3S8PA

Crystal structure of the set domain of human histone-lysine n-methyltransferase suv420h1 in complex with s-adenosyl-l-methionine
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
263
structure length
233
Chain Sequence
MSAKELCENDDLATSLVLDPYLGFQTHKMNTRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKEHVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEENMLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYTCERRGTGAFKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SUV420H1
publication title Crystal structures of the human histone H4K20 methyltransferases SUV420H1 and SUV420H2.
pubmed rcsb
source organism Homo sapiens
total genus 60
structure length 233
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1700 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3s8pA01
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s8pA02
3S7JA 3M53A 3OXLA 2R3AA 4LDGA 2O8JA 4E47A 1N3JA 3PDNA 3OXFA 3OPEA 4H12A 4J7IA 3M58A 3QWVA 5HQ8A 2QPWA 4J83A 5T5GA 4YNPA 4I51A 1ML9A 4O30A 3SW9A 2RFIA 3TG4A 5LSZA 4BUPA 3MO5A 3M5AA 4AU7A 4RZ0A 3F9XA 1N6AA 5F6LA 3S7DA 2F69A 3IHXA 3KMJA 5JJ0A 3CBOA 4FMUA 3QWPA 1XQHA 5KJKA 2G46A 4O6FA 5F5EA 4J8OA 4YPEA 4YPUA 4NVQA 3M56A 1PEGA 4C1QA 1ZKKA 1N6CA 3K5KA 5CPRB 5KJLA 4JDSA 5EG2A 3M59A 3N71A 4J7FA 4QEOA 1MT6A 3S7FA 5KJMA 3RQ4A 4NJ5A 5F6KC 3F9YA 4IJDA 4Z4PA 5JIYA 1MVXA 1MUFA 5T0MA 3MEKA 3RU0A 3M55A 3CBMA 3F9ZA 3SWCA 3BO5A 3RAYA 5F59A 3MO0A 5EX0A 5TEGA 3DB5A 3S7BA 4QENA 5KJNA 3S8PA 1H3IA 4JLGA 5AYFA 1O9SA 3OOIA 4YNMA 3VUZA 3MO2A 4MI5A 1MVHA 5EX3A 3CBPA 3TG5A 5JHNA 5ARGA 3EP0A 3M54A 5TH7A 4YPAA 2JV0A 2W5ZA 4WUYA 5LSXA 5HI7A 2BQZA 3F9WA 3FPDA 4IJ8A 4QEPA 5JINA 2IGQA 5CCMA 2W5YA 3M57A 5CCLA 3KMTA 3QWWA 3RJWA 5TTFA 5ARFA 5T0KA 3KMAA 3VV0A 3OS5A 4YNDA 3HNAA 3OXGA 3DALA 4MI0A 3RIBA
chains in the Genus database with same CATH superfamily
2V9PA 4HEA2 3VDXA 2KL4A 3TDZC 2R3AA 1WJ5A 3ABKH 3Q0WA 2ZJQF 2HKXA 4AIDA 2DXIA 1YIOA 3KZZA 4D7MA 1NK3P 4A3BJ 4NC8A 2PJPA 4EGZA 3A4CA 4HNVA 3RQIA 3PO3J 1XCBA 5KVRA 2ZFUA 2W00A 2Y9YA 4DW6A 3GZ6A 2DA3A 4DYCA 3OY9A 4AU7A 4XICA 4KMUX 2XGDA 1LEAA 5LRSA 3QWLA 1IRFA 2O8XA 3TO7A 1FTTA 3V42A 1XTAA 1W36C 1KU3A 1BR2A 5TJJA 4ZTFA 2V1DA 4Q48A 5IOZA 1QPIA 1ZGWA 4GDFA 1FBSA 3AG4H 1T0FA 2ZSHB 5DD4A 3JREA 3FKJA 1LB2A 2XSDC 4A3FJ 2IS1A 4RM3A 1HC8A 2L9SA 3BTJA 2CUEA 1MT6A 2G9WA 1JJ6C 3TMOA 4EMSA 4ZDOA 4N4NB 3CUQB 3M8JA 3OS0A 1X3UA 3ESWB 4WX9A 2LSOA 1TWHJ 3X2QH 3KP7A 2VL8A 2BBYA 3M9AA 2JZYA 3MKYB 2F5EA 3HOTA 3W2WA 2HTSA 2HFHA 2L01A 2OA4A 3DTEA 4G6QA 3RU0A 4IHWA 4BKXA 1U8RA 4LLLA 2E35A 2VC1A 4M3GA 1KONA 4TV7A 5L3GA 3I59A 4BHCA 5H6QA 3JRAA 1LE8B 1R6RA 1WWXA 1QVUA 3V8KA 3S7BA 1SEUA 2HQNA 1XSDA 1G59A 2NVYJ 4GCVA 1UHSA 3PQJA 2MW8A 2Q1ZB 3MWMA 1QO0D 4BJ5C 4AVPA 3RZOJ 2H6CA 2M87A 2F4OB 4HQMA 5HLGA 1VQPI 3CBPA 1Z0XA 1LVAA 4M9ZA 1B9NA 5E8IA 3HOSA 1IC8A 3IH4A 4XLCA 3WHBA 5EEAA 2VJIA 4MFDA 2ID3A 5CQGA 2R3SA 4KIGA 3CCSI 3SZTA 2M7AA 4DNCA 3MEXA 2CS3A 1PP8F 3M4OJ 1V4RA 1FOKA 1HKQA 1IO2A 1WSUA 2R92J 2ZXWH 3QYEA 1VQ4I 4M3DA 2PMHA 1FPQA 4CYCA 5CCLA 3GW2A 2A5YB 5IP7J 4FHTA 1TTYA 2BW3A 3ZMZA 1HOMA 1EF4A 3RTRA 4B47A 4A5MA 4XLPF 2KIFA 2WADA 2IGKA 4XLAA 4E4HA 4EATA 3HNAA 4HPQA 1A6IA 4LLGF 1DU0A 3QPLA 3WU1B 1D0YA 2OF7A 2VKEA 3B02A 2BVMA 5EYRA 4KT6A 1NH3A 2K9MA 3IV5A 2QEXI 3LMMA 1FIAA 1KU9A 1D5YA 1XDUA 4M3BA 2R7RA 2RVCA 1VQNI 3HKZA 1TT5B 4Y33A 4ZYHA 3MO5A 5CVIA 2TRTA 4RZ0A 2Z33A 3ECOA 1JTXA 5KHDA 2OPTA 4RGUA 1CF7B 5JLXA 3CLOA 4EM0B 1YW8A 4QSHA 3LSHA 2JRTA 2K7LA 3DKXA 3E97A 3ABUA 2OV7A 3I5UA 4BXXJ 1O3RA 3C1DA 2V6EA 1Q1HA 1WI9A 2DT6A 4M9XA 5GADJ 5GTHC 3F72A 1R36A 5M5XJ 1FZPB 1A35A 1IN4A 3SFZA 1Z05A 2MGQA 1MBFA 3HOVJ 4MLOA 1IV8A 2MH9A 1FYMA 5AONA 4ENNA 1T33A 1IAWA 2VONA 1ZN2A 5B5EC 1HXDA 3FWEA 4MFEA 5F6FA 2UWMA 3FXRA 5LRRA 2M8GX 1MUFA 4UVCA 2FRHA 2VQHA 5CVVA 1RETA 3J80Z 3CC4I 4EM1A 1JUMA 1SAXA 2Y75A 1X58A 2P5LC 3RAYA 4QENA 2DOEA 3IRRA 1LQ1A 2ADUA 3CJTB 1R00A 2VB6A 1T2KA 3FBNB 6PAXA 2BHYA 3NRVA 3U1DA 2HVSA 1FOXA 3RPUD 5F1RA 3ZQQA 4G94A 4M6YA 2A68F 4XOTA 5DEQA 3KLNA 2EZKA 2L2OA 2ZXHA 2K9QA 2ZNYA 2OBPA 4L9VA 4V2FA 2IXSA 3DU6A 1W7PD 2EPFA 1AU7A 3O6BB 3OYMA 2XF6A 5CJ9A 1ON2A 4WK8F 2JSPA 2EBIA 5J40A 5DUIA 2FD5A 4A5NA 2XAQA 2UV1A 1YG2A 2IW5A 1MJAA 1V5FA 3PNYA 1QU3A 4X6AJ 3IKVA 4LIVA 1ZAOA 5F27A 3I3LA 1D1BA 3RYRA 3VFZA 3BTCA 1G3WA 3CUQA 5H20A 1MMSA 3L2RA 2XPVA 4CO8A 3GTKJ 4C3HJ 3OV8A 5E1XA 2LY1A 1OMIA 1P7IA 1QRYA 1KQ0A 1ZK8A 4BQAA 2L7KA 2Z3YA 1X3WB 3ZQIA 2L4MA 3GZ5A 2BVLA 2VQCA 4J83A 3G73A 4HRIA 3ZN0A 4O30A 4A69C 3OYHA 1LE8A 2EQRA 2CQQA 2Z9OA 3D5SC 3ERED 2ZKZA 2KRFA 2VJ4A 4ITVA 1RNLA 1W5TA 1REPC 2ZXJA 2HYGD 3M3YJ 1W0TA 1OISA 2BYVE 2R93J 2R7WA 4I02A 2RNJA 2DMQA 2IA0A 4OU0A 2HS5A 2CQXA 5L3EA 3CUQC 3H9JA 1O57A 4RB1A 3BR1A 2FMYA 4XBFA 2IT0A 4JDSA 1R1TA 1N78A 2VIXA 3C2GA 1RC9A 1HDDC 1U5TB 1TC3C 1S7EA 1EV7A 2MBFA 3PNVA 4MNUA 2HDWA 3RQ4A 5KJMA 3K10A 3H36A 5K7HA 3HBLA 1X19A 4HV6A 1X1PA 3K2AA 2X6OA 4YELA 1O3QA 3I71A 1ONVA 2GZWA 1MVXA 3I4MJ 2DJIA 2JSCA 1S8NA 4QLCU 4JX5A 3OS1A 3BO5A 1H9GA 3DFGA 4HF1A 2W25A 4G12A 4I76A 3GLLA 2LF7A 2TCTA 4KMFA 1OCZH 3CO7C 1VQOI 2HEOA 3OYNA 5AYFA 1O9SA 3B6AA 1GVDA 2L7FP 3IRQA 5H6RA 2LH9A 4BY7J 3C3WA 4LB6B 1HW1A 2DA6A 5TISC 1WH5A 1X1DA 4EV0A 2CV2A 4KICA 1MJ9A 2GLOA 1J09A 2PX9A 2JA5J 2NXNB 4IQJA 5M3FJ 1GLNA 1G3TA 4I99C 3WTZA 1CF7A 3IC7A 2R5ZB 3FPDA 1FT9A 1TW2A 3R4KA 2D45A 2Q0OA 2HYJA 4DIQA 3F23A 4IKFA 3IH2A 1R58A 4DGWB 5M5WJ 2HQAA 3HRMA 5FFXA 1YHQI 3ZPLA 1SMYF 2TDXA 2Y2ZA 1Z6RA 3KYDB 3OIPA 5EZHA 5JHFA 5M5YJ 2QKLB 3HIFA 2DA5A 3VV0A 3LL7A 4L0ZB 3S2DJ 3VYRB 4R79A 2Y48A 1X1CA 3M53A 2LYCA 3WGGA 2BY3A 3IAS2 2QQ9A 2ZB9A 4G7ZF 2ESNA 4CICA 1QHHD 3K70D 1HCRA 3BG3A 3NWTA 1VQLI 2VBZA 4XN0A 1RKTA 3DTKA 3KPHA 2ZFWA 4YEJA 2XPUA 1FOWA 1IUYA 3WTVC 1OCRH 4LITA 2F5DA 4BUPA 2HGCA 3O8GA 3EYIA 4LG0B 2OCEA 4Q5SF 3S2WA 1N6AA 5IY5H 3ERMA 3LAJA 5D5WB 1ZARA 2LMDA 3H3ZA 4B3AA 2XVCA 5JJ0A 3L2UA 5FRNA 1XX5A 2R7FA 4L18B 2ESHA 2M4GA 4C2TA 1DU6A 4NVQA 3M56A 1P2FA 1B1BA 4MQ9F 1OCTC 4Y15A 5CVUA 4EJVA 2NOJB 3OYBA 4J7FA 4QEOA 3KEOA 2LR8A 3S7FA 1SFXA 5FB2A 2DDAA 2VKVA 1RKWA 3HRTA 2Y0SA 3D0SA 3TDUC 2OJED 4IQ4A 3HHHA 4UV8A 2AXLA 2KFDA 3KP5A 4XNFA 3CMYA 2XROA 3FF5A 1K61A 2LKPA 4ZZDA 1WVRA 2XAHA 2IPQX 3BROA 3ZXSA 3OYAA 1BI2A 3WU0A 2ZSIB 4BE1A 5IYDJ 3FMRA 1ETOA 3CMMA 2FQ3A 3ZQHA 2Z1DA 3JSOA 3L9FA 4A3EJ 3Q5FA 5EJCA 5FLXZ 3GTJJ 2O61A 1TLHB 3M7GA 2JA2A 4KUMA 5ARGA 4HW0A 1IW7F 3WTXC 2K27A 2OCCH 2A3SA 2QSFX 3ELKA 4WUYA 4EQQA 1V5GA 3HRSA 4JX4A 4F52A 4IRGA 4OMYA 5E8GA 3I54A 5LEJA 2DTZA 5J47A 1I6XA 3CMAI 1VTNC 3M57A 3KEYA 3K9TA 2E7WA 1GXPA 1LEBA 4PFPA 1FNNA 2PLYA 1Z3YA 3ZP5A 1B72B 4HSTA 2VI6A 2JWTA 1JGSA 1E0EA 1LDJA 2Y69H 4XRSG 3DALA 1U5TA 1ENHA 2GBYA 4BEHB 3CP8A 2HZTA 2PJRB 1F43A 1SVMA 3CJNA 2HPMA 4JX6A 4C3IJ 5AIQA 4PUSA 3VYTB 2E71A 3VEPA 2CGPA 2EV0A 1IUFA 3PUBA 4XLEA 5F04A 1N3JA 2V1NA 2CG4A 2M2EA 1Y39A 5HS8A 1OKRA 3PDNA 4J7IA 4N9IA 3M58A 2Q2EB 1WGXA 1PVEA 1RPWA 1XG1A 2P6SA 3R0JA 4LJZF 1U78A 1S29A 1KU7A 3AG2H 3G3ZA 1ML9A 1I3QJ 1YYVA 3SDGA 2CW7A 4IEJA 1P6RA 2JPBA 3DQVC 1V3FA 4PGHA 5D5VB 1FJLA 2DYSH 4UVAA 1VQ8I 5F6LA 2F69A 4PK4A 4ZYDA 2BY0A 2LF8A 5KCMA 3QWPA 1XQHA 2M30A 3OYEA 2H94A 4O6FA 3V8JA 3KP4A 4UUSB 4YPUA 2PMZA 4RAFA 3KYLA 2R5ZA 1PEGA 1I39A 2W82A 5J4VA 5KJLA 2ETHA 2EZLA 3KCCA 2DA7A 2P4WA 5F08A 2ECBA 1HSJA 2QQAA 4CHUA 3H1CA 4RAYA 5JR3A 2I8DA 2OD5A 2L9NA 2XDVA 4GYIA 4IHTA 2J5PA 4GXOA 2HYFA 4OIOF 2E2JJ 3W2AA 4Z4PA 4F91B 3GF2A 2RQPA 4HX7A 3QODA 4HDUA 1VQ9I 1NK2P 2O9LA 2UXXA 4EGYA 1LFPA 1WJAA 1TL8A 3QPTA 2KIQA 2F5FA 4MGRA 4OWRB 3DB5A 2VOOA 5TEGA 1HW2A 1OCCH 1ZKGA 3MFKA 1QQIA 3H3UA 2XRNA 2WV0A 1S7AA 2NS0A 2FNPA 3JCUC 2LLKA 