5FLX K;  2BQZ A;  2IGQ A;  1IXC A;  3M5A A;  5EEH A;  3A01 B;  3IWF A;  3F23 A;  1WH7 A;  2O9L A;  1V5E A;  1GHC A;  4AYB N;  1IRF A;  4M6X A;  4UVB A;  4C3H J;  3TO9 A;  1P7J A;  3CQZ J;  3IKV A;  1PJR A;  4FHT A;  2IBD A;  3HYI A;  2VIX A;  3TL4 X;  4Y33 A;  3CLO A;  3H9Q A;  5E1W A;  1FC3 A;  2QLZ A;  5EYR A;  5IP9 J;  3EUH A;  1MT6 A;  4HQE A;  2LLK A;  3BR5 A;  4L18 B;  1KYW A;  4DGW B;  3HEF A;  1ULY A;  3PQK A;  1O7L A;  3OYH A;  3K4K A;  2H1K A;  3MO0 A;  2XPW A;  2IT0 A;  3H3V K;  2XAG A;  4IL6 C;  3I4N J;  3WU0 A;  1GV5 A;  2Z16 A;  3CCM I;  2OAZ A;  4C1Q A;  1OCP A;  4KT6 A;  3PSI A;  5DD4 A;  2KP6 A;  2LFB A;  3TQN A;  5D8K B;  3RSN A;  2WV0 A;  2XAJ A;  3NAR A;  1ODD A;  4OOI A;  3U9G A;  1DQU A;  2KIQ A;  2MSY A;  1BL0 A;  5DEQ A;  2EZH A;  2Z33 A;  2A69 F;  4AVP A;  4E7L A;  3OYD A;  2M4K A;  2WC2 A;  3HDD A;  1Q1H A;  1S3J A;  1W7P D;  5GTI C;  5FJ8 J;  1HKQ A;  4ZDO A;  3L2Q A;  1T0F C;  4ASN A;  2F48 A;  2IGM A;  2HTS A;  4BJT A;  2XAH A;  3W2A A;  3F21 A;  1C0W A;  4G6D A;  3CP8 A;  5HDG A;  3L1P A;  1FTT A;  3BO5 A;  4EGZ A;  3K1N A;  1TQI A;  3ASN H;  1CGP A;  4E7I A;  3F9W A;  2ID3 A;  4UHT A;  5IOY A;  1YJW I;  4XL9 A;  2O61 A;  4JQF A;  2JVH A;  3M58 A;  4GYG A;  2FRH A;  3OYF A;  1FMW A;  2EQR A;  3FXL A;  4ABZ A;  4KT5 C;  1VQK I;  3RTR A;  1GT0 C;  2CO5 A;  2OTL I;  1XPX A;  3REO A;  3WTY C;  3I56 I;  3M53 A;  2CYY A;  4P9U A;  1IN7 A;  4F55 A;  4GFB A;  4X1E A;  4Q4Z F;  3N4M A;  2R7R A;  5F6L A;  4L5I A;  3M56 A;  4GRI A;  1QHG A;  3ZN0 A;  3FIS A;  4AIK A;  2I10 A;  3DWL E;  2G9W A;  3CJN A;  3I59 B;  3WHB A;  4M3G A;  4DYQ A;  4BNC A;  2QGU A;  4Q47 A;  2OF7 A;  4AIH A;  3ZCO A;  3LAP A;  4A3B J;  2W5Z A;  1O4X A;  2RAE A;  5KAI C;  3E3V A;  3I58 A;  3M54 A;  2LBF B;  1I1S A;  2A07 F;  2DOF A;  2QSF X;  1W0T A;  4HNU A;  3QQA A;  3O6B B;  3IRQ A;  3QU3 A;  2PMU A;  3H0G J;  2ELK A;  2DMQ A;  2QBY A;  1XGO A;  3ULQ B;  2VC1 A;  5GPA A;  2KT0 A;  4JOM A;  5KK1 A;  4IHS A;  1IV8 A;  4H0E A;  3FF5 A;  1PUF A;  1DGW Y;  2VT2 A;  1LE8 B;  2M7A A;  3Q9V A;  2LF7 A;  3W2W A;  1P4A A;  4LGW A;  4AU7 A;  1LJ9 A;  2VL8 A;  5EGO A;  3ABK H;  3AG2 H;  2B63 J;  4TV7 A;  2RKH A;  2O8K A;  4NC8 A;  5LFA A;  2L0K A;  5E8I A;  3JRD A;  1FEX A;  2HDW A;  1ZRC A;  2M30 