4JYKA 4WXCA 3S16J 4LG0A 2XKOA 2GXAA 3EP0A 1R7JA 4M6XA 5FGMA 1AHDP 4II3A 1U9NA 4OOIA 1BOBA 4A3DJ 3VSKA 3DCFA 2R4GA 2LBFB 5GTIC 2ZJRF 2NNNA 3HTUA 1DDNA 2AQFA 5E18F 1PUFB 2CUZA 4I2OA 2X85A 4XKBA 3JR9A 1IGNA 2JUCA 2W48A 4KN7X 3D5RC 4FE4A 4IHYA 1KYZA 2J5OA 2X48A 4HOBA 2XKPA 5JVGF 4FASD 2LY2A 5ED4A 2DN0A 4ZYEA 2M5WA 3AG1H 2DT5A 2WB1N 2WAQA 2M45A 1Y6IA 4CYDA 2R7TA 2XUBA 2DA1A 2L7MP 2MYSA 5J8FA 3V7SA 4BBSJ 3Q0UA 2DOAA 1OCOH 3FK6A 1H89C 2EV5A 2A69F 3P9KA 1R22A 5AIPA 1JTYA 3HPGA 2ZO4A 3BPVA 4OMZA 4DOZA 1D5VA 3BY6A 1MDMB 1ZR2A 1GDTA 2K3PA 1ETVA 3CJRB 1B9MA 4A2UA 3CCEI 4EJWA 1F9NA 1FIPA 3C2BA 4IJAA 5EG0B 2WWYA 5CVRA 2D2WA 3OR2C 1A04A 1JKPC 3G4SI 1MJBA 1DPRA 1MH3A 3G1LA 3FIWA 3FXMA 5JHUA 5GAEJ 1T38A 1OR7C 4ZDPA 2E2HJ 2R7XA 1MBGA 1MMDA 4HNTA 1Z1DA 1HKSA 1VQMI 5EG2A 4ESBA 3BJAA 4IO9F 2YU9J 2QVOA 3AL0C 3N71A 3S93A 2GM4A 3RIRA 2MC4A 2KP6A 3BZ6A 5FO5A 4XSZF 2V79A 1E2XA 2HVQA 5FD5A 5DM7F 1B72A 3FISA 1WJEA 3Q0VA 3HDDA 4MQVA 2LVSA 4O5VA 3ZMVA 1BOAA 2BV6A 1M1EB 4AD9A 2W85A 4XMYA 3K4MA 3MMYB 1JE8A 1AWCA 4XLHA 4BEHA 3OR1C 1IF1A 2PJRA 3M55A 4F55A 3ECHA 1UMQA 1W5SA 3HG9A 4OAZA 3E1SA 1I3AA 4HBLA 3JRHA 1CGPA 1GUUA 3RI4A 4NC6A 2L9VA 2HTJA 1ACIA 1H3IA 2DU9A 4FT8A 1XMKA 4JK1X 1G4DA 2QGUA 4RLFA 1HQCA 2Q2EA 3HB9A 3OSGA 2VN2A 1MBHA 4A3GJ 2KQRA 3CQZJ 3GTOJ 1OLTA 5JHNA 1AA7A 3TG5A 1ULYA 3CC2I 2BY2A 3K6GA 2AXTC 4BU2A 4HQEA 4A3LJ 2RGVA 2L4AA 3ZGKA 2KJCA 1QZZA 1F4KA 5LSXA 2VJ5A 5D6FA 3F6VA 4FE7A 4U0WA 4RGXA 5ICCA 3MKZA 3JTHA 4UUSA 2JQ7A 2WV1A 3BR5A 3BC8A 5B1BH 3D1NI 1H9TA 1Z3XA 3BR6A 4A3CJ 3UR3C 3HGYA 1VI0A 2V26A 5KK1A 4U7DA 3JRDA 4IXAA 1T39A 4BH9A 3GEZA 1H8AC 1R4MB 4EEFG 2KDOA 3IKTA 1Z67A 4ZTJA 4E7IA 3RIBA 1IXSB 3DXJF 3GUDA 4FETA 5E17F 4EJTA 3VPRA 4GRIA 2VODA 3PM1A 1Y8QB 2H8WA 2F2EA 2LREA 2V1UA 1GVJA 4HX4A 4I09A 2VXZA 3OPEA 2AO9A 2ZCWA 4XKCA 5E1ZB 3LOCA 2ELJA 1FBUA 1K4SA 3FK7A 5HS9A 3V8LA 1T98A 2MSYA 2V7FA 2QWWA 3HRUA 1JT0A 2CV0A 2E60A 3CCLI 1QZYA 1W4MA 2AQEA 4IF4A 5F0FA 2KMUA 3JAMZ 2FEZA 1SFUA 2R7ZJ 2M9HA 4QIWN 3J81K 2B0LA 1D8KA 3PL8A 4B3XA 4IZZA 2EILH 1TQMA 2OQRA 2JUGA 5H2FC 2OTLI 5A2QK 2OTJI 1E3PA 4M3FA 1TP4A 4YFXF 4YPEA 1YJNI 5DDGA 4MEXF 4FTHA 1SVLA 2MD0A 2XF5A 3F0CA 2LBFA 1JJ8C 3KZYA 1XGOA 1P92A 2PFBA 3K69A 4M9SA 3M8EA 5ERIA 1PUFA 1GT0C 1USSA 2BE5F 1D0XA 3S1RJ 3A1YA 1BI1A 5BPIA 3AFHA 4OIRF 2R0QC 3ZQ7A 1R49A 5E1WA 2H27A 3HOZJ 1VQ5I 4BE0A 3PQKA 3DBRB 4RB3C 2DMUA 5F6KC 2IGMA 3L1PA 1OJLA 3BQYA 4FX0A 1TZLA 1OYYA 4XOPA 4ASNA 1NTCA 2IEKA 3F9ZA 4E7KA 1K7AA 1BW5A 3FXOA 2EIMH 1YS7A 2EB7A 1ETYA 3MO0A 3HSEA 1QA6A 2A05A 5FROA 2E19A 2ELHA 4ZYAA 1EA3A 4CH7A 4LB5A 3OOIA 4HYEA 1TW3A 3CC7I 4L0YB 1ZG5A 3HPHA 2E1NA 2DMPA 1DP7P 2JMWA 3OOUA 1OPCA 1MDMA 3EUKL 4G8XA 2VUMJ 1FP1D 1SFEA 3PSIA 2DQRA 1LDDA 1WI3A 3K0LA 4WCGA 1DUXC 1WJFA 4A6DA 5EG0A 4IJ8A 3J7ZI 3REOA 5FLVA 1XPXA 2X1DA 3WTTC 4KISA 3KYCB 1D8JA 5JINA 2IS4A 5CCMA 4AYBA 1ETKA 1O3SA 3EQLF 1MNMC 1FLIA 3RCOA 1OYIA 2K9NA 4YFKF 1N77A 3HSRA 2DBBA 2A61A 3W3CA 3DP7A 2O03A 2DW4A 2JK3A 3KLOA 4I98B 4QTRA 5DV5A 4NB5A 3TW6A 5HNFA 3SZPA 1R71A 2ECCA 1T56A 3OXLA 3CLQA 1U8BA 3I4NJ 4HNUA 1WPKA 3U9GA 3V7RA 2V6CA 3V7CA 2M0MA 5LFAA 3BCBA 5T5GA 4YNPA 4I51A 5B66C 2G7UA 3BTIA 1Z7UA 3TOAA 1BW6A 1G3SA 1LNWA 1ZYRF 3IAM2 2JJ7A 3HOUJ 2QZ8A 3IHXA 4CCJA 3SQNA 1E17A 5ILVA 3EUHA 2P7VB 1G2HA 2L54A 2HQ5A 2NOGA 2L02A 4ESFA 1K79A 4UUVA 3QP6A 2STTA 5IT9Z 2VT2A 4IRHA 1I50J 2IA2A 2QENA 1XGSA 4PGGA 4RM2A 2K86A 1NG6A 2QA4I 3G1OA 4IOAF 1VNDA 3FMSA 2DJNA 4JQFA 4KYWA 2YR2A 5CVJA 2JVHA 2A6EF 3I58A 5IP6A 1AKHB 3C7JA 3CZ6A 5DCMB 2M4KA 4ESJA 3KETA 2W84A 2WA0A 1XMXA 4ENJA 1EJ9A 4A3JJ 2GA1A 4XM3A 1J75A 2FU4A 3RSNA 4IJDA 3S14J 2CWEA 3ABLH 4R8HA 3U21A 3COAC 5D5UB 4NHJA 1XDSA 3BR0A 1FBQA 4OIQF 2H09A 5B1AH 2FOWA 5K5OA 3CUOA 3EUHC 1CQTA 5LD2C 4LOCA 3K70C 1ETWA 1X4PA 1Y1VJ 2Z5UA 4IHXA 1VQKI 2MFZA 4G9YA 1TQPA 2CRGA 2HPIA 2UXNA 2OZ6A 5M3MJ 2JRMA 2KZVA 3VUZA 1YFHA 4GGGA 1MNDA 3LSKA 4LLNA 5F0CA 3OYJA 3SJMA 1XSXA 3FHZA 2NS7A 2IBDA 4RA2A 1BC8C 4BQOA 3OYKA 3IL2A 1H0MA 3WE3A 1R23A 2L3DA 4CGZA 2JA7J 2K4BA 2AHQA 3ASNH 4GYGA 3P7NA 1IXCA 2B9SA 3MVPA 2VQLA 3LFKA 3TW7A 2OUMA 3ONQA 3LNQA 2F6CA 2XHKA 1U6GA 1SAUA 2CUFA 3SEZA 1T8IA 3E5UA 2P7CB 4IPAA 1MIJA 3K4BA 3S2HJ 4MI0A 4NUBA 3J7AO 3ZN1A 2ZJ2A 3A01B 3QPHA 2RN7A 3M1EA 5GPAA 2ID6A 2ZMEB 3LAPA 3CESA 4O6JA 2LFBA 3ZMSA 4ENKA 2CV1A 4XR6A 3G2BA 3WG9A 4F3QA 2P0WA 2R7SA 2QF7A 5CKTA 2X0LA 2Y9ZA 1P7JA 2CMPA 4F7ZA 3TP0A 4HDVA 1BJAA 4BQQA 1W0UA 2H1LA 3CCMI 3GVAA 3M5AA 2RNGA 3G6EI 1BL0A 3NWSA 3PIPF 1MKMA 3QRFF 1BBYA 1OYWA 1IN8A 2HQRA 4QWQA 4ZDLA 5GAHJ 4J00A 1R9TJ 1I5ZA 3KMJA 2BHZA 1QZEA 3PFYA 2RAEA 3HKZN 3PO2J 4AIKA 2RDPA 1WCMJ 2CQNA 2RC4A 1IG7A 2FSWA 3ML6A 5B3SH 3NEUA 1JI8A 2DO7A 4BS9A 1BI3A 2DFHA 2ME0A 5L3FA 3OS2A 3MKLA 4I01A 1ZG1A 1N6CA 4R1HA 4G6DA 3MZYA 4ZC3A 4B48A 3Q9SA 4P5OA 2MG4A 1STZA 5C44J 3CCJI 3AG3H 1KZHA 5FKKA 1FMWA 3BG5A 3E7LA 2HVRA 2LTPA 2KKOA 3DKWA 5C3EJ 1QVTA 1LFBA 5EEHA 2VASA 1K4TA 4PJLA 4P9UA 2V1XA 2QLZA 4PFOA 4J01A 3IWZA 2F4MB 2GXGA 3QYFA 3DPTA 3TBIA 3K4LA 4BYYA 2W1OA 1JUSA 1RUOA 2YPRA 3GO5A 5FKOA 3MO2A 3OWTA 2K9LA 2XAUA 1NHAA 1BR1A 4P55A 2CW0F 1S7OA 4B4CA 1TNTA 1MBKA 2EA4A 5EX3A 3LQRA 1Z77A 4F93B 5J3LA 3DLLF 2QUFA 3HOXJ 3LA2A 2BEOA 3AL0B 4A12A 3KP6A 1JKQC 3TO9A 3TOBA 4RGRA 3BR2A 2Y31A 3F22A 1VQ6I 3CCVI 2P5VA 4M72A 2R7OA 1SFKA 3IHUA 4A6EA 3KMTA 1ETXA 1PJRA 1APLC 4IHSA 1E3OC 3WODF 1DP3A 5ILSA 4Y7NJ 2ISYA 4H4KC 2DQLA 5TRDA 3RKQA 1AKHA 1FWZA 3F9KA 5DCMA 2GWRA 2MA3A 2Z99A 3ASOH 4MEYF 1RIOH 2HOTA 4YRVA 4U88A 1F1ZA 4L9TA 4N0BA 4W1UA 4AUXA 4YG2F 3FXUA 5FKMA 4D1QA 4A3KJ 5HNHA 1YIJI 2N8GA 2VKDA 5L3DA 2DYRH 3GFJA 3DEWA 4PZJA 3GMEA 1Y1WJ 1FEXA 5J1RA 5E3MA 4CCLA 1FTZA 2RFIA 3SW9A 1J59A 3BLYA 3MQ0A 1VQ7I 3TG4A 5L3BA 1XD7A 4XIDA 2D1VA 2A6TA 4I6ZA 2NYXA 3F9XA 3P9IA 5HLIA 4KN4X 4A3IJ 3BOQA 4PCQA 4YIIA 4BHPA 4DYRA 2Q8KA 5KJKA 2G46A 2QQ8A 2R5YB 3GBGA 5F5EA 2V9KA 4S0HB 3LWFA 5K5RA 4W97A 4EM2A 3CD6I 5J8CA 3K5KA 4DYQA 1WFXA 4JBAA 1O7FA 4UVBA 3A02A 4C9YA 1S6LA 1X1BA 3OIOA 1PYVA 1QGPA 4KIFA 4Y4RA 3F21A 3J80K 3GZNB 3HC7A 3J7YJ 5LHIA 5TGTA 2WAFA 3OYFA 1XGNA 1IN6A 1R1VA 4BNCA 1RRJA 4G7HF 2F5CA 3GTPJ 5ICGA 4BL0B 4M71A 3ZMDA 2VKHA 2KJBA 3A01A 3ABTA 1U0JA 1Y8RB 1YS6A 2ZMEA 3AAFA 3K4CA 4UNOA 3HOWJ 1IRZA 4MTDA 4BGDA 5HOOA 1TT0A 1HF0A 3S1MJ 1TBXA 5HDKA 1S72I 2KT0A 2CW8A 2KZGA 4Z2YA 4ENMA 3KEQA 4U87A 1C0WA 3T0YA 3L2WA 1ZGAA 2E36A 1W7PB 2FBKA 4D9JA 1ZQ3P 3EUAA 3VSLA 3BQZA 2BXZA 3DU5A 4OAYA 1GXQA 2XSJC 2DPUA 3ZCOA 2E5ZA 4QEPA 3OYCA 3O8HA 2KRHA 5LBQA 4BACA 5IPAA 2YX7A 5HVQC 3WE2A 5HLTA 1O3TA 1IJWC 5EDNA 4NBQA 4WF2A 1SVOA 2WBMA 5J6XA 2K02A 4ZJZA 3DPUA 2O8KA 1JHHA 3K4JA 5FFZA 4XK4A 5TTFA 2ZMEC 5E3OA 2RV8A 3JRCA 2BXYA 2JVGA 3E5QA 3QOPA 2B7EA 3JTGA 1UG2A 3F6OA 3WU2C 5D4RA 4BAYA 4L5IA 5GAGJ 1ZREA 2WTEA 4LDGA 2PQ8A 3GYHX 3SXYA 5DS9A 4S05A 1I27A 2CU7A 5DCFA 3CDLA 2NRAC 2VXDA 2QPWA 1LVKA 5LHGA 4CZCA 2E5NA 4NNJA 3CTAA 2H6BA 1R5ID 2W24A 3LA7A 4F92B 2MC3A 5J1YA 2ICWG 2IAIA 5FRMA 1G3YA 2K3FA 3GCMA 3HEFA 3QU3A 2DA4A 2HI3A 3I4PA 2VLAA 1OR7A 3ABMH 4GO1A 2YS9A 4V2GA 4BXFA 2VOPA 3JRBA 2I10A 3TP3A 2CJJA 2XAGA 4C1QA 3WGIA 4A0ZA 3FHNA 3GFIA 3DBLB 4AC0A 3CCUI 1LKXA 4XRMA 3OYLA 3HUGB 1FOYA 3ZOBA 2OAZA 1L3LA 1K6OA 2VQGA 2KRCA 2DK5A 3IWFA 3LFUA 4YFNF 2BZTA 1GV5A 2DK8A 3KP2A 2OZUA 3WTUC 5K7ZA 1ORKA 3I53A 2ISZA 2FA5A 3LSTA 5IT3A 2DT7B 2XV4S 1F36A 4G7OF 3RKWA 5LGTA 2V9VA 4RDUA 3OSFA 2P81A 4PJ0C 3UKGA 3O3KA 1YE9A 2HOSA 2GAUA 3RDIA 2EFQA 4KIBA 2Y0SN 2LNBA 3CDIA 3HJEA 4D5CA 1FSHA 5F59A 3BJ6A 1SD6A 3HGGA 4N9HA 3K1NA 3L7WA 1YRNB 4Y52J 3P9CA 1ZHFA 2EZHA 5C4JJ 3KZIC 2GQQA 1BR4A 4MIMA 2XGXA 2XASA 1JKRC 3VWBA 5EGOB 3JSPA 4FISA 2NVTJ 2VBWA 5TH7A 2DAOA 1ZH5A 3E0JB 3TL4X 2MH2A 2VBXA 4AIJA 1UHMA 4IHVA 4D0PA 2JT1A 1SC7A 1SD4A 4LK0F 4NC7A 2DTRA 4MTEA 2VE9A 2R5YA 3FKIJ 3OYGA 1Q1VA 1O4XA 2GIZA 5HDNA 2DDBA 5IP9J 1A31A 2XIGA 3KE2A 2MLGA 1VFCA 2PN6A 3MD2A 3I0TA 5FKLA 1Y56A 3R6SA 3I64A 5D8KB 5ARFA 2O6GE 4OIPF 4YNDA 1MBJA 4EJUA 2Y0MA 1YITI 3P5JA 4CCMA 2Z2SB 2VPRA 3S7JA 2ZXIA 2KIUA 5E3LA 2NNYA 1U3EM 3H5RA 2WC2A 1XS9A 2XAJA 1BIAA 3GTMJ 2B63J 2IGOA 4L5JA 4LMYA 4E47A 4UB8C 1TWCJ 4J19A 4XKWA 3NARA 2QBYB 3MZ8A 1D3YA 2HNHA 3QYBA 5DYMA 2XGCA 5JLWA 1UFMA 3OYDA 3CMEI 5D8LB 1ZRDA 1JUPA 3H0GJ 2P6TA 2X1CA 3RPUA 5D4SA 2L0KA 4B8XA 2PEXA 3PFIA 3I9V2 4IX7A 2EJRA 2K9SA 4HSRA 1BM9A 5JI6A 2P5KA 1Y0NA 4IVNA 2O0YA 3L2VA 3IUOA 3CBOA 1YX5A 3D5LA 3QPSA 3QQAA 2CQKA 2WY7Q 4M3EA 1W7PA 3DKYA 3WGHA 3LQQA 1RR8C 2GOMA 3DBHB 2LP0A 1FP2A 2ZC2A 1Z6TA 2FF4A 3TGNA 3V4GA 2L7ZA 4B1RA 3FM5A 1FC3A 3RJPA 2X4HA 3CJQB 1W5CC 3HL2A 2KIMA 5F1JA 1WKMA 1R5HA 2LRDA 2PMZN 1UG0A 1UCRA 5FKNA 5J4YA 3E5XA 1B6AA 2XRLA 1T0FC 2E1CA 2K85A 3LSMA 4XLFA 1MNEA 4L9JA 2O7OA 4BY1J 3VB2A 1ZLKA 4MO7A 1U9OA 2LD5A 3MEKA 1Z91A 2V4JC 1WZ2A 4PSXA 2IS2A 2EFWA 1A36A 5GP9A 4B09A 3PJRA 4DJAA 5FLXK 1ITYA 2CSOA 3EYYA 4JLGA 4M74A 4IRIA 2PI0A 2EFPA 2P8TA 2KLOA 3M1CA 4JOMA 1MVHA 4CZZA 2KHMA 4RAZA 4I7HA 4XN3A 1W36D 4GFBA 1FMVA 3F8NA 4NQWB 3GTQJ 3SYTA 3K2ZA 3DWLE 3T1BA 3B73A 4Q47A 5DM6F 3FDYA 3FXJA 5E20A 3F8CA 3FX3A 1SD7A 3QOEA 3R60A 2ZNZA 1V5EA 1Z21A 1D1CA 5JFRA 3F8FA 1TWGJ 1RR7A 5EZGA 3BJOA 1ON1A 4WXDA 3VOEA 4JP0A 5ILUA 3LSJA 2HKOA 1KA8A 3A03A 3GXOA 4C30A 2LKSA 3CCRI 1ODDA 3HUGA 2FNAA 3N97A 1P4AA 1OFCX 3L09A 4LIUA 3KMAA 3CDHA 3OXGA 1PDNC 2MD5A 1PUEE 1XN7A 2QKMB 2O8JA 4LD5A 3W2VA 2QM3A 1EH7A 3BZKA 2DPDA 1I1SA 1QBJA 2IGNA 1OQYA 2YX4A 3TO6A 1F5TA 3BDDA 5LEKA 3A2KA 3W6JB 2WAQN 3ULQB 1J0RA 3T8TA 3T5XA 2G0EA 3K1MA 3HOYJ 3W6VA 1WJCA 5LSZA 3LSIA 4UXNA 1RESA 3R0AA 1BA5A 1WJBA 4LFUA 1YRNA 2WY8Q 1MSEC 3HM5A 2HXIA 2COBA 2CYYA 3IH3A 4KT5C 5BS6A 3K4KA 2DODA 5EGOA 3GTLJ 2I5UA 4NDLA 1BN5A 4B43A 5L3CA 1IXRC 5LGNA 2BY1A 2EH3A 4ETSA 1V55H 4ZH4F 2W7NA 1JGGA 2L9RA 3BG7A 3RPQA 2LOOA 1LPQA 3K4NA 4RS8A 1B4AA 5E3NA 3FZVA 4XORA 4BQNA 1X2NA 2X1EA 2K5CA 3HZJA 1SFOJ 2FX0A 5J1UA 3RKYA 1VF9A 1B59A 2QCOA 3HTSB 2PMUA 3ZQCA 1R5GA 3QAHA 3L2CA 2EK5A 2ACJA 5DUKA 4L9NA 5DD8A 3U2RA 4BJ6C 3CBMA 2C6YA 2EFNA 3G1MA 2KISA 4RAGA 2M1BA 4PDKA 4XL9A 4Y3OA 1IN7A 1TWAJ 5CYVA 4E7SA 1MH4A 5KNLA 2QBYA 2XPWA 1WHUA 4X0GA 3FXKA 4BBRJ 3EETA 5BPDA 3F3XA 3DV8A 1X2MA 3FM3A 3PNTA 4XKVA 3TKYA 3BCAA 1DQUA 1I6HJ 1XB4A 2OC6A 3WTWC 3GTGJ 3KP3A 1MMNA 3S32A 2IJLA 2W4SA 3I55I 2E2IJ 3S15J 1N75A 1YO5C 3S3OA 4CSWA 3DPLC 2FOKA 3R61A 4ON0A 1IRXA 1KGSA 2RKHA 4P96A 3H0DA 1YOVB 3NAUA 1BI0A 2CQ7A 2FXAA 5KAIC 1L0OC 2O3FA 4KDPA 1HW5A 1ZRFA 2H8RA 3QWWA 4DBRA 3MAJA 3S17J 1XSVA 3SFIA 1UJ8A 2ME6A 3Q3SA 3BR3A 3SZGA 4KA4A 3ZQFA 2MLKA 4UUTA 2LK2A 1R1UA 2STWA 3KIOA 3F8BA 4II2A 5DTDA 1DPUA 1KQ8A 1LJ9A 4BXUA 4M6VA 3HHGA 1ETQA 2NVXJ 1T08B 3PUFA 2W57A 2HDDA 2M7BA 1WH7A 4B44A 4IOCF 4KFCA 5HQ8A 5HODA 2QYOA 1IN5A 2RREA 1YX3A 1USTA 4HA8A 4UY8I 1POGA 2HZDA 2FUG2 5K5QA 1TWFJ 2HWVA 2D5VA 2JPCA 1S9HA 2HXOA 1OCPA 5F0HA 2VJJA 3S3MA 3FBIB 3LA3A 4LG3A 2EIKH 1ZLJA 3WTYC 5FLMJ 1YW9A 4NQWA 3BPXA 4J8OA 4A3MJ 3KX2A 2DLLA 2IS6A 4CCNA 1Y0UA 2DFFA 3JRIA 1ZKKA 1A5JA 4KJZA 4ZYGA 1MZBA 4D5FA 3DEEA 3ZR8X 4K2EA 5ICEA 2Z16A 3ZQLA 5HS7A 2E1OA 4E7JA 4Y13A 3HXLA 3S3NA 1P9QC 1WRJA 4M73A 3ZMUA 3K1PA 5FD6A 1UAAA 2E34A 2M34A 1HKTA 3S1NJ 4NJ5A 2CO5A 4LK1F 3GFLA 3W6KB 2NAZA 4BJTA 2MABA 4ZZLA 1XCVA 3CCQI 4E7HA 2OU2A 3T8RA 4DQ2A 4FCYA 2H1KA 2VPLA 3WTSC 2CFXA 3N4MA 1Z7LA 3SWCA 2FQ4A 1GHCA 4IL6C 2EWNA 1J7KA 1EKEA 5EX0A 3ZQGA 1ZRCA 2DOFA 3C2HA 3H9GA 4PJNA 3S8PA 2RQQA 2IP2A 2YSRA 1MGTA 1MBEA 4YNMA 1MD0A 2NVUB 3DLAA 1FY7A 3A0HC 2VE8A 1TNSA 3VODA 4HF0A 3SEQA 3Q9VA 3H5AA 2OQGA 3OIQA 1A6QA 2KPMA 4E6KG 2ZJPF 4YPAA 4HV5A 2DA2A 2EA2A 1W1WE 2FMLA 3ROUA 2DMNA 2F48A 3CF2A 2A6HF 3DEUA 2HOEA 3BG9A 4U0YA 2E1MB 2PG4A 1LDKB 5HLHA 1UELB 2IGQA 3OOPA 2F4IA 2X6XA 5JVTA 3BP8A 3BG6A 3RZDJ 4QPQA 2IRFG 3H3VK 3RJWA 1SANA 1AOYA 2WAEA 2WB1A 3J7AY 4AYBN 2XF7A 2VC0A 1IV6A 3HYIA 4PSWA 4UHTA 4RMNA 1ZELA 4HZFA 4N4OB 1RUNA 3H92A 2K40A 5K1YA 2KDZA 1HSTA 2BOLA 2YUSA 1P4WA 4CDGA 1B8IB 1KU2A 4Q4ZF 2GOXB 1K6YA 3OXFA 4H12A 4QPOA 5IYBJ 4CUGA 3M07A 3QWVA 4XONA 3JAMK 1U2WA 2CUJA 2FJ1A 2HR3A 4HAMA 2DCEA 4HLXA 1QPMA 3C18A 2X6YA 1MW7A 2R7UA 1H88C 4C2UA 2NS8A 1K78B 3BT9A 2UUZA 3N05A 4XRFA 2GXBA 1ZG3A 2LKXA 2X51A 5BMZA 3K7AJ 3EDPA 3OL4A 4I0BA 1S3JA 4UB6C 3FXQA 4P1WA 4XSXF 2HDCA 1E3HA 1N25A 1BC7C 4FMUA 4Z6YA 2XB5A 4RLQA 3G71I 3BTLA 4EVIA 2NVQJ 2R7VA 2JN6A 2DI3A 2M0CA 5K7FA 4BDZA 3J81Z 2XB0X 1YLFA 1PP7U 3SDBA 4A0XA 1HBXG 5CPRB 4EJOA 3ISPA 4HG2A 5A2QZ 2QSGX 4HLYA 3M59A 1JHFA 2GIVA 4AM3A 3MN2A 1BJZA 1WJDA 3CP2A 1DGWY 4A93J 3F9YA 1YJWI 1X1AA 1BIBA 2XC7A 5JIYA 2JTVA 3RYPA 5IOYA 1KYWA 1X4OA 5T0MA 2DMTA 2EZIA 2PBIA 3O2PE 4CCOA 4V19K 3WG7H 5ICFA 2R7QA 4D7NA 4ABZA 4ANJA 4AVZA 3E6DA 1KQ9A 3SHFA 2K4JA 4LGWA 2COMA 3OL3A 4O3MA 5KJNA 3VYUB 4CCKA 3CCYA 1J2XA 3GLXA 4HF2A 1MMGA 4MI5A 1XMAA 2BGCA 1LFUP 1T6SA 1IRGA 3TEDA 1XGMA 4CXFA 3OYIA 2FBIA 2JV0A 5LGUA 2W5ZA 3NQOA 2QSHX 1DGRM 5E79C 4YIRX 4WWCA 1JXSA 2BQZA 2M8EA 5IYCJ 4MHGA 3S1QJ 3BWGA 5D6EA 1YTYA 1QNTA 4PJJA 1K83J 1UZCA 2VBYA 4PJMA 3H5NA 4RB0A 4KNYA 3H9QA 1YW7A 3ZRGA 5CQEA 5HDGA 2CFOA 4DBQA 2JA8J 2A5WA 4FQGA 4H0EA 1HA8A 2DFEA 2LDUA 3QP5A 4KITB 3AKZA 3JRFA 3DF8A 3L2QA 1P4XA 3CF5F 2QQBA 1D0ZA 4X1EA 2Y30A 5BNGA 4U0VA 4C3JJ 3CO6C 1MSFC 3LSPA 3WHCA 1LUJB 3GX4X 2YU3A 3I59B 1QHGA 4DZPA 1U5TC 2X6WA 1TQIA 4RBOA 5EEGA 3RKXA 4E70A 5C4XJ 1D1AA 1T95A 5LLQA 3FMQA 3PIOF 3LSRA 1YQAA 5BOXA 3LSGA 4CA0A 2LG4A 5LHHA 1FX7A 5GPCA 2ELKA 1VZ0A 5EF6A 1ZR4A 4AWXB 5FJ8J 5IT9K 3FXLA 4E7LA 2CH0A 3JRGA 3U1KA 3S7DA 3MZHA 1IZ1A 1JKOC 3TQNA 1XC5A 1Z9CA 2EV6A 2GA2A 4OINF 2EFOA 2E7XA 3H35A 1NG7A 3E6BA 9ANTA 1EH8A 4CYCB 4WXHA 2A07F 3GFMA 2UZKA 1EH6A 1RZ4A 3MKWB 3BZCA 2BW3B 2X9DA 4BHBA 2R7DA 3GWZA 1ERDA 1ZTRA 3OMYA 3EPZA 1IDZA 1HDPA 3ZMTA 3M8FA 1GV2A 4BDYA 2HU9A 4BE2A 1WQ2A 5F64A 3DTIA 1X3ZB 4FX4A 4XQFA 2L5QA 3KFWX 2IA1A 2D1HA 3JW4A 2ZBKA 4A0YA 1MMAA 3A0BC 1I1GA 3L00A 4I0AA 5D5XB 4U7BA 1G8XA 4P9FA 1ZGJA 3E3VA 1O7LA 4G6TB 4XRSA 1B8IA 2JA6J 1RI7A 1R4NB 4RB2C 1SMTA 5CLSA 4AIHA 5BQTA 5KAFC 3PSFA 3I56I 3E6MA 3F8MA 2FE3A 4XLNF 2AS5F 1J5YA 4RGSA 4UV9A 4L5EA 2E1MC 2EIJH 1HLVA 1SD5A 1K78A 3M54A 2F5VA 1G6NA 4DZJA 1IDYA 2FBHA 5HI7A 3F9WA 3HSFA 4E7ZA 4YIFA 1J9IA 2HOAA 2XAFA 2DFIA 4Y17A 2W5YA 3E6CC 1FYKA 2LY9A 1V54H 4HX8A 1UHWA 2LC2A 2G7HA 1YI2I 1S5LC 2IVMA 1FSEA 2EINH 3QU6A 1UB9A 4C2MJ 3MCZA 3VYSB 1JT6A 2M3AA 4S04A 5T0KA 2O5RA 3IP4B 3OS5A 1FYLA 3B6CA 1YJ9I 2VT3A 2XGEA 3UNGC
chains in the Genus database with same CATH topology