A;  5HNF A;  2JK3 A;  3HTU A;  1R9T J;  3M4O J;  4Q5S F;  2BVM A;  3RAY A;  2KDO A;  1F1Z A;  3ML6 A;  4UB8 C;  2BYV E;  3BG9 A;  1OR7 A;  4F91 B;  3P9I A;  2W84 A;  4H4K C;  2DFF A;  2DW4 A;  4KJZ A;  4Q48 A;  2OQR A;  3U1D A;  2GXB A;  5CQE A;  2RNG A;  1XG1 A;  2KIU A;  4PSX A;  1YI2 I;  4JDS A;  2BW3 A;  2ID6 A;  2PJR B;  4UY8 I;  1OFC X;  2IEK A;  3C1D A;  3GEZ A;  3MZH A;  1D3Y A;  1WJF A;  4L9V A;  4A69 C;  5JHN A;  2VXD A;  2XF5 A;  4AYB A;  5E79 C;  2TCT A;  5J47 A;  1JUP A;  1B9N A;  1IC8 A;  4HF1 A;  2UV1 A;  2F5D A;  4CDG A;  3F9Y A;  2CV0 A;  4GCV A;  2CW0 F;  1LEB A;  1ZLJ A;  3BTI A;  1K7A A;  3KYD B;  3WE2 A;  3EPZ A;  4DOZ A;  4S05 A;  4MQ9 F;  5FD5 A;  1APL C;  1LKX A;  3AAF A;  4A0Z A;  3K2Z A;  3TW7 A;  4XSZ F;  3RKW A;  3HSR A;  1Z67 A;  3T8R A;  5GPC A;  3OYJ A;  4M71 A;  3C7J A;  2DFE A;  1JHF A;  4AWX B;  2VON A;  2LRD A;  5LHG A;  2NVY J;  5C4X J;  5F0F A;  3S7B A;  2DMP A;  3G3Z A;  1TNT A;  4XKB A;  4RDU A;  2GBY A;  3SZT A;  3HTS B;  4KIS A;  5E3L A;  2DJI A;  1HDD C;  2VBW A;  3GLL A;  1HW1 A;  5E3N A;  3HOV J;  1F9N A;  1QU3 A;  2H94 A;  1XD7 A;  1P7I A;  2BZT A;  3ZGK A;  4RGU A;  2MA3 A;  2FBH A;  3ZMV A;  2VBZ A;  2GA2 A;  2O3F A;  2XGD A;  1I6H J;  4GXO A;  3GZ5 A;  1OYY A;  4BJ5 C;  1W5T A;  4UNO A;  1BW6 A;  2JUG A;  3IRR A;  1U5T A;  3OYI A;  2FNP A;  4BE1 A;  2L54 A;  1BW5 A;  4II3 A;  4AVZ A;  2CFO A;  1D0Y A;  4Y7N J;  4YNM A;  2M2E A;  3JAM K;  3HUG A;  3OR2 C;  4MEX F;  5L3C A;  3GFM A;  2PI0 A;  1BI0 A;  4QSH A;  4IOC F;  4KN4 X;  1GXQ A;  2CUE A;  3OIO A;  2EV6 A;  5C3E J;  3COA C;  3OOP A;  1FX7 A;  2IP2 A;  1QVU A;  3F8M A;  3MQ0 A;  1KU9 A;  2VE8 A;  3PM1 A;  4E7J A;  3DTI A;  3FBI B;  5CVU A;  5BPD A;  2AQE A;  4HPQ A;  2BBY A;  4IHX A;  1MH3 A;  1A6Q A;  2M8E A;  4Z6Y A;  3K1M A;  2JPC A;  2Q2E A;  2TDX A;  4IZZ A;  2V1U A;  2QF7 A;  3O8G A;  1Z91 A;  2VKE A;  2QM3 A;  4JX6 A;  5E3O A;  1IV6 A;  4NQW A;  4CIC A;  4I98 B;  3S14 J;  1NH3 A;  2Y0M A;  4O6F A;  4ZDP A;  3MN2 A;  1IRZ A;  1O9S A;  4CZZ A;  2QQ8 A;  3K2A A;  1P92 A;  5D4R A;  5CCM A;  1YTY A;  2HQR A;  2JN6 A;  3KLN A;  3IL2 A;  4EJT A;  3A03 A;  3KPH A;  4W1U A;  3HB9 A;  5DM6 F;  1FYK A;  1YE9 A;  2R7V A;  5FKN A;  4F7Z A;  2L7M P;  2FXA A;  2FX0 A;  1VI0 A;  2DQR A;  