4HEA2 2HPMA 3VDXA 2KL4A 4PUSA 3VYTB 2R3AA 1WJ5A 2QKMB 2O8JA 4XLEA 3W2VA 3PUBA 1N3JA 3CESA 2V1NA 2DXIA 2IGNA 2CV1A 4XR6A 3PDNA 4NC8A 3G2BA 4F3QA 3A4CA 4J7IA 2P0WA 2R7SA 3M58A 5CKTA 2Q2EB 3A2KA 2CMPA 1ML9A 4BQQA 2ZFUA 2W00A 2CW7A 3OY9A 1WJCA 5LSZA 3LSIA 3DQVC 3M5AA 4AU7A 2RNGA 3NWSA 1WJBA 2WY8Q 5F6LA 4ZDLA 4J00A 2F69A 4PK4A 3KMJA 3K4KA 3V42A 3PFYA 5KCMA 3QWPA 1XQHA 1W36C 3OYEA 4B43A 1BR2A 4ZTFA 4O6FA 4YPUA 2PMZA 1JI8A 2W7NA 4BS9A 3KYLA 1PEGA 3BG7A 3OS2A 2W82A 1N6CA 2LOOA 3K4NA 5KJLA 4ZC3A 4B48A 2ZSHB 3FKJA 4P5OA 2IS1A 4RM3A 2L9SA 1MT6A 4XORA 4BQNA 2X1EA 3TMOA 4ZDOA 4N4NB 2I8DA 3M8JA 2K5CA 3OS0A 2L9NA 2XDVA 4Z4PA 3W2AA 2VL8A 4F91B 3MKYB 1FMWA 3HOTA 3W2WA 2HVRA 3DTEA 3QODA 3RU0A 3CBMA 4BJ6C 1LFPA 1KONA 1WJAA 4XL9A 2VASA 4Y3OA 4PJLA 4J01A 4PFOA 1R6RA 4OWRB 5TEGA 3DB5A 3S7BA 3QYFA 4E7SA 3DPTA 5KNLA 3TBIA 3K4LA 2W1OA 1G59A 4X0GA 3MO2A 2Q1ZB 3OWTA 4BJ5C 2K9LA 2XAUA 1BR1A 3PNTA 4XKVA 3BCAA 1DQUA 5EX3A 3CBPA 3HOSA 3EP0A 2OC6A 4F93B 1MMNA 3S32A 4XLCA 2W4SA 2VJIA 4II3A 3AL0B 1N75A 3S3OA 4CSWA 3DPLC 5CQGA 1BOBA 1IRXA 2M7AA 2CS3A 5KJMA 3VSKA 2R4GA 2LBFB 3H0DA 3QYEA 2R7OA 1SFKA 5CCLA 2AQFA 2CUZA 3KMTA 2X85A 4XKBA 2BW3A 1PJRA 4DBRA 3QWWA 3D5RC 3RTRA 1DP3A 4B47A 2WADA 2IGKA 4XLAA 3UNGC 4E4HA 4EATA 2LY2A 4H4KC 4HPQA 4FASD 3HNAA 3SZGA 1D0YA 3F9KA 4II2A 2BVMA 2WAQA 1Y6IA 2R7TA 4YRVA 4KT6A 2K9MA 2MYSA 2M7BA 4D1QA 4B44A 3LMMA 5HNHA 2DOAA 5HQ8A 2VKDA 2RREA 1YX3A 3HPGA 2R7RA 4DOZA 3SW9A 4CCLA 2RFIA 3TG4A 3BLYA 2HZDA 2FUG2 3HKZA 2K3PA 4Y33A 3MO5A 3CJRB 4RZ0A 1S9HA 2A6TA 3F9XA 2VJJA 3S3MA 3FBIB 5KHDA 4LG3A 3LSHA 3OR2C 3DKXA 5KJKA 2G46A 3GBGA 5F5EA 2V9KA 4J8OA 2OV7A 3KX2A 2V6EA 2IS6A 1OR7C 4ZDPA 4CCNA 2R7XA 2DT6A 1ZKKA 1MMDA 3K5KA 4KJZA 4HNTA 1WFXA 5EG2A 3DEEA 3ZR8X 2Z16A 1X1BA 4C9YA 3AL0C 3N71A 3S93A 4E7JA 4MLOA 2MC4A 3HXLA 1PYVA 2KP6A 1P9QC 3S3NA 4Y4RA 1UAAA 2HVQA 3HC7A 5TGTA 2WAFA 3OYFA 4NJ5A 1WJEA 2UWMA 4BJTA 2MABA 4E7HA 4XMYA 3K4MA 3MMYB 2VPLA 1MUFA 4XLHA 4BEHA 4BL0B 2VQHA 3OR1C 2PJRA 3M55A 2VKHA 1Z7LA 4F55A 3HG9A 3SWCA 4OAZA 3E1SA 1U0JA 3K4CA 3RAYA 5EX0A 4QENA 3C2HA 4BGDA 3H9GA 1TT0A 4PJNA 3S8PA 5HOOA 1H3IA 2RQQA 4RLFA 2VB6A 4YNMA 3FBNB 2CW8A 3DLAA 4U87A 2HVSA 2KQRA 3RPUD 3ZQQA 4XOTA 3L2WA 1OLTA 3SEQA 1AA7A 3H5AA 3TG5A 2L2OA 2ZXHA 3OIQA 4D9JA 2KPMA 3EUAA 3K6GA 3VSLA 4E6KG 4BU2A 4YPAA 3DU5A 4OAYA 3ZGKA 2XSJC 5LSXA 2IXSA 3CF2A 3DU6A 3ZCOA 2E5ZA 2VJ5A 4QEPA 2E1MB 1LDKB 3OYCA 1UELB 2KRHA 3OYMA 4BACA 2IGQA 2XF6A 2F4IA 5HVQC 5HLTA 2X6XA 3MKZA 3BG6A 3BC8A 2JSPA 1Z3XA 2WBMA 4QPQA 3UR3C 4ZJZA 3DPUA 2V26A 2UV1A 3K4JA 3RJWA 2WAEA 2WB1A 5TTFA 3J7AY 1V5FA 3PNYA 1QU3A 2XF7A 4LIVA 2KDOA 1D1BA 2JVGA 3I3LA 4PSWA 4ZTJA 4E7IA 3RIBA 4FETA 4RMNA 1ZELA 4N4OB 4LDGA 3L2RA 4GRIA 2BOLA 2LREA 2LY1A 2GOXB 1K6YA 2VXZA 3OXFA 3OPEA 4QPOA 4CUGA 4H12A 2L7KA 4XKCA 3QWVA 2VXDA 4XONA 1LVKA 2BVLA 2VQCA 2QPWA 4J83A 4CZCA 2E5NA 4HRIA 2CUJA 2ELJA 4NNJA 4O30A 2DCEA 3OYHA 2X6YA 1MW7A 2R7UA 2V7FA 3D5SC 2CV0A 4C2UA 4F92B 2E60A 5FRMA 2UUZA 3N05A 2AQEA 4ITVA 2VJ4A 2KMUA 2X51A 3OL4A 3PL8A 4P1WA 2VLAA 4B3XA 4IZZA 2R7WA 2JUGA 4FMUA 4RLQA 4BXFA 2R7VA 4YPEA 4BDZA 4C1QA 3H9JA 3FHNA 2MD0A 2XF5A 3SDBA 5CPRB 4HG2A 4JDSA 2LBFA 1LKXA 3OYLA 3HUGB 2VIXA 3C2GA 1N78A 3M59A 1WJDA 3CP2A 2VQGA 3PNVA 1D0XA 1DGWY 2HDWA 2KRCA 3A1YA 3AFHA 3K10A 3LFUA 3RQ4A 4BE0A 1X19A 5F6KC 3F9YA 2DT7B 1X1AA 2IGMA 4YELA 2XC7A 5JIYA 1MVXA 1X4OA 1TZLA 5T0MA 4XOPA 2DJIA 3F9ZA 1YE9A 3OS1A 4CCOA 4E7KA 3BO5A 2R7QA 4ANJA 4AVZA 5F59A 3MO0A 3OL3A 5KJNA 3VYUB 4CCKA 5FROA 3OYNA 5AYFA 4ZYAA 1O9SA 1EA3A 4CH7A 3OOIA 1MMGA 3HPHA 4MI5A 2LH9A 1BR4A 3OOUA 3VWBA 1X1DA 3EUKL 2CV2A 1J09A 3OYIA 3PSIA 4IQJA 5TH7A 1GLNA 2JV0A 2W5ZA 1DGRM 3E0JB 1WJFA 3TL4X 2BQZA 4IJ8A 3FPDA 4DIQA 2X1DA 4KISA 4PJJA 4PJMA 5JINA 2IS4A 4IKFA 3H5NA 4AYBA 5CCMA 3H9QA 4NC7A 4DGWB 3OYGA 3ZRGA 2HQAA 5CQEA 2CFOA 4DBQA 2A5WA 3RCOA 3OIPA 5JHFA 2QKLB 1HA8A 3MD2A 1N77A 1Y56A 5ARFA 3W3CA 4KITB 3VV0A 3AKZA 3LL7A 4YNDA 3L2QA 5HNFA 3VYRB 4CCMA 2Z2SB 4R79A 3S7JA 1X1CA 2ZXIA 1D0ZA 3H5RA 3M53A 2LYCA 3OXLA 3IAS2 4HNUA 2IGOA 4E47A 1QHGA 1QHHD 3K70D 3NWTA 2X6WA 4XKWA 4XN0A 2M0MA 3DTKA 2HNHA 5LFAA 3QYBA 1D1AA 3BCBA 1T95A 5T5GA 4YNPA 4I51A 4YEJA 3OYDA 3LSGA 4CA0A 2LG4A 2X1CA 4LITA 1VZ0A 4BUPA 3I9V2 4IX7A 4HSRA 3IAM2 4E7LA 1N6AA 2CH0A 3S7DA 3IHXA 4CCJA 3L2VA 3IUOA 5JJ0A 3CBOA 1YX5A 3D5LA 2WY7Q 3H35A 3L2UA 5FRNA 3DKYA 1NG7A 2M4GA 4C2TA 2GOMA 4NVQA 3M56A 3MKWB 4RM2A 2BW3B 1NG6A 1ERDA 3CJQB 3OMYA 3EPZA 5JHNA 4JQFA 3HL2A 4BDYA 2NOJB 2HU9A 4BE2A 2JVHA 2LRDA 3OYBA 4J7FA 4QEOA 3DTIA 3S7FA 1UG0A 3CZ6A 2M4KA 4XQFA 2L5QA 1T0FC 2WA0A 4XLFA 3LSMA 1MNEA 2Y0SA 4XM3A 3RSNA 4IJDA 1MMAA 4IQ4A 3U21A 4U7BA 4XNFA 1G8XA 2V4JC 3MEKA 4PSXA 2IS2A 4G6TB 3PJRA 4DJAA 3EUHC 3ZXSA 5LD2C 3OYAA 3K70C 1X4PA 2MFZA 4JLGA 2HPIA 2ZSIB 4BE1A 2KZVA 3VUZA 3PSFA 3CMMA 2Z1DA 2KLOA 3M1CA 1MNDA 3LSKA 4JOMA 1MVHA 2KHMA 4XN3A 3OYJA 2E1MC 2JA2A 1W36D 1FMVA 4NQWB 5ARGA 3M54A 3SYTA 4BQOA 2F5VA 3DWLE 3OYKA 4WUYA 3FDYA 5HI7A 1V5GA 4F52A 3F9WA 4E7ZA 3QOEA 1V5EA 1Z21A 1D1CA 2W5YA 3M57A 3KEYA 2VQLA 4PFPA 2LC2A 2OUMA 3ONQA 2F6CA 1Z3YA 4HSTA 1SAUA 3SEZA 2M3AA 3VYSB 5T0KA 4C30A 1E0EA 2O5RA 3KMAA 3IP4B 3OS5A 4LIUA 3K4BA 3OXGA 3DALA 4MI0A 4BEHB 4NUBA 3CP8A 2PJRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S7J A;  3M53 A;  3OXL A;  2R3A A;  4LDG A;  2O8J A;  4E47 A;  1N3J A;  3PDN A;  3OXF A;  3OPE A;  4H12 A;  4J7I A;  3M58 A;  3QWV A;  5HQ8 A;  2QPW A;  4J83 A;  5T5G A;  4YNP A;  4I51 A;  1ML9 A;  4O30 A;  3SW9 A;  2RFI A;  3TG4 A;  5LSZ A;  4BUP A;  3MO5 A;  3M5A A;  4AU7 A;  4RZ0 A;  3F9X A;  1N6A A;  5F6L A;  3S7D A;  2F69 A;  3IHX A;  3KMJ A;  5JJ0 A;  3CBO A;  4FMU A;  3QWP A;  1XQH A;  5KJK A;  2G46 A;  4O6F A;  5F5E A;  4J8O A;  4YPE A;  4YPU A;  4NVQ A;  3M56 A;  1PEG A;  4C1Q A;  1ZKK A;  1N6C A;  3K5K A;  5CPR B;  5KJL A;  4JDS A;  5EG2 A;  3M59 A;  3N71 A;  4J7F A;  4QEO A;  1MT6 A;  3S7F A;  5KJM A;  3RQ4 A;  4NJ5 A;  5F6K C;  3F9Y A;  4IJD A;  4Z4P A;  5JIY A;  1MVX A;  1MUF A;  5T0M A;  3MEK A;  3RU0 A;  3M55 A;  3CBM A;  3F9Z A;  3SWC A;  3BO5 A;  3RAY A;  5F59 A;  3MO0 A;  5EX0 A;  5TEG A;  3DB5 A;  3S7B A;  4QEN A;  5KJN A;  3S8P A;  1H3I A;  4JLG A;  5AYF A;  1O9S A;  3OOI A;  4YNM A;  3VUZ A;  3MO2 A;  4MI5 A;  1MVH A;  5EX3 A;  3CBP A;  3TG5 A;  5JHN A;  5ARG A;  3EP0 A;  3M54 A;  5TH7 A;  4YPA A;  2JV0 A;  2W5Z A;  4WUY A;  5LSX A;  5HI7 A;  2BQZ A;  3F9W A;  3FPD A;  4IJ8 A;  4QEP A;  5JIN A;  2IGQ A;  5CCM A;  2W5Y A;  3M57 A;  5CCL A;  3KMT A;  3QWW A;  3RJW A;  5TTF A;  5ARF A;  5T0K A;  3KMA A;  3VV0 A;  3OS5 A;  4YND A;  3HNA A;  3OXG A;  3DAL A;  4MI0 A;  3RIB A; 
#chains in the Genus database with same CATH topology
 2V9P A;  4HEA 2;  3VDX A;  2KL4 A;  3TDZ C;  2R3A A;  1WJ5 A;  3ABK H;  3Q0W A;  2ZJQ F;  2HKX A;  4AID A;  2DXI A;  1YIO A;  3KZZ A;  4D7M A;  1NK3 P;  4A3B J;  4NC8 A;  2PJP A;  4EGZ A;  3A4C A;  4HNV A;  3RQI A;  3PO3 J;  1XCB A;  5KVR A;  2ZFU A;  2W00 A;  2Y9Y A;  4DW6 A;  3GZ6 A;  2DA3 A;  4DYC A;  3OY9 A;  4AU7 A;  4XIC A;  4KMU X;  2XGD A;  1LEA A;  5LRS A;  3QWL A;  1IRF A;  2O8X A;  3TO7 A;  1FTT A;  3V42 A;  1XTA A;  1W36 C;  1KU3 A;  1BR2 A;  5TJJ A;  4ZTF A;  2V1D A;  4Q48 A;  5IOZ A;  1QPI A;  1ZGW A;  4GDF A;  1FBS A;  3AG4 H;  1T0F A;  2ZSH B;  5DD4 A;  3JRE A;  3FKJ A;  1LB2 A;  2XSD C;  4A3F J;  2IS1 A;  4RM3 A;  1HC8 A;  2L9S A;  3BTJ A;  2CUE A;  1MT6 A;  2G9W A;  1JJ6 C;  3TMO A;  4EMS A;  4ZDO A;  4N4N B;  3CUQ B;  3M8J A;  3OS0 A;  1X3U A;  3ESW B;  4WX9 A;  2LSO A;  1TWH J;  3X2Q H;  3KP7 A;  2VL8 A;  2BBY A;  3M9A A;  2JZY A;  3MKY B;  2F5E A;  3HOT A;  3W2W A;  2HTS A;  2HFH A;  2L01 A;  2OA4 A;  3DTE A;  4G6Q A;  3RU0 A;  4IHW A;  4BKX A;  1U8R A;  4LLL A;  2E35 A;  2VC1 A;  4M3G A;  1KON A;  4TV7 A;  5L3G A;  3I59 A;  4BHC A;  5H6Q A;  3JRA A;  1LE8 B;  1R6R A;  1WWX A;  1QVU A;  3V8K A;  3S7B A;  1SEU A;  2HQN A;  1XSD A;  1G59 A;  2NVY J;  4GCV A;  1UHS A;  3PQJ A;  2MW8 A;  2Q1Z B;  3MWM A;  1QO0 D;  4BJ5 C;  4AVP A;  3RZO J;  2H6C A;  2M87 A;  2F4O B;  4HQM A;  5HLG A;  1VQP I;  3CBP A;  1Z0X A;  1LVA A;  4M9Z A;  1B9N A;  5E8I A;  3HOS A;  1IC8 A;  3IH4 A;  4XLC A;  3WHB A;  5EEA A;  2VJI A;  4MFD A;  2ID3 A;  5CQG A;  2R3S A;  4KIG A;  3CCS I;  3SZT A;  2M7A A;  4DNC A;  3MEX A;  2CS3 A;  1PP8 F;  3M4O J;  1V4R A;  1FOK A;  1HKQ A;  1IO2 A;  1WSU A;  2R92 J;  2ZXW H;  3QYE A;  1VQ4 I;  4M3D A;  2PMH A;  1FPQ A;  4CYC A;  5CCL A;  3GW2 A;  2A5Y B;  5IP7 J;  4FHT A;  1TTY A;  2BW3 A;  3ZMZ A;  1HOM A;  1EF4 A;  3RTR A;  4B47 A;  4A5M A;  4XLP F;  2KIF A;  2WAD A;  2IGK A;  4XLA A;  4E4H A;  4EAT A;  3HNA A;  4HPQ A;  1A6I A;  4LLG F;  1DU0 A;  3QPL A;  3WU1 B;  1D0Y A;  2OF7 A;  2VKE A;  3B02 A;  2BVM A;  5EYR A;  4KT6 A;  1NH3 A;  2K9M A;  3IV5 A;  2QEX I;  3LMM A;  1FIA A;  1KU9 A;  1D5Y A;  1XDU A;  4M3B A;  2R7R A;  2RVC A;  1VQN I;  3HKZ A;  1TT5 B;  4Y33 A;  4ZYH A;  3MO5 A;  5CVI A;  2TRT A;  4RZ0 A;  2Z33 A;  3ECO A;  1JTX A;  5KHD A;  2OPT A;  4RGU A;  1CF7 B;  5JLX A;  3CLO A;  4EM0 B;  1YW8 A;  4QSH A;  3LSH A;  2JRT A;  2K7L A;  3DKX A;  3E97 A;  3ABU A;  2OV7 A;  3I5U A;  4BXX J;  1O3R A;  3C1D A;  2V6E A;  1Q1H A;  1WI9 A;  2DT6 A;  4M9X A;  5GAD J;  5GTH C;  3F72 A;  1R36 A;  5M5X J;  1FZP B;  1A35 A;  1IN4 A;  3SFZ A;  1Z05 A;  2MGQ A;  1MBF A;  3HOV J;  4MLO A;  1IV8 A;  2MH9 A;  1FYM A;  5AON A;  4ENN A;  1T33 A;  1IAW A;  2VON A;  1ZN2 A;  5B5E C;  1HXD A;  3FWE A;  4MFE A;  5F6F A;  2UWM A;  3FXR A;  5LRR A;  2M8G X;  1MUF A;  4UVC A;  2FRH A;  2VQH A;  5CVV A;  1RET A;  3J80 Z;  3CC4 I;  4EM1 A;  1JUM A;  1SAX A;  2Y75 A;  1X58 A;  2P5L C;  3RAY A;  4QEN A;  2DOE A;  3IRR A;  1LQ1 A;  2ADU A;  3CJT B;  1R00 A;  2VB6 A;  1T2K A;  3FBN B;  6PAX A;  2BHY A;  3NRV A;  3U1D A;  2HVS A;  1FOX A;  3RPU D;  5F1R A;  3ZQQ A;  4G94 A;  4M6Y A;  2A68 F;  4XOT A;  5DEQ A;  3KLN A;  2EZK A;  2L2O A;  2ZXH A;  2K9Q A;  2ZNY A;  2OBP A;  4L9V A;  4V2F A;  2IXS A;  3DU6 A;  1W7P D;  2EPF A;  1AU7 A;  3O6B B;  3OYM A;  2XF6 A;  5CJ9 A;  1ON2 A;  4WK8 F;  2JSP A;  2EBI A;  5J40 A;  5DUI A;  2FD5 A;  4A5N A;  2XAQ A;  2UV1 A;  1YG2 A;  2IW5 A;  1MJA A;  1V5F A;  3PNY A;  1QU3 A;  4X6A J;  3IKV A;  4LIV A;  1ZAO A;  5F27 A;  3I3L A;  1D1B A;  3RYR A;  3VFZ A;  3BTC A;  1G3W A;  3CUQ A;  5H20 A;  1MMS A;  3L2R A;  2XPV A;  4CO8 A;  3GTK J;  4C3H J;  3OV8 A;  5E1X A;  2LY1 A;  1OMI A;  1P7I A;  1QRY A;  1KQ0 A;  1ZK8 A;  4BQA A;  2L7K A;  2Z3Y A;  1X3W B;  3ZQI A;  2L4M A;  3GZ5 A;  2BVL A;  2VQC A;  4J83 A;  3G73 A;  4HRI A;  3ZN0 A;  4O30 A;  4A69 C;  3OYH A;  1LE8 A;  2EQR A;  2CQQ A;  2Z9O A;  3D5S C;  3ERE D;  2ZKZ A;  2KRF A;  2VJ4 A;  4ITV A;  1RNL A;  1W5T A;  1REP C;  2ZXJ A;  2HYG D;  3M3Y J;  1W0T A;  1OIS A;  2BYV E;  2R93 J;  2R7W A;  4I02 A;  2RNJ A;  2DMQ A;  2IA0 A;  4OU0 A;  2HS5 A;  2CQX A;  5L3E A;  3CUQ C;  3H9J A;  1O57 A;  4RB1 A;  3BR1 A;  2FMY A;  4XBF A;  2IT0 A;  4JDS A;  1R1T A;  1N78 A;  2VIX A;  3C2G A;  1RC9 A;  1HDD C;  1U5T B;  1TC3 C;  1S7E A;  1EV7 A;  2MBF A;  3PNV A;  4MNU A;  2HDW A;  3RQ4 A;  5KJM A;  3K10 A;  3H36 A;  5K7H A;  3HBL A;  1X19 A;  4HV6 A;  1X1P A;  3K2A A;  2X6O A;  4YEL A;  1O3Q A;  3I71 A;  1ONV A;  2GZW A;  1MVX A;  3I4M J;  2DJI A;  2JSC A;  1S8N A;  4QLC U;  4JX5 A;  3OS1 A;  3BO5 A;  1H9G A;  3DFG A;  4HF1 A;  2W25 A;  4G12 A;  4I76 A;  3GLL A;  2LF7 A;  2TCT A;  4KMF A;  1OCZ H;  3CO7 C;  1VQO I;  2HEO A;  3OYN A;  5AYF A;  1O9S A;  3B6A A;  1GVD A;  2L7F P;  3IRQ A;  5H6R A;  2LH9 A;  4BY7 J;  3C3W A;  4LB6 B;  1HW1 A;  2DA6 A;  5TIS C;  1WH5 A;  1X1D A;  4EV0 A;  2CV2 A;  4KIC A;  1MJ9 A;  2GLO A;  1J09 A;  2PX9 A;  2JA5 J;  2NXN B;  4IQJ A;  5M3F J;  1GLN A;  1G3T A;  4I99 C;  3WTZ A;  1CF7 A;  3IC7 A;  2R5Z B;  3FPD A;  1FT9 A;  1TW2 A;  3R4K A;  2D45 A;  2Q0O A;  2HYJ A;  4DIQ A;  3F23 A;  4IKF A;  3IH2 A;  1R58 A;  4DGW B;  5M5W J;  2HQA A;  3HRM A;  5FFX A;  1YHQ I;  3ZPL A;  1SMY F;  2TDX A;  2Y2Z A;  1Z6R A;  3KYD B;  3OIP A;  5EZH A;  5JHF A;  5M5Y J;  2QKL B;  3HIF A;  2DA5 A;  3VV0 A;  3LL7 A;  4L0Z B;  3S2D J;  3VYR B;  4R79 A;  2Y48 A;  1X1C A;  3M53 A;  2LYC A;  3WGG A;  2BY3 A;  3IAS 2;  2QQ9 A;  2ZB9 A;  4G7Z F;  2ESN A;  4CIC A;  1QHH D;  3K70 D;  1HCR A;  3BG3 A;  3NWT A;  1VQL I;  2VBZ A;  4XN0 A;  1RKT A;  3DTK A;  3KPH A;  2ZFW A;  4YEJ A;  2XPU A;  1FOW A;  1IUY A;  3WTV C;  1OCR H;  4LIT A;  2F5D A;  4BUP A;  2HGC A;  3O8G A;  3EYI A;  4LG0 B;  2OCE A;  4Q5S F;  3S2W A;  1N6A A;  5IY5 H;  3ERM A;  3LAJ A;  5D5W B;  1ZAR A;  2LMD A;  3H3Z A;  4B3A A;  2XVC A;  5JJ0 A;  3L2U A;  5FRN A;  1XX5 A;  2R7F A;  4L18 B;  2ESH A;  2M4G A;  4C2T A;  1DU6 A;  4NVQ A;  3M56 A;  1P2F A;  1B1B A;  4MQ9 F;  1OCT C;  4Y15 A;  5CVU A;  4EJV A;  2NOJ B;  3OYB A;  4J7F A;  4QEO A;  3KEO A;  2LR8 A;  3S7F A;  1SFX A;  5FB2 A;  2DDA A;  2VKV A;  1RKW A;  3HRT A;  2Y0S A;  3D0S A;  3TDU C;  2OJE D;  4IQ4 A;  3HHH A;  4UV8 A;  2AXL A;  2KFD A;  3KP5 A;  4XNF A;  3CMY A;  2XRO A;  3FF5 A;  1K61 A;  2LKP A;  4ZZD A;  1WVR A;  2XAH A;  2IPQ X;  3BRO A;  3ZXS A;  3OYA A;  1BI2 A;  3WU0 A;  2ZSI B;  4BE1 A;  5IYD J;  3FMR A;  1ETO A;  3CMM A;  2FQ3 A;  3ZQH A;  2Z1D A;  3JSO A;  3L9F A;  4A3E J;  3Q5F A;  5EJC A;  5FLX Z;  3GTJ J;  2O61 A;  1TLH B;  3M7G A;  2JA2 A;  4KUM A;  5ARG A;  4HW0 A;  1IW7 F;  3WTX C;  2K27 A;  2OCC H;  2A3S A;  2QSF X;  3ELK A;  4WUY A;  4EQQ A;  1V5G A;  3HRS A;  4JX4 A;  4F52 A;  4IRG A;  4OMY A;  5E8G A;  3I54 A;  5LEJ A;  2DTZ A;  5J47 A;  1I6X A;  3CMA I;  1VTN C;  3M57 A;  3KEY A;  3K9T A;  2E7W A;  1GXP A;  1LEB A;  4PFP A;  1FNN A;  2PLY A;  1Z3Y A;  3ZP5 A;  1B72 B;  4HST A;  2VI6 A;  2JWT A;  1JGS A;  1E0E A;  1LDJ A;  2Y69 H;  4XRS G;  3DAL A;  1U5T A;  1ENH A;  2GBY A;  4BEH B;  3CP8 A;  2HZT A;  2PJR B;  1F43 A;  1SVM A;  3CJN A;  2HPM A;  4JX6 A;  4C3I J;  5AIQ A;  4PUS A;  3VYT B;  2E71 A;  3VEP A;  2CGP A;  2EV0 A;  1IUF A;  3PUB A;  4XLE A;  5F04 A;  1N3J A;  2V1N A;  2CG4 A;  2M2E A;  1Y39 A;  5HS8 A;  1OKR A;  3PDN A;  4J7I A;  4N9I A;  3M58 A;  2Q2E B;  1WGX A;  1PVE A;  1RPW A;  1XG1 A;  2P6S A;  3R0J A;  4LJZ F;  1U78 A;  1S29 A;  1KU7 A;  3AG2 H;  3G3Z A;  1ML9 A;  1I3Q J;  1YYV A;  3SDG A;  2CW7 A;  4IEJ A;  1P6R A;  2JPB A;  3DQV C;  1V3F A;  4PGH A;  5D5V B;  1FJL A;  2DYS H;  4UVA A;  1VQ8 I;  5F6L A;  2F69 A;  4PK4 A;  4ZYD A;  2BY0 A;  2LF8 A;  5KCM A;  3QWP A;  1XQH A;  2M30 A;  3OYE A;  2H94 A;  4O6F A;  3V8J A;  3KP4 A;  4UUS B;  4YPU A;  2PMZ A;  4RAF A;  3KYL A;  2R5Z A;  1PEG A;  1I39 A;  2W82 A;  5J4V A;  5KJL A;  2ETH A;  2EZL A;  3KCC A;  2DA7 A;  2P4W A;  5F08 A;  2ECB A;  1HSJ A;  2QQA A;  4CHU A;  3H1C A;  4RAY A;  5JR3 A;  2I8D A;  2OD5 A;  2L9N A;  2XDV A;  4GYI A;  4IHT A;  2J5P A;  4GXO A;  2HYF A;  4OIO F;  2E2J J;  3W2A A;  4Z4P A;  4F91 B;  3GF2 A;  2RQP A;  4HX7 A;  3QOD A;  4HDU A;  1VQ9 I;  1NK2 P;  2O9L A;  2UXX A;  4EGY A;  1LFP A;  1WJA A;  1TL8 A;  3QPT A;  2KIQ A;  2F5F A;  4MGR A;  4OWR B;  3DB5 A;  2VOO A;  5TEG A;  1HW2 A;  1OCC H;  1ZKG A;  3MFK A;  1QQI A;  3H3U A;  2XRN A;  2WV0 A;  1S7A A;  2NS0 A;  2FNP A;  3JCU C;  2LLK A;  4JYK A;  4WXC A;  3S16 J;  4LG0 A;  2XKO A;  2GXA A;  3EP0 A;  1R7J A;  4M6X A;  5FGM A;  1AHD P;  4II3 A;  1U9N A;  4OOI A;  1BOB A;  4A3D J;  3VSK A;  3DCF A;  2R4G A;  2LBF B;  5GTI C;  2ZJR F;  2NNN A;  3HTU A;  1DDN A;  2AQF A;  5E18 F;  1PUF B;  2CUZ A;  4I2O A;  2X85 A;  4XKB A;  3JR9 A;  1IGN A;  2JUC A;  2W48 A;  4KN7 X;  3D5R C;  4FE4 A;  4IHY A;  1KYZ A;  2J5O A;  2X48 A;  4HOB A;  2XKP A;  5JVG F;  4FAS D;  2LY2 A;  5ED4 A;  2DN0 A;  4ZYE A;  2M5W A;  3AG1 H;  2DT5 A;  2WB1 N;  2WAQ A;  2M45 A;  1Y6I A;  4CYD A;  2R7T A;  2XUB A;  2DA1 A;  2L7M P;  2MYS A;  5J8F A;  3V7S A;  4BBS J;  3Q0U A;  2DOA A;  1OCO H;  3FK6 A;  1H89 C;  2EV5 A;  2A69 F;  3P9K A;  1R22 A;  5AIP A;  1JTY A;  3HPG A;  2ZO4 A;  3BPV A;  4OMZ A;  4DOZ A;  1D5V A;  3BY6 A;  1MDM B;  1ZR2 A;  1GDT A;  2K3P A;  1ETV A;  3CJR B;  1B9M A;  4A2U A;  3CCE I;  4EJW A;  1F9N A;  1FIP A;  3C2B A;  4IJA A;  5EG0 B;  2WWY A;  5CVR A;  