4I51 A;  2KFD A;  4CCJ A;  4YPE A;  4UUT A;  1TWF J;  2R5Y A;  4YG2 F;  4P55 A;  2DA6 A;  2DU9 A;  2W1O A;  3S93 A;  1E17 A;  4G7H F;  3KCC A;  2P5V A;  4A5M A;  3ERE D;  4CYC B;  2K5C A;  5T0M A;  3V7R A;  3CC4 I;  2BHY A;  1MW7 A;  2WY7 Q;  3SDB A;  1CQT A;  3WGH A;  4R1H A;  4A3K J;  1EF4 A;  5FFX A;  1F43 A;  3IH3 A;  4PGH A;  1ZLK A;  3WU2 C;  1V5F A;  5ARF A;  1OCO H;  3K7A J;  2ZME B;  4CSW A;  1FJL A;  1MBH A;  3DLL F;  2LH9 A;  1P4X A;  5E17 F;  5JVT A;  3BP8 A;  4RMN A;  1JT6 A;  3GTG J;  2QKL B;  2M87 A;  5E8G A;  4KDP A;  3NRV A;  3F3X A;  5HQ8 A;  3TDU C;  2BGC A;  4BBR J;  3GXO A;  1BJA A;  3HUG B;  4OAY A;  2DOA A;  4MGR A;  1G3T A;  4ITV A;  4QWQ A;  5JHU A;  1BC7 C;  4HBL A;  2K9M A;  4II2 A;  2O8X A;  4GDF A;  3NAU A;  5HI7 A;  1SD4 A;  2F5V A;  3J7Y J;  3KP5 A;  3KMJ A;  3DV8 A;  1BN5 A;  1ETW A;  4BY1 J;  2Z2S B;  2VUM J;  4HF0 A;  5K5Q A;  3OYG A;  1SC7 A;  1T98 A;  1I3Q J;  3F6O A;  2IA1 A;  3OIQ A;  3M8F A;  3JR9 A;  3CO6 C;  2HOA A;  1VQ7 I;  3E6D A;  2KRF A;  2H8W A;  4M9S A;  3IHU A;  5AYF A;  5F27 A;  3ZQH A;  4XLC A;  5LEJ A;  2HZT A;  4N0B A;  1D0X A;  1I39 A;  4HQM A;  3HBL A;  2QVO A;  1Y1V J;  5GAD J;  3NWS A;  3FMS A;  2X0L A;  3ERM A;  3MEK A;  2IS1 A;  2WBM A;  3RDI A;  4ZYH A;  3QRF F;  2VC0 A;  2VB6 A;  2X6O A;  2O03 A;  4EEF G;  3GYH X;  3RIB A;  3OS2 A;  2KIF A;  2EJR A;  1DPR A;  4NHJ A;  3HRT A;  2JA7 J;  5F0C A;  2R7U A;  2ZXH A;  3F22 A;  2QPW A;  5H2F C;  3U21 A;  4DYC A;  1NK3 P;  4BDY A;  2J5O A;  5KJN A;  1IN6 A;  5DCM A;  2OTJ I;  2GAU A;  3M8E A;  2EFP A;  2UXX A;  2IW5 A;  4XKC A;  3FK6 A;  5E1Z B;  4G7Z F;  3F9X A;  4ZZL A;  5KNL A;  3CP2 A;  4PCQ A;  2MAB A;  2O6G E;  3VDX A;  1QPM A;  3KZZ A;  2ELH A;  4B3A A;  1XGS A;  4PFO A;  4XRF A;  2DPD A;  2W85 A;  3QOP A;  3UKG A;  5E3M A;  1KQ8 A;  4U0V A;  2ZJP F;  1HSJ A;  4QPQ A;  4DNC A;  2DOD A;  2ZC2 A;  3RZD J;  4KFC A;  1MKM A;  3FIW A;  3QAH A;  1U0J A;  1S9H A;  3RKX A;  2GM4 A;  2OC6 A;  1Z7L A;  1ZRF A;  4WCG A;  4L9N A;  3MAJ A;  2P5K A;  4HOB A;  4BAY A;  3F9K A;  3MVP A;  1FP1 D;  2L4M A;  3TKY A;  4LG0 B;  3FXO A;  2VT3 A;  5J1U A;  4EM2 A;  1IXR C;  4RAY A;  2WWY A;  4IJ8 A;  3OXF A;  2NRA C;  4XSX F;  4LB5 A;  2D2W A;  3HRM A;  4UV8 A;  1H89 C;  1QPI A;  3CCS I;  1XDU A;  2DA3 A;  2VOD A;  4BAC A;  1LNW A;  1ON2 A;  3HIF A;  1UJ8 A;  2DA5 A;  2AQF A;  2M7B A;  3E5X A;  1V3F A;  3TOA A;  4B43 A;  5ICG A;  4WWC A;  1RKW A;  3M7G A;  5CKT A;  1X2N A;  3F8F A;  3HM5 A;  1JTY A;  3HZJ A;  4KA4 A;  3KLO A;  4V2F A;  1G59 A;  1K78 B;  1TTY A;  2R0Q C;  3HOW J;  3MO2 A;  1FIP A;  1R22 A;  3RCO A;  3HSE A;  1D8K A;  4NC6 A;  3BCB A;  3PL8 A;  9ANT A;  1ML9 A;  2EFN A;  3A01 A;  5EZH A;  3S17 J;  2IGN A;  2BY1 A;  1Y56 A;  4BS9 A;  1PUE E;  1W7P B;  3W3C A;  1R36 A;  3DKY A;  4LG0 A;  2F5F A;  4J19 A;  3OXL A;  1TWC J;  2MGQ A;  2VOP A;  4HW0 A;  1BR1 A;  2LRE A;  3CES A;  1ZG3 A;  2YX7 A;  5IY5 H;  3AFH A;  1IN8 A;  3KIO A;  3TOB A;  1XTA A;  1RC9 A;  5CJ9 A;  2ZNY A;  3JCU C;  1LUJ B;  3GFJ A;  4PJN A;  1F5T A;  2IS2 A;  1VND A;  1JE8 A;  1D0Z A;  1TQP A;  2K9N A;  2KL4 A;  1G6N A;  4ZYD A;  4RB2 C;  4L0Z B;  3CCV I;  3GTQ J;  1X19 A;  1NG7 A;  3S2D J;  2O5R A;  1R1U A;  1G3S A;  3KP7 A;  4O30 A;  4J7I A;  1TWG J;  2L9V A;  2LTP A;  4OIR F;  2WTE A;  4XRM A;  3OS5 A;  1WCM J;  2LP0 A;  4LLL A;  3SZP A;  3LFK A;  3MZY A;  3KEY A;  5F6K C;  5IT3 A;  1Q1V A;  1ZR4 A;  2DT6 A;  2CG4 A;  1BOB A;  4XOP A;  1Z3X A;  5CVV A;  1YHQ I;  5DV5 A;  2BE5 F;  4D9J A;  1TT0 A;  4XOR A;  3TMO A;  4E7S A;  1Z6T A;  3CJR B;  4HNV A;  1MSF C;  1K79 A;  1KU7 A;  2VPL A;  1ZAR A;  2MH9 A;  3DEW A;  2QQB A;  5HDK A;  2ZSI B;  1SD7 A;  5ICC A;  2MYS A;  2CSO A;  3EYY A;  1SFO J;  2DK5 A;  3BQY A;  3F0C A;  4I7H A;  1SAX A;  3K4J A;  1S7O A;  4IHV A;  4KMU X;  1IN4 A;  3CCQ I;  4HEA 2;  4NNJ A;  2K9L A;  2P6T A;  5TRD A;  4A0Y A;  4L0Y B;  2J5P A;  1ITY A;  3TDZ C;  2R7Q A;  3I4M J;  2JRM A;  2FOW A;  3IAM 2;  3UNG C;  4BEH A;  3S3O A;  1MJB A;  3AL0 C;  3K5K A;  2Y69 H;  1T33 A;  1X1B A;  3OYK A;  3VSL A;  3S7D A;  3KFW X;  3FHN A;  3DPU A;  5FKK A;  4FT8 A;  1HQC A;  3BR3 A;  3OIP A;  3I55 I;  2VE9 A;  4LDG A;  2HNH A;  2FEZ A;  2OBP A;  4BQA A;  1POG A;  3B6A A;  4RAG A;  4BQN A;  1LEA A;  4A5N A;  4BXF A;  3HOT A;  1Z21 A;  2A3S A;  1YW8 A;  1WI3 A;  3N05 A;  2L3D A;  5D5V B;  2XAS A;  3IP4 B;  3K1P A;  5JIN A;  1S5L C;  2K4J A;  4CGZ A;  2XRN A;  1FOY A;  5LSX A;  2HTJ A;  1ZEL A;  5LGU A;  2W24 A;  3TP0 A;  3QWW A;  3DBR B;  1S29 A;  1WVR A;  4YII A;  5IT9 Z;  4AUX A;  4BHC