2D2W A;  3OR2 C;  1A04 A;  1JKP C;  3G4S I;  1MJB A;  1DPR A;  1MH3 A;  3G1L A;  3FIW A;  3FXM A;  5JHU A;  5GAE J;  1T38 A;  1OR7 C;  4ZDP A;  2E2H J;  2R7X A;  1MBG A;  1MMD A;  4HNT A;  1Z1D A;  1HKS A;  1VQM I;  5EG2 A;  4ESB A;  3BJA A;  4IO9 F;  2YU9 J;  2QVO A;  3AL0 C;  3N71 A;  3S93 A;  2GM4 A;  3RIR A;  2MC4 A;  2KP6 A;  3BZ6 A;  5FO5 A;  4XSZ F;  2V79 A;  1E2X A;  2HVQ A;  5FD5 A;  5DM7 F;  1B72 A;  3FIS A;  1WJE A;  3Q0V A;  3HDD A;  4MQV A;  2LVS A;  4O5V A;  3ZMV A;  1BOA A;  2BV6 A;  1M1E B;  4AD9 A;  2W85 A;  4XMY A;  3K4M A;  3MMY B;  1JE8 A;  1AWC A;  4XLH A;  4BEH A;  3OR1 C;  1IF1 A;  2PJR A;  3M55 A;  4F55 A;  3ECH A;  1UMQ A;  1W5S A;  3HG9 A;  4OAZ A;  3E1S A;  1I3A A;  4HBL A;  3JRH A;  1CGP A;  1GUU A;  3RI4 A;  4NC6 A;  2L9V A;  2HTJ A;  1ACI A;  1H3I A;  2DU9 A;  4FT8 A;  1XMK A;  4JK1 X;  1G4D A;  2QGU A;  4RLF A;  1HQC A;  2Q2E A;  3HB9 A;  3OSG A;  2VN2 A;  1MBH A;  4A3G J;  2KQR A;  3CQZ J;  3GTO J;  1OLT A;  5JHN A;  1AA7 A;  3TG5 A;  1ULY A;  3CC2 I;  2BY2 A;  3K6G A;  2AXT C;  4BU2 A;  4HQE A;  4A3L J;  2RGV A;  2L4A A;  3ZGK A;  2KJC A;  1QZZ A;  1F4K A;  5LSX A;  2VJ5 A;  5D6F A;  3F6V A;  4FE7 A;  4U0W A;  4RGX A;  5ICC A;  3MKZ A;  3JTH A;  4UUS A;  2JQ7 A;  2WV1 A;  3BR5 A;  3BC8 A;  5B1B H;  3D1N I;  1H9T A;  1Z3X A;  3BR6 A;  4A3C J;  3UR3 C;  3HGY A;  1VI0 A;  2V26 A;  5KK1 A;  4U7D A;  3JRD A;  4IXA A;  1T39 A;  4BH9 A;  3GEZ A;  1H8A C;  1R4M B;  4EEF G;  2KDO A;  3IKT A;  1Z67 A;  4ZTJ A;  4E7I A;  3RIB A;  1IXS B;  3DXJ F;  3GUD A;  4FET A;  5E17 F;  4EJT A;  3VPR A;  4GRI A;  2VOD A;  3PM1 A;  1Y8Q B;  2H8W A;  2F2E A;  2LRE A;  2V1U A;  1GVJ A;  4HX4 A;  4I09 A;  2VXZ A;  3OPE A;  2AO9 A;  2ZCW A;  4XKC A;  5E1Z B;  3LOC A;  2ELJ A;  1FBU A;  1K4S A;  3FK7 A;  5HS9 A;  3V8L A;  1T98 A;  2MSY A;  2V7F A;  2QWW A;  3HRU A;  1JT0 A;  2CV0 A;  2E60 A;  3CCL I;  1QZY A;  1W4M A;  2AQE A;  4IF4 A;  5F0F A;  2KMU A;  3JAM Z;  2FEZ A;  1SFU A;  2R7Z J;  2M9H A;  4QIW N;  3J81 K;  2B0L A;  1D8K A;  3PL8 A;  4B3X A;  4IZZ A;  2EIL H;  1TQM A;  2OQR A;  2JUG A;  5H2F C;  2OTL I;  5A2Q K;  2OTJ I;  1E3P A;  4M3F A;  1TP4 A;  4YFX F;  4YPE A;  1YJN I;  5DDG A;  4MEX F;  4FTH A;  1SVL A;  2MD0 A;  2XF5 A;  3F0C A;  2LBF A;  1JJ8 C;  3KZY A;  1XGO A;  1P92 A;  2PFB A;  3K69 A;  4M9S A;  3M8E A;  5ERI A;  1PUF A;  1GT0 C;  1USS A;  2BE5 F;  1D0X A;  3S1R J;  3A1Y A;  1BI1 A;  5BPI A;  3AFH A;  4OIR F;  2R0Q C;  3ZQ7 A;  1R49 A;  5E1W A;  2H27 A;  3HOZ J;  1VQ5 I;  4BE0 A;  3PQK A;  3DBR B;  4RB3 C;  2DMU A;  5F6K C;  2IGM A;  3L1P A;  1OJL A;  3BQY A;  4FX0 A;  1TZL A;  1OYY A;  4XOP A;  4ASN A;  1NTC A;  2IEK A;  3F9Z A;  4E7K A;  1K7A A;  1BW5 A;  3FXO A;  2EIM H;  1YS7 A;  2EB7 A;  1ETY A;  3MO0 A;  3HSE A;  1QA6 A;  2A05 A;  5FRO A;  2E19 A;  2ELH A;  4ZYA A;  1EA3 A;  4CH7 A;  4LB5 A;  3OOI A;  4HYE A;  1TW3 A;  3CC7 I;  4L0Y B;  1ZG5 A;  3HPH A;  2E1N A;  2DMP A;  1DP7 P;  2JMW A;  3OOU A;  1OPC A;  1MDM A;  3EUK L;  4G8X A;  2VUM J;  1FP1 D;  1SFE A;  3PSI A;  2DQR A;  1LDD A;  1WI3 A;  3K0L A;  4WCG A;  1DUX C;  1WJF A;  4A6D A;  5EG0 A;  4IJ8 A;  3J7Z I;  3REO A;  5FLV A;  1XPX A;  2X1D A;  3WTT C;  4KIS A;  3KYC B;  1D8J A;  5JIN A;  2IS4 A;  5CCM A;  4AYB A;  1ETK A;  1O3S A;  3EQL F;  1MNM C;  1FLI A;  3RCO A;  1OYI A;  2K9N A;  4YFK F;  1N77 A;  3HSR A;  2DBB A;  2A61 A;  3W3C A;  3DP7 A;  2O03 A;  2DW4 A;  2JK3 A;  3KLO A;  4I98 B;  4QTR A;  5DV5 A;  4NB5 A;  3TW6 A;  5HNF A;  3SZP A;  1R71 A;  2ECC A;  1T56 A;  3OXL A;  3CLQ A;  1U8B A;  3I4N J;  4HNU A;  1WPK A;  3U9G A;  3V7R A;  2V6C A;  3V7C A;  2M0M A;  5LFA A;  3BCB A;  5T5G A;  4YNP A;  4I51 A;  5B66 C;  2G7U A;  3BTI A;  1Z7U A;  3TOA A;  1BW6 A;  1G3S A;  1LNW A;  1ZYR F;  3IAM 2;  2JJ7 A;  3HOU J;  2QZ8 A;  3IHX A;  4CCJ A;  3SQN A;  1E17 A;  5ILV A;  3EUH A;  2P7V B;  1G2H A;  2L54 A;  2HQ5 A;  2NOG A;  2L02 A;  4ESF A;  1K79 A;  4UUV A;  3QP6 A;  2STT A;  5IT9 Z;  2VT2 A;  4IRH A;  1I50 J;  2IA2 A;  2QEN A;  1XGS A;  4PGG A;  4RM2 A;  2K86 A;  1NG6 A;  2QA4 I;  3G1O A;  4IOA F;  1VND A;  3FMS A;  2DJN A;  4JQF A;  4KYW A;  2YR2 A;  5CVJ A;  2JVH A;  2A6E F;  3I58 A;  5IP6 A;  1AKH B;  3C7J A;  3CZ6 A;  5DCM B;  2M4K A;  4ESJ A;  3KET A;  2W84 A;  2WA0 A;  1XMX A;  4ENJ A;  1EJ9 A;  4A3J J;  2GA1 A;  4XM3 A;  1J75 A;  2FU4 A;  3RSN A;  4IJD A;  3S14 J;  2CWE A;  3ABL H;  4R8H A;  3U21 A;  3COA C;  5D5U B;  4NHJ A;  1XDS A;  3BR0 A;  1FBQ A;  4OIQ F;  2H09 A;  5B1A H;  2FOW A;  5K5O A;  3CUO A;  3EUH C;  1CQT A;  5LD2 C;  4LOC A;  3K70 C;  1ETW A;  1X4P A;  1Y1V J;  2Z5U A;  4IHX A;  1VQK I;  2MFZ A;  4G9Y A;  1TQP A;  2CRG A;  2HPI A;  2UXN A;  2OZ6 A;  5M3M J;  2JRM A;  2KZV A;  3VUZ A;  1YFH A;  4GGG A;  1MND A;  3LSK A;  4LLN A;  5F0C A;  3OYJ A;  3SJM A;  1XSX A;  3FHZ A;  2NS7 A;  2IBD A;  4RA2 A;  1BC8 C;  4BQO A;  3OYK A;  3IL2 A;  1H0M A;  3WE3 A;  1R23 A;  2L3D A;  4CGZ A;  2JA7 J;  2K4B A;  2AHQ A;  3ASN H;  4GYG A;  3P7N A;  1IXC A;  2B9S A;  3MVP A;  2VQL A;  3LFK A;  3TW7 A;  2OUM A;  3ONQ A;  3LNQ A;  2F6C A;  2XHK A;  1U6G A;  1SAU A;  2CUF A;  3SEZ A;  1T8I A;  3E5U A;  2P7C B;  4IPA A;  1MIJ A;  3K4B A;  3S2H J;  4MI0 A;  4NUB A;  3J7A O;  3ZN1 A;  2ZJ2 A;  3A01 B;  3QPH A;  2RN7 A;  3M1E A;  5GPA A;  2ID6 A;  2ZME B;  3LAP A;  3CES A;  4O6J A;  2LFB A;  3ZMS A;  4ENK A;  2CV1 A;  4XR6 A;  3G2B A;  3WG9 A;  4F3Q A;  2P0W A;  2R7S A;  2QF7 A;  5CKT A;  2X0L A;  2Y9Z A;  1P7J A;  2CMP A;  4F7Z A;  3TP0 A;  4HDV A;  1BJA A;  4BQQ A;  1W0U A;  2H1L A;  3CCM I;  3GVA A;  3M5A A;  2RNG A;  3G6E I;  1BL0 A;  3NWS A;  3PIP F;  1MKM A;  3QRF F;  1BBY A;  1OYW A;  1IN8 A;  2HQR A;  4QWQ A;  4ZDL A;  5GAH J;  4J00 A;  1R9T J;  1I5Z A;  3KMJ A;  2BHZ A;  1QZE A;  3PFY A;  2RAE A;  3HKZ N;  3PO2 J;  4AIK A;  2RDP A;  1WCM J;  2CQN A;  2RC4 A;  1IG7 A;  2FSW A;  3ML6 A;  5B3S H;  3NEU A;  1JI8 A;  2DO7 A;  4BS9 A;  1BI3 A;  2DFH A;  2ME0 A;  5L3F A;  3OS2 A;  3MKL A;  4I01 A;  1ZG1 A;  1N6C A;  4R1H A;  4G6D A;  3MZY A;  4ZC3 A;  4B48 A;  3Q9S A;  4P5O A;  2MG4 A;  1STZ A;  5C44 J;  3CCJ I;  3AG3 H;  1KZH A;  5FKK A;  1FMW A;  3BG5 A;  3E7L A;  2HVR A;  2LTP A;  2KKO A;  3DKW A;  5C3E J;  1QVT A;  1LFB A;  5EEH A;  2VAS A;  1K4T A;  4PJL A;  4P9U A;  2V1X A;  2QLZ A;  4PFO A;  4J01 A;  3IWZ A;  2F4M B;  2GXG A;  3QYF A;  3DPT A;  3TBI A;  3K4L A;  4BYY A;  2W1O A;  1JUS A;  1RUO A;  2YPR A;  3GO5 A;  5FKO A;  3MO2 A;  3OWT A;  2K9L A;  2XAU A;  1NHA A;  1BR1 A;  4P55 A;  2CW0 F;  1S7O A;  4B4C A;  1TNT A;  1MBK A;  2EA4 A;  5EX3 A;  3LQR A;  1Z77 A;  4F93 B;  5J3L A;  3DLL F;  2QUF A;  3HOX J;  3LA2 A;  2BEO A;  3AL0 B;  4A12 A;  3KP6 A;  1JKQ C;  3TO9 A;  3TOB A;  4RGR A;  3BR2 A;  2Y31 A;  3F22 A;  1VQ6 I;  3CCV I;  2P5V A;  4M72 A;  2R7O A;  1SFK A;  3IHU A;  4A6E A;  3KMT A;  1ETX A;  1PJR A;  1APL C;  4IHS A;  1E3O C;  3WOD F;  1DP3 A;  5ILS A;  4Y7N J;  2ISY A;  4H4K C;  2DQL A;  5TRD A;  3RKQ A;  1AKH A;  1FWZ A;  3F9K A;  5DCM A;  2GWR A;  2MA3 A;  2Z99 A;  3ASO H;  4MEY F;  1RIO H;  2HOT A;  4YRV A;  4U88 A;  1F1Z A;  4L9T A;  4N0B A;  4W1U A;  4AUX A;  4YG2 F;  3FXU A;  5FKM A;  4D1Q A;  4A3K J;  5HNH A;  1YIJ I;  2N8G A;  2VKD A;  5L3D A;  2DYR H;  3GFJ A;  3DEW A;  4PZJ A;  3GME A;  1Y1W J;  1FEX A;  5J1R A;  5E3M A;  4CCL A;  1FTZ A;  2RFI A;  3SW9 A;  1J59 A;  3BLY A;  3MQ0 A;  1VQ7 I;  3TG4 A;  5L3B A;  1XD7 A;  4XID A;  2D1V A;  2A6T A;  4I6Z A;  2NYX A;  3F9X A;  3P9I