A;  5E20 A;  1F4K A;  5CVJ A;  2L7F P;  3B6C A;  5IT9 K;  3BG3 A;  2P7V B;  3A0H C;  2RRE A;  2VJI A;  1H0M A;  3SXY A;  3ZRG A;  1WJA A;  3ABL H;  1ZGW A;  5L3G A;  3FHZ A;  4MLO A;  3QPL A;  1ZG5 A;  3U2R A;  4NBQ A;  1OYW A;  5ILU A;  2MG4 A;  4Y15 A;  2LG4 A;  2PG4 A;  3HL2 A;  3SEQ A;  2E1C A;  4A6D A;  1IJW C;  2PMH A;  3R61 A;  3MKW B;  2GZW A;  3J80 Z;  1UHM A;  1XCV A;  1ZK8 A;  4HX4 A;  3H35 A;  1SVM A;  2A5W A;  1FY7 A;  1RET A;  2HZD A;  2L02 A;  1W0U A;  3IC7 A;  4OIQ F;  1RR7 A;  1OCR H;  2K40 A;  1MBF A;  3K70 D;  4J8O A;  1TP4 A;  3EUH C;  3OYA A;  1MVH A;  1MD0 A;  2RGV A;  2OQG A;  4BYY A;  1EH7 A;  3LSP A;  2XSD C;  2CFX A;  2XC7 A;  1ZAO A;  3V42 A;  2DK8 A;  4M3E A;  1X58 A;  2HKX A;  1K61 A;  3QWP A;  3CCE I;  1KYZ A;  3CUQ B;  3R60 A;  2VJJ A;  3I53 A;  1GUU A;  4B44 A;  1VQM I;  2ZJR F;  1I1G A;  4LFU A;  3KMA A;  4IXA A;  2EA2 A;  4PJJ A;  3OL4 A;  3RPQ A;  5DCF A;  2XB5 A;  1ZTR A;  1BM9 A;  1UEL B;  4B1R A;  3HGG A;  1VQ4 I;  3LQQ A;  2DT7 B;  4QPO A;  2X6Y A;  1R4M B;  4NC7 A;  2XGC A;  2XGE A;  4HA8 A;  3SWC A;  2VN2 A;  5ICF A;  2W00 A;  4J7F A;  3OS1 A;  3H9G A;  5M3M J;  1I3A A;  3RJP A;  2DT5 A;  2A6H F;  1BI2 A;  2VKH A;  5F08 A;  3S1Q J;  1A04 A;  4Z4P A;  1KA8 A;  3CCR I;  1W5C C;  3ZMU A;  3RKY A;  3JRI A;  3W6J B;  1KQ9 A;  2Y0S N;  5F59 A;  2IAI A;  4A3E J;  4JK1 X;  1BC8 C;  3PO3 J;  2G46 A;  1FPQ A;  3FWE A;  4I76 A; 
#chains in the Genus database with same CATH homology
 2K3P A;  4Y3O A;  4B3X A;  3DB5 A;  2DXI A;  2L5Q A;  1QU3 A;  4CCM A;  5KJM A;  3ZGK A;  4XOT A;  3QYB A;  2CH0 A;  1PEG A;  4J00 A;  4BJ5 C;  3OR1 C;  4ZYA A;  3L2U A;  2JSP A;  4PJM A;  4YNP A;  3ZR8 X;  2BVL A;  3PUB A;  3TG5 A;  2JUG A;  2Q1Z B;  2MC4 A;  3OYI A;  4BE1 A;  2M3A A;  4YNM A;  3BC8 A;  4II3 A;  2CFO A;  1D0Y A;  4AVZ A;  1N6A A;  1OR7 C;  3OR2 C;  2IGK A;  2VKD A;  3MO5 A;  4JLG A;  3DPL C;  3CZ6 A;  4E47 A;  3H9J A;  4BUP A;  5TH7 A;  1XQH A;  2P0W A;  2LYC A;  4BL0 B;  2CS3 A;  4N4N B;  3LSK A;  1GLN A;  3MD2 A;  2VAS A;  4CA0 A;  3HOS A;  4E7J A;  1N6C A;  3DTI A;  3VWB A;  3FBI B;  4LIU A;  2AQE A;  4HPQ A;  1EA3 A;  1AA7 A;  4P5O A;  4ZDL A;  3GBG A;  1D1A A;  2R7S A;  3HKZ A;  4IZZ A;  4C9Y A;  2JV0 A;  4E7Z A;  2X1D A;  2Z1D A;  4WUY A;  3OYE A;  