A;  5HLI A;  4KN4 X;  4A3I J;  3BOQ A;  4PCQ A;  4YII A;  4BHP A;  4DYR A;  2Q8K A;  5KJK A;  2G46 A;  2QQ8 A;  2R5Y B;  3GBG A;  5F5E A;  2V9K A;  4S0H B;  3LWF A;  5K5R A;  4W97 A;  4EM2 A;  3CD6 I;  5J8C A;  3K5K A;  4DYQ A;  1WFX A;  4JBA A;  1O7F A;  4UVB A;  3A02 A;  4C9Y A;  1S6L A;  1X1B A;  3OIO A;  1PYV A;  1QGP A;  4KIF A;  4Y4R A;  3F21 A;  3J80 K;  3GZN B;  3HC7 A;  3J7Y J;  5LHI A;  5TGT A;  2WAF A;  3OYF A;  1XGN A;  1IN6 A;  1R1V A;  4BNC A;  1RRJ A;  4G7H F;  2F5C A;  3GTP J;  5ICG A;  4BL0 B;  4M71 A;  3ZMD A;  2VKH A;  2KJB A;  3A01 A;  3ABT A;  1U0J A;  1Y8R B;  1YS6 A;  2ZME A;  3AAF A;  3K4C A;  4UNO A;  3HOW J;  1IRZ A;  4MTD A;  4BGD A;  5HOO A;  1TT0 A;  1HF0 A;  3S1M J;  1TBX A;  5HDK A;  1S72 I;  2KT0 A;  2CW8 A;  2KZG A;  4Z2Y A;  4ENM A;  3KEQ A;  4U87 A;  1C0W A;  3T0Y A;  3L2W A;  1ZGA A;  2E36 A;  1W7P B;  2FBK A;  4D9J A;  1ZQ3 P;  3EUA A;  3VSL A;  3BQZ A;  2BXZ A;  3DU5 A;  4OAY A;  1GXQ A;  2XSJ C;  2DPU A;  3ZCO A;  2E5Z A;  4QEP A;  3OYC A;  3O8H A;  2KRH A;  5LBQ A;  4BAC A;  5IPA A;  2YX7 A;  5HVQ C;  3WE2 A;  5HLT A;  1O3T A;  1IJW C;  5EDN A;  4NBQ A;  4WF2 A;  1SVO A;  2WBM A;  5J6X A;  2K02 A;  4ZJZ A;  3DPU A;  2O8K A;  1JHH A;  3K4J A;  5FFZ A;  4XK4 A;  5TTF A;  2ZME C;  5E3O A;  2RV8 A;  3JRC A;  2BXY A;  2JVG A;  3E5Q A;  3QOP A;  2B7E A;  3JTG A;  1UG2 A;  3F6O A;  3WU2 C;  5D4R A;  4BAY A;  4L5I A;  5GAG J;  1ZRE A;  2WTE A;  4LDG A;  2PQ8 A;  3GYH X;  3SXY A;  5DS9 A;  4S05 A;  1I27 A;  2CU7 A;  5DCF A;  3CDL A;  2NRA C;  2VXD A;  2QPW A;  1LVK A;  5LHG A;  4CZC A;  2E5N A;  4NNJ A;  3CTA A;  2H6B A;  1R5I D;  2W24 A;  3LA7 A;  4F92 B;  2MC3 A;  5J1Y A;  2ICW G;  2IAI A;  5FRM A;  1G3Y A;  2K3F A;  3GCM A;  3HEF A;  3QU3 A;  2DA4 A;  2HI3 A;  3I4P A;  2VLA A;  1OR7 A;  3ABM H;  4GO1 A;  2YS9 A;  4V2G A;  4BXF A;  2VOP A;  3JRB A;  2I10 A;  3TP3 A;  2CJJ A;  2XAG A;  4C1Q A;  3WGI A;  4A0Z A;  3FHN A;  3GFI A;  3DBL B;  4AC0 A;  3CCU I;  1LKX A;  4XRM A;  3OYL A;  3HUG B;  1FOY A;  3ZOB A;  2OAZ A;  1L3L A;  1K6O A;  2VQG A;  2KRC A;  2DK5 A;  3IWF A;  3LFU A;  4YFN F;  2BZT A;  1GV5 A;  2DK8 A;  3KP2 A;  2OZU A;  3WTU C;  5K7Z A;  1ORK A;  3I53 A;  2ISZ A;  2FA5 A;  3LST A;  5IT3 A;  2DT7 B;  2XV4 S;  1F36 A;  4G7O F;  3RKW A;  5LGT A;  2V9V A;  4RDU A;  3OSF A;  2P81 A;  4PJ0 C;  3UKG A;  3O3K A;  1YE9 A;  2HOS A;  2GAU A;  3RDI A;  2EFQ A;  4KIB A;  2Y0S N;  2LNB A;  3CDI A;  3HJE A;  4D5C A;  1FSH A;  5F59 A;  3BJ6 A;  1SD6 A;  3HGG A;  4N9H A;  3K1N A;  3L7W A;  1YRN B;  4Y52 J;  3P9C A;  1ZHF A;  2EZH A;  5C4J J;  3KZI C;  2GQQ A;  1BR4 A;  4MIM A;  2XGX A;  2XAS A;  1JKR C;  3VWB A;  5EGO B;  3JSP A;  4FIS A;  2NVT J;  2VBW A;  5TH7 A;  2DAO A;  1ZH5 A;  3E0J B;  3TL4 X;  2MH2 A;  2VBX A;  4AIJ A;  1UHM A;  4IHV A;  4D0P A;  2JT1 A;  1SC7 A;  1SD4 A;  4LK0 F;  4NC7 A;  2DTR A;  4MTE A;  2VE9 A;  2R5Y A;  3FKI J;  3OYG A;  1Q1V A;  1O4X A;  2GIZ A;  5HDN A;  2DDB A;  5IP9 J;  1A31 A;  2XIG A;  3KE2 A;  2MLG A;  1VFC A;  2PN6 A;  3MD2 A;  3I0T A;  5FKL A;  1Y56 A;  3R6S A;  3I64 A;  5D8K B;  5ARF A;  2O6G E;  4OIP F;  4YND A;  1MBJ A;  4EJU A;  2Y0M A;  1YIT I;  3P5J A;  4CCM A;  2Z2S B;  2VPR A;  3S7J A;  2ZXI A;  2KIU A;  5E3L A;  2NNY A;  1U3E M;  3H5R A;  2WC2 A;  1XS9 A;  2XAJ A;  1BIA A;  3GTM J;  2B63 J;  2IGO A;  4L5J A;  4LMY A;  4E47 A;  4UB8 C;  1TWC J;  4J19 A;  4XKW A;  3NAR A;  2QBY B;  3MZ8 A;  1D3Y A;  2HNH A;  3QYB A;  5DYM A;  2XGC A;  5JLW A;  1UFM A;  3OYD A;  3CME I;  5D8L B;  1ZRD A;  1JUP A;  3H0G J;  2P6T A;  2X1C A;  3RPU A;  5D4S A;  2L0K A;  4B8X A;  2PEX A;  3PFI A;  3I9V 2;  4IX7 A;  2EJR A;  2K9S A;  4HSR A;  1BM9 A;  5JI6 A;  2P5K A;  1Y0N A;  4IVN A;  2O0Y A;  3L2V A;  3IUO A;  3CBO A;  1YX5 A;  3D5L A;  3QPS A;  3QQA A;  2CQK A;  2WY7 Q;  4M3E A;  1W7P A;  3DKY A;  3WGH A;  3LQQ A;  1RR8 C;  2GOM A;  3DBH B;  2LP0 A;  1FP2 A;  2ZC2 A;  1Z6T A;  2FF4 A;  3TGN A;  3V4G A;  2L7Z A;  4B1R A;  3FM5 A;  1FC3 A;  3RJP A;  2X4H A;  3CJQ B;  1W5C C;  3HL2 A;  2KIM A;  5F1J A;  1WKM A;  1R5H A;  2LRD A;  2PMZ N;  1UG0 A;  1UCR A;  5FKN A;  5J4Y A;  3E5X A;  1B6A A;  2XRL A;  1T0F C;  2E1C A;  2K85 A;  3LSM A;  4XLF A;  1MNE A;  4L9J A;  2O7O A;  4BY1 J;  3VB2 A;  1ZLK A;  4MO7 A;  1U9O A;  2LD5 A;  3MEK A;  1Z91 A;  2V4J C;  1WZ2 A;  4PSX A;  2IS2 A;  2EFW A;  1A36 A;  5GP9 A;  4B09 A;  3PJR A;  4DJA A;  5FLX K;  1ITY A;  2CSO A;  3EYY A;  4JLG A;  4M74 A;  4IRI A;  2PI0 A;  2EFP A;  2P8T A;  2KLO A;  3M1C A;  4JOM A;  1MVH A;  4CZZ A;  2KHM A;  4RAZ A;  4I7H A;  4XN3 A;  1W36 D;  4GFB A;  1FMV A;  3F8N A;  4NQW B;  3GTQ J;  3SYT A;  3K2Z A;  3DWL E;  3T1B A;  3B73 A;  4Q47 A;  5DM6 F;  3FDY A;  3FXJ A;  5E20 A;  3F8C A;  3FX3 A;  1SD7 A;  3QOE A;  3R60 A;  2ZNZ A;  1V5E A;  1Z21 A;  1D1C A;  5JFR A;  3F8F A;  1TWG J;  1RR7 A;  5EZG A;  3BJO A;  1ON1 A;  4WXD A;  3VOE A;  4JP0 A;  5ILU A;  3LSJ A;  2HKO A;  1KA8 A;  3A03 A;  3GXO A;  4C30 A;  2LKS A;  3CCR I;  1ODD A;  3HUG A;  2FNA A;  3N97 A;  1P4A A;  1OFC X;  3L09 A;  4LIU A;  3KMA A;  3CDH A;  3OXG A;  1PDN C;  2MD5 A;  1PUE E;  1XN7 A;  2QKM B;  2O8J A;  4LD5 A;  3W2V A;  2QM3 A;  1EH7 A;  3BZK A;  2DPD A;  1I1S A;  1QBJ A;  2IGN A;  1OQY A;  2YX4 A;  3TO6 A;  1F5T A;  3BDD A;  5LEK A;  3A2K A;  3W6J B;  2WAQ N;  3ULQ B;  1J0R A;  3T8T A;  3T5X A;  2G0E A;  3K1M A;  3HOY J;  3W6V A;  1WJC A;  5LSZ A;  3LSI A;  4UXN A;  1RES A;  3R0A A;  1BA5 A;  1WJB A;  4LFU A;  1YRN A;  2WY8 Q;  1MSE C;  3HM5 A;  2HXI A;  2COB A;  2CYY A;  3IH3 A;  4KT5 C;  5BS6 A;  3K4K A;  2DOD A;  5EGO A;  3GTL J;  2I5U A;  4NDL A;  1BN5 A;  4B43 A;  5L3C A;  1IXR C;  5LGN A;  2BY1 A;  2EH3 A;  4ETS A;  1V55 H;  4ZH4 F;  2W7N A;  1JGG A;  2L9R A;  3BG7 A;  3RPQ A;  2LOO A;  1LPQ A;  3K4N A;  4RS8 A;  1B4A A;  5E3N A;  3FZV A;  4XOR A;  4BQN A;  1X2N A;  2X1E A;  2K5C A;  3HZJ A;  1SFO J;  2FX0 A;  5J1U A;  3RKY A;  1VF9 A;  1B59 A;  2QCO A;  3HTS B;  2PMU A;  3ZQC A;  1R5G A;  3QAH A;  3L2C A;  2EK5 A;  2ACJ A;  5DUK A;  4L9N A;  5DD8 A;  3U2R A;  4BJ6 C;  3CBM A;  2C6Y A;  2EFN A;  3G1M A;  2KIS A;  4RAG A;  2M1B A;  4PDK A;  4XL9 A;  4Y3O A;  1IN7 A;  1TWA J;  5CYV A;  4E7S A;  1MH4 A;  5KNL A;  2QBY A;  2XPW A;  1WHU A;  4X0G A;  3FXK A;  4BBR J;  3EET A;  5BPD A;  3F3X A;  3DV8 A;  1X2M A;  3FM3 A;  3PNT A;  4XKV A;  3TKY A;  3BCA A;  1DQU A;  1I6H J;  1XB4 A;  2OC6 A;  3WTW C;  3GTG J;  3KP3 A;  1MMN A;  3S32 A;  2IJL A;  2W4S A;  3I55 I;  2E2I J;  3S15 J;  1N75 A;  1YO5 C;  3S3O A;  4CSW A;  3DPL C;  2FOK A;  3R61 A;  4ON0 A;  1IRX A;  1KGS A;  2RKH A;  4P96 A;  3H0D A;  1YOV B;  3NAU A;  1BI0 A;  2CQ7 A;  2FXA A;  5KAI C;  1L0O C;  2O3F A;  4KDP A;  1HW5 A;  1ZRF A;  2H8R A;  3QWW A;  4DBR A;  3MAJ A;  3S17 J;  1XSV A;  3SFI A;  1UJ8 A;  2ME6 A;  3Q3S A;  3BR3 A;  3SZG A;  4KA4 A;  3ZQF A;  2MLK A;  4UUT A;  2LK2 A;  1R1U A;  2STW A;  3KIO A;  3F8B A;  4II2 A;  5DTD A;  1DPU A;  1KQ8 A;  1LJ9 A;  4BXU A;  4M6V A;  3HHG A;  1ETQ A;  2NVX J;  1T08 B;  3PUF A;  2W57 A;  2HDD A;  2M7B A;  1WH7 A;  4B44 A;  4IOC F;  4KFC A;  5HQ8 A;  5HOD A;  2QYO A;  1IN5 A;  2RRE A;  1YX3 A;  1UST A;  4HA8 A;  4UY8 I;  1POG A;  2HZD A;  2FUG 2;  5K5Q A;  1TWF J;  2HWV A;  2D5V A;  2JPC A;  1S9H A;  2HXO A;  1OCP A;  5F0H A;  2VJJ A;  3S3M A;  3FBI B;  3LA3 A;  4LG3 A;  2EIK H;  1ZLJ A;  3WTY C;  5FLM J;  1YW9 A;  4NQW A;  3BPX A;  4J8O A;  4A3M J;  3KX2 A;  2DLL A;  2IS6 A;  4CCN A;  1Y0U A;  2DFF A;  