3PSF A;  4QEO A;  2KMU A;  3DU6 A;  4O6F A;  1MNE A;  2XAU A;  4RLQ A;  2VQL A;  3K10 A;  4ZDP A;  5HNH A;  1O9S A;  2WAD A;  1K6Y A;  2XF7 A;  4PFP A;  3J7A Y;  5CCM A;  2RFI A;  3K70 C;  3G2B A;  4OAZ A;  4HST A;  3D5S C;  1D1B A;  1YE9 A;  2CUJ A;  2E5Z A;  4XM3 A;  2R7V A;  1H3I A;  2F4I A;  3DAL A;  3M59 A;  1X1D A;  5FRO A;  4YEL A;  4CH7 A;  4I51 A;  4CCJ A;  3PNY A;  3H5A A;  4BJ6 C;  4YPE A;  2ZXI A;  2KHM A;  2BW3 B;  2MFZ A;  1MMN A;  3BCA A;  2FUG 2;  4XLF A;  4IX7 A;  4DIQ A;  2W1O A;  3S93 A;  2R7X A;  3OOU A;  2CV2 A;  4Y4R A;  2VQG A;  4F3Q A;  3S7J A;  1UAA A;  3QOE A;  2K5C A;  4R79 A;  5T0M A;  3OOI A;  2O8J A;  3DQV C;  1MW7 A;  2UWM A;  2WY7 Q;  3SDB A;  4OWR B;  3HNA A;  4EAT A;  4C2U A;  4LG3 A;  1T95 A;  3KX2 A;  4HNT A;  1V5F A;  5ARF A;  2VXZ A;  4BEH B;  4E4H A;  4XLA A;  4G6T B;  3S32 A;  1WJE A;  4CSW A;  4QEP A;  1WJC A;  5EX3 A;  2LH9 A;  3VUZ A;  4RMN A;  2QKL B;  1JI8 A;  3KMT A;  2WAQ A;  3DTE A;  3S8P A;  3OYL A;  3SW9 A;  1ZKK A;  5HQ8 A;  2UUZ A;  4FET A;  3HUG B;  1R6R A;  4OAY A;  3MKZ A;  2DOA A;  3L2W A;  2E1M C;  3OMY A;  2X85 A;  4ITV A;  1MMG A;  3M57 A;  4C2T A;  2K9M A;  4II2 A;  2NOJ B;  5HI7 A;  4J01 A;  1Y6I A;  2F5V A;  2WAF A;  4BQQ A;  5JJ0 A;  3KMJ A;  3VYR B;  2OUM A;  2Z2S B;  3OYC A;  3OYG A;  5CPR B;  4XQF A;  3OIQ A;  3OYM A;  4FMU A;  5JIY A;  3CF2 A;  2M0M A;  2WY8 Q;  5AYF A;  5KCM A;  3D5R C;  3HG9 A;  4XLC A;  3AL0 B;  4J83 A;  3DPT A;  2L9S A;  3SEZ A;  4CZC A;  1D0X A;  4YEJ A;  3L2V A;  4RM3 A;  2VJ5 A;  3L2R A;  1N77 A;  5KHD A;  3A1Y A;  2RQQ A;  2HVS A;  3VYU B;  4YRV A;  2CW7 A;  2KRC A;  3NWS A;  3MEK A;  2IS1 A;  2WBM A;  4QEN A;  4X0G A;  2Y0S A;  4C30 A;  3LSM A;  3K4B A;  3OYB A;  2VB6 A;  4BQO A;  5HOO A;  3M55 A;  3RIB A;  3SZG A;  3OS2 A;  1PYV A;  3E1S A;  2R7T A;  2R7U A;  2W82 A;  2ZXH A;  3DKX A;  2QPW A;  3U21 A;  2LY2 A;  4PJL A;  2E1M B;  3S3N A;  4BDY A;  4CCO A;  3EUK L;  5KJN A;  3DTK A;  4HG2 A;  2A6T A;  3LSI A;  2KRH A;  1WJB A;  2VQC A;  4XKC A;  3F9X A;  4B48 A;  1W36 C;  3I3L A;  5KNL A;  3CP2 A;  2MAB A;  4RZ0 A;  4XN3 A;  3TBI A;  4PK4 A;  3VDX A;  4F92 B;  3OS0 A;  4ANJ A;  4PFO A;  1LVK A;  3K4M A;  2CUZ A;  2GOM A;  4ZJZ A;  4YND A;  4QPQ A;  1W36 D;  2KPM A;  1DGR M;  3AKZ A;  4NQW B;  3OXG A;  1X1C A;  3QYF A;  5T0K A;  1U0J A;  5FRM A;  1S9H A;  2V4J C;  1N3J A;  1X1A A;  5CCL A;  2IXS A;  2W5Y A;  2OC6 A;  2BOL A;  2IGO A;  2X6X A;  3PDN A;  1Z7L A;  4RLF A;  2CW8 A;  2Q2E B;  1TZL A;  3F9K A;  3BLY A;  5LD2 C;  3CJQ B;  2HU9 A;  4H12 A;  4XLH A;  4P1W A;  1IRX A;  3ONQ A;  3C2G A;  3FBN B;  1LDK B;  3BG6 A;  2JVG A;  2I8D A;  1MVX A;  3OXF A;  4BGD A;  2X1C A;  2PJR A;  1QHH D;  3K4C A;  4BAC A;  2AQF A;  2M7B A;  3PNV A;  4B43 A;  2E5N A;  4XMY A;  1ERD A;  5CKT A;  3H0D A;  1V5G A;  5EG2 A;  1G59 A;  4HSR A;  1YX3 A;  1MMD A;  3MKY B;  2HVR A;  3MO2 A;  3RCO A;  4F93 B;  3S3M A;  1BR2 A;  3BCB A;  3PL8 A;  3A2K A;  3HPG A;  1ML9 A;  2IGN A;  1Y56 A;  3DEE A;  4BS9 A;  3K4L A;  1G8X A;  3BG7 A;  3FDY A;  3W3C A;  2L2O A;  3DKY A;  3IUO A;  3PNT A;  1E0E A;  2BQZ A;  2IGQ A;  3M5A A;  3OXL A;  3D5L A;  2JA2 A;  1V5E A;  2ELJ A;  1BR1 A;  2HVQ A;  2LRE A;  3CES A;  2WA0 A;  2XSJ C;  3AFH A;  4ZC3 A;  2WB1 A;  1HA8 A;  3LMM A;  5CQG A;  1PJR A;  4XON A;  2W4S A;  3CMM A;  2VIX A;  3TL4 X;  2F6C A;  1FMV A;  2V1N A;  4Y33 A;  3TG4 A;  3N71 A;  3H9Q A;  4PJN A;  4DBQ A;  5EX0 A;  2IS2 A;  1D0Z A;  3RU0 A;  4RM2 A;  1MND A;  1MT6 A;  2KL4 A;  3VSK A;  2XF6 A;  4DGW B;  1X19 A;  3CBM A;  1NG7 A;  3OYH A;  2O5R A;  3K4K A;  4HRI A;  3RJW A;  4BDZ A;  3MO0 A;  4O30 A;  4J7I A;  2V26 A;  3OS5 A;  3IHX A;  2Z16 A;  3I9V 2;  3KEY A;  4C1Q A;  5F6K C;  3CBP A;  1P9Q C;  4BE2 A;  4KT6 A;  3PSI A;  2KP6 A;  3RSN A;  4NVQ A;  4CUG A;  2DT6 A;  3M8J A;  5TEG A;  1VZ0 A;  2X1E A;  1BOB A;  3K4N A;  4XOP A;  3RPU D;  1Z3X A;  1DQU A;  3HXL A;  4E7K A;  3S7F A;  2V7F A;  4D9J A;  4E7L A;  3OYD A;  1TT0 A;  2M4K A;  4XOR A;  2HPI A;  3TMO A;  4E7S A;  3CJR B;  5HVQ C;  2VPL A;  1YX5 A;  4ZDO A;  2E60 A;  3L2Q A;  1T0F C;  1D1C A;  2IGM A;  4BJT A;  2ZSI B;  3W2A A;  2MYS A;  3OPE A;  3QWV A;  3ZQQ A;  3CP8 A;  2PMZ A;  3K4J A;  3BO5 A;  4U7B A;  4CCK A;  3IAS 2;  2LY1 A;  2XDV A;  2K9L A;  4HEA 2;  3MMY B;  4NNJ A;  4E7I A;  5KJL A;  3F9W A;  4MI5 A;  2R7Q A;  1X4O A;  3QOD A;  1MMA A;  3AL0 C;  3IAM 2;  3UNG C;  4BEH A;  3S3O A;  4XL9 A;  4MI0 A;  3K5K A;  4JQF A;  2JVH A;  3M58 A;  1X1B A;  3OYK A;  3VSL A;  3OYF A;  3S7D A;  1FMW A;  4E7H A;  3UR3 C;  4N4O B;  3FHN A;  3DPU A;  3A4C A;  3LSH A;  3RTR A;  4CCN A;  3EP0 A;  2VLA A;  3OIP A;  2X51 A;  3VYT B;  2QKM B;  3M53 A;  2CMP A;  2V6E A;  4LDG A;  2HNH A;  1WJD A;  2LBF A;  4BQN A;  3LFU A;  4F55 A;  1J09 A;  4BXF A;  3HOT A;  3DLA A;  1Z21 A;  2R7R A;  5F6L A;  4FAS D;  2OV7 A;  3M56 A;  3N05 A;  4GRI A;  4DBR A;  3OY9 A;  1QHG A;  3IP4 B;  5JIN A;  3H5N A;  5LSZ A;  3DWL E;  1N75 A;  2HQA A;  4IJD A;  4U87 A;  5LSX A;  3QYE A;  4XKV A;  3CBO A;  2GOX B;  3FKJ A;  1ZEL A;  3ZCO A;  3RQ4 A;  4PSW A;  3QWW A;  3OYN A;  2W5Z A;  1X4P A;  3M54 A;  2LBF B;  2LOO A;  2KZV A;  3M1C A;  3OWT A;  5TGT A;  3HPH A;  4F52 A;  1OLT A;  4HNU A;  3LL7 A;  2R7W A;  2RRE A;  2VJI A;  3C2H A;  4XR6 A;  3ZRG A;  2IS4 A;  5TTF A;  1WJA A;  3VYS B;  4MLO A;  2F69 A;  4JOM A;  1LFP A;  4XN0 A;  3LSG A;  1WFX A;  2ZSH B;  3ZXS A;  1DGW Y;  3F9Z A;  2LG4 A;  4PUS A;  3HL2 A;  3SEQ A;  4IKF A;  2L9N A;  4XLE A;  4NJ5 A;  5ARG A;  3HC7 A;  2M7A A;  3W2W A;  4XNF A;  4AU7 A;  3MKW B;  2VJ4 A;  2VL8 A;  4DJA A;  4LIT A;  2A5W A;  3H35 A;  2HZD A;  4NC8 A;  4YPU A;  5LFA A;  1WJ5 A;  2KQR A;  2HDW A;  2W7N A;  3EUA A;  5F5E A;  1UG0 A;  5HNF A;  3K70 D;  4J8O A;  3OYA A;  3EUH C;  4BU2 A;  2BVM A;  1MVH A;  3RAY A;  2KDO A;  1SFK A;  3DU5 A;  4NUB A;  4F91 B;  4H4K C;  5KJK A;  4KJZ A;  2XC7 A;  5CQE A;  4LIV A;  3V42 A;  3PJR A;  4ZTJ A;  2RNG A;  5JHF A;  4XKW A;  4PSX A;  5FRN A;  3H5R A;  3QWP A;  4JDS A;  5HLT A;  2BW3 A;  2PJR B;  1DP3 A;  2LC2 A;  2ZFU A;  1Z3Y A;  2CV1 A;  2VQH A;  2VJJ A;  4B44 A;  4ZTF A;  1NG6 A;  3K6G A;  5JHN A;  1WJF A;  3KMA A;  2VXD A;  2XF5 A;  4AYB A;  4BE0 A;  4PJJ A;  2MD0 A;  3OL4 A;  2IS6 A;  2UV1 A;  3KYL A;  2WAE A;  3F9Y A;  4YPA A;  2CV0 A;  1UEL B;  4IQJ A;  4D1Q A;  1N78 A;  4IQ4 A;  2DT7 B;  2R7O A;  4QPO A;  3EPZ A;  2L7K A;  2X6Y A;  3NWT A;  4NC7 A;  4DOZ A;  5T5G A;  3SWC A;  1LKX A;  3OL3 A;  2W00 A;  4J7F A;  2R4G A;  3OS1 A;  4KIT B;  4E6K G;  3H9G A;  3OYJ A;  2V9K A;  1MUF A;  4B47 A;  2VKH A;  3VV0 A;  4CCL A;  4Z4P A;  2LRD A;  2M4G A;  1SAU A;  2X6W A;  3W2V A;  5F59 A;  2HPM A;  2R3A A;  3E0J B;  4XKB A;  3S7B A;  2DCE A;  3PFY A;  1KON A;  3FPD A;  2KLO A;  3SYT A;  1BR4 A;  2G46 A;  4KIS A;  4IJ8 A;  2DJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...