3JRI A;  1ZKK A;  1A5J A;  4KJZ A;  4ZYG A;  1MZB A;  4D5F A;  3DEE A;  3ZR8 X;  4K2E A;  5ICE A;  2Z16 A;  3ZQL A;  5HS7 A;  2E1O A;  4E7J A;  4Y13 A;  3HXL A;  3S3N A;  1P9Q C;  1WRJ A;  4M73 A;  3ZMU A;  3K1P A;  5FD6 A;  1UAA A;  2E34 A;  2M34 A;  1HKT A;  3S1N J;  4NJ5 A;  2CO5 A;  4LK1 F;  3GFL A;  3W6K B;  2NAZ A;  4BJT A;  2MAB A;  4ZZL A;  1XCV A;  3CCQ I;  4E7H A;  2OU2 A;  3T8R A;  4DQ2 A;  4FCY A;  2H1K A;  2VPL A;  3WTS C;  2CFX A;  3N4M A;  1Z7L A;  3SWC A;  2FQ4 A;  1GHC A;  4IL6 C;  2EWN A;  1J7K A;  1EKE A;  5EX0 A;  3ZQG A;  1ZRC A;  2DOF A;  3C2H A;  3H9G A;  4PJN A;  3S8P A;  2RQQ A;  2IP2 A;  2YSR A;  1MGT A;  1MBE A;  4YNM A;  1MD0 A;  2NVU B;  3DLA A;  1FY7 A;  3A0H C;  2VE8 A;  1TNS A;  3VOD A;  4HF0 A;  3SEQ A;  3Q9V A;  3H5A A;  2OQG A;  3OIQ A;  1A6Q A;  2KPM A;  4E6K G;  2ZJP F;  4YPA A;  4HV5 A;  2DA2 A;  2EA2 A;  1W1W E;  2FML A;  3ROU A;  2DMN A;  2F48 A;  3CF2 A;  2A6H F;  3DEU A;  2HOE A;  3BG9 A;  4U0Y A;  2E1M B;  2PG4 A;  1LDK B;  5HLH A;  1UEL B;  2IGQ A;  3OOP A;  2F4I A;  2X6X A;  5JVT A;  3BP8 A;  3BG6 A;  3RZD J;  4QPQ A;  2IRF G;  3H3V K;  3RJW A;  1SAN A;  1AOY A;  2WAE A;  2WB1 A;  3J7A Y;  4AYB N;  2XF7 A;  2VC0 A;  1IV6 A;  3HYI A;  4PSW A;  4UHT A;  4RMN A;  1ZEL A;  4HZF A;  4N4O B;  1RUN A;  3H92 A;  2K40 A;  5K1Y A;  2KDZ A;  1HST A;  2BOL A;  2YUS A;  1P4W A;  4CDG A;  1B8I B;  1KU2 A;  4Q4Z F;  2GOX B;  1K6Y A;  3OXF A;  4H12 A;  4QPO A;  5IYB J;  4CUG A;  3M07 A;  3QWV A;  4XON A;  3JAM K;  1U2W A;  2CUJ A;  2FJ1 A;  2HR3 A;  4HAM A;  2DCE A;  4HLX A;  1QPM A;  3C18 A;  2X6Y A;  1MW7 A;  2R7U A;  1H88 C;  4C2U A;  2NS8 A;  1K78 B;  3BT9 A;  2UUZ A;  3N05 A;  4XRF A;  2GXB A;  1ZG3 A;  2LKX A;  2X51 A;  5BMZ A;  3K7A J;  3EDP A;  3OL4 A;  4I0B A;  1S3J A;  4UB6 C;  3FXQ A;  4P1W A;  4XSX F;  2HDC A;  1E3H A;  1N25 A;  1BC7 C;  4FMU A;  4Z6Y A;  2XB5 A;  4RLQ A;  3G71 I;  3BTL A;  4EVI A;  2NVQ J;  2R7V A;  2JN6 A;  2DI3 A;  2M0C A;  5K7F A;  4BDZ A;  3J81 Z;  2XB0 X;  1YLF A;  1PP7 U;  3SDB A;  4A0X A;  1HBX G;  5CPR B;  4EJO A;  3ISP A;  4HG2 A;  5A2Q Z;  2QSG X;  4HLY A;  3M59 A;  1JHF A;  2GIV A;  4AM3 A;  3MN2 A;  1BJZ A;  1WJD A;  3CP2 A;  1DGW Y;  4A93 J;  3F9Y A;  1YJW I;  1X1A A;  1BIB A;  2XC7 A;  5JIY A;  2JTV A;  3RYP A;  5IOY A;  1KYW A;  1X4O A;  5T0M A;  2DMT A;  2EZI A;  2PBI A;  3O2P E;  4CCO A;  4V19 K;  3WG7 H;  5ICF A;  2R7Q A;  4D7N A;  4ABZ A;  4ANJ A;  4AVZ A;  3E6D A;  1KQ9 A;  3SHF A;  2K4J A;  4LGW A;  2COM A;  3OL3 A;  4O3M A;  5KJN A;  3VYU B;  4CCK A;  3CCY A;  1J2X A;  3GLX A;  4HF2 A;  1MMG A;  4MI5 A;  1XMA A;  2BGC A;  1LFU P;  1T6S A;  1IRG A;  3TED A;  1XGM A;  4CXF A;  3OYI A;  2FBI A;  2JV0 A;  5LGU A;  2W5Z A;  3NQO A;  2QSH X;  1DGR M;  5E79 C;  4YIR X;  4WWC A;  1JXS A;  2BQZ A;  2M8E A;  5IYC J;  4MHG A;  3S1Q J;  3BWG A;  5D6E A;  1YTY A;  1QNT A;  4PJJ A;  1K83 J;  1UZC A;  2VBY A;  4PJM A;  3H5N A;  4RB0 A;  4KNY A;  3H9Q A;  1YW7 A;  3ZRG A;  5CQE A;  5HDG A;  2CFO A;  4DBQ A;  2JA8 J;  2A5W A;  4FQG A;  4H0E A;  1HA8 A;  2DFE A;  2LDU A;  3QP5 A;  4KIT B;  3AKZ A;  3JRF A;  3DF8 A;  3L2Q A;  1P4X A;  3CF5 F;  2QQB A;  1D0Z A;  4X1E A;  2Y30 A;  5BNG A;  4U0V A;  4C3J J;  3CO6 C;  1MSF C;  3LSP A;  3WHC A;  1LUJ B;  3GX4 X;  2YU3 A;  3I59 B;  1QHG A;  4DZP A;  1U5T C;  2X6W A;  1TQI A;  4RBO A;  5EEG A;  3RKX A;  4E70 A;  5C4X J;  1D1A A;  1T95 A;  5LLQ A;  3FMQ A;  3PIO F;  3LSR A;  1YQA A;  5BOX A;  3LSG A;  4CA0 A;  2LG4 A;  5LHH A;  1FX7 A;  5GPC A;  2ELK A;  1VZ0 A;  5EF6 A;  1ZR4 A;  4AWX B;  5FJ8 J;  5IT9 K;  3FXL A;  4E7L A;  2CH0 A;  3JRG A;  3U1K A;  3S7D A;  3MZH A;  1IZ1 A;  1JKO C;  3TQN A;  1XC5 A;  1Z9C A;  2EV6 A;  2GA2 A;  4OIN F;  2EFO A;  2E7X A;  3H35 A;  1NG7 A;  3E6B A;  9ANT A;  1EH8 A;  4CYC B;  4WXH A;  2A07 F;  3GFM A;  2UZK A;  1EH6 A;  1RZ4 A;  3MKW B;  3BZC A;  2BW3 B;  2X9D A;  4BHB A;  2R7D A;  3GWZ A;  1ERD A;  1ZTR A;  3OMY A;  3EPZ A;  1IDZ A;  1HDP A;  3ZMT A;  3M8F A;  1GV2 A;  4BDY A;  2HU9 A;  4BE2 A;  1WQ2 A;  5F64 A;  3DTI A;  1X3Z B;  4FX4 A;  4XQF A;  2L5Q A;  3KFW X;  2IA1 A;  2D1H A;  3JW4 A;  2ZBK A;  4A0Y A;  1MMA A;  3A0B C;  1I1G A;  3L00 A;  4I0A A;  5D5X B;  4U7B A;  1G8X A;  4P9F A;  1ZGJ A;  3E3V A;  1O7L A;  4G6T B;  4XRS A;  1B8I A;  2JA6 J;  1RI7 A;  1R4N B;  4RB2 C;  1SMT A;  5CLS A;  4AIH A;  5BQT A;  5KAF C;  3PSF A;  3I56 I;  3E6M A;  3F8M A;  2FE3 A;  4XLN F;  2AS5 F;  1J5Y A;  4RGS A;  4UV9 A;  4L5E A;  2E1M C;  2EIJ H;  1HLV A;  1SD5 A;  1K78 A;  3M54 A;  2F5V A;  1G6N A;  4DZJ A;  1IDY A;  2FBH A;  5HI7 A;  3F9W A;  3HSF A;  4E7Z A;  4YIF A;  1J9I A;  2HOA A;  2XAF A;  2DFI A;  4Y17 A;  2W5Y A;  3E6C C;  1FYK A;  2LY9 A;  1V54 H;  4HX8 A;  1UHW A;  2LC2 A;  2G7H A;  1YI2 I;  1S5L C;  2IVM A;  1FSE A;  2EIN H;  3QU6 A;  1UB9 A;  4C2M J;  3MCZ A;  3VYS B;  1JT6 A;  2M3A A;  4S04 A;  5T0K A;  2O5R A;  3IP4 B;  3OS5 A;  1FYL A;  3B6C A;  1YJ9 I;  2VT3 A;  2XGE A;  3UNG C; 
#chains in the Genus database with same CATH homology
 4HEA 2;  2HPM A;  3VDX A;  2KL4 A;  4PUS A;  3VYT B;  2R3A A;  1WJ5 A;  2QKM B;  2O8J A;  4XLE A;  3W2V A;  3PUB A;  1N3J A;  3CES A;  2V1N A;  2DXI A;  2IGN A;  2CV1 A;  4XR6 A;  3PDN A;  4NC8 A;  3G2B A;  4F3Q A;  3A4C A;  4J7I A;  2P0W A;  2R7S A;  3M58 A;  5CKT A;  2Q2E B;  3A2K A;  2CMP A;  1ML9 A;  4BQQ A;  2ZFU A;  2W00 A;  2CW7 A;  3OY9 A;  1WJC A;  5LSZ A;  3LSI A;  3DQV C;  3M5A A;  4AU7 A;  2RNG A;  3NWS A;  1WJB A;  2WY8 Q;  5F6L A;  4ZDL A;  4J00 A;  2F69 A;  4PK4 A;  3KMJ A;  3K4K A;  3V42 A;  3PFY A;  5KCM A;  3QWP A;  1XQH A;  1W36 C;  3OYE A;  4B43 A;  1BR2 A;  4ZTF A;  4O6F A;  4YPU A;  2PMZ A;  1JI8 A;  2W7N A;  4BS9 A;  3KYL A;  1PEG A;  3BG7 A;  3OS2 A;  2W82 A;  1N6C A;  2LOO A;  3K4N A;  5KJL A;  4ZC3 A;  4B48 A;  2ZSH B;  3FKJ A;  4P5O A;  2IS1 A;  4RM3 A;  2L9S A;  1MT6 A;  4XOR A;  4BQN A;  2X1E A;  3TMO A;  4ZDO A;  4N4N B;  2I8D A;  3M8J A;  2K5C A;  3OS0 A;  2L9N A;  2XDV A;  4Z4P A;  3W2A A;  2VL8 A;  4F91 B;  3MKY B;  1FMW A;  3HOT A;  3W2W A;  2HVR A;  3DTE A;  3QOD A;  3RU0 A;  3CBM A;  4BJ6 C;  1LFP A;  1KON A;  1WJA A;  4XL9 A;  2VAS A;  4Y3O A;  4PJL A;  4J01 A;  4PFO A;  1R6R A;  4OWR B;  5TEG A;  3DB5 A;  3S7B A;  3QYF A;  4E7S A;  3DPT A;  5KNL A;  3TBI A;  3K4L A;  2W1O A;  1G59 A;  4X0G A;  3MO2 A;  2Q1Z B;  3OWT A;  4BJ5 C;  2K9L A;  2XAU A;  1BR1 A;  3PNT A;  4XKV A;  3BCA A;  1DQU A;  5EX3 A;  3CBP A;  3HOS A;  3EP0 A;  2OC6 A;  4F93 B;  1MMN A;  3S32 A;  4XLC A;  2W4S A;  2VJI A;  4II3 A;  3AL0 B;  1N75 A;  3S3O A;  4CSW A;  3DPL C;  5CQG A;  1BOB A;  1IRX A;  2M7A A;  2CS3 A;  5KJM A;  3VSK A;  2R4G A;  2LBF B;  3H0D A;  3QYE A;  2R7O A;  1SFK A;  5CCL A;  2AQF A;  2CUZ A;  3KMT A;  2X85 A;  4XKB A;  2BW3 A;  1PJR A;  4DBR A;  3QWW A;  3D5R C;  3RTR A;  1DP3 A;  4B47 A;  2WAD A;  2IGK A;  4XLA A;  3UNG C;  4E4H A;  4EAT A;  2LY2 A;  4H4K C;  4HPQ A;  4FAS D;  3HNA A;  3SZG A;  1D0Y A;  3F9K A;  4II2 A;  2BVM A;  2WAQ A;  1Y6I A;  2R7T A;  4YRV A;  4KT6 A;  2K9M A;  2MYS A;  2M7B A;  4D1Q A;  4B44 A;  3LMM A;  5HNH A;  2DOA A;  5HQ8 A;  2VKD A;  2RRE A;  1YX3 A;  3HPG A;  2R7R A;  4DOZ A;  3SW9 A;  4CCL A;  2RFI A;  3TG4 A;  3BLY A;  2HZD A;  2FUG 2;  3HKZ A;  2K3P A;  4Y33 A;  3MO5 A;  3CJR B;  4RZ0 A;  1S9H A;  2A6T A;  3F9X A;  2VJJ A;  3S3M A;  3FBI B;  5KHD A;  4LG3 A;  3LSH A;  3OR2 C;  3DKX A;  5KJK A;  2G46 A;  3GBG A;  5F5E A;  2V9K A;  4J8O A;  2OV7 A;  3KX2 A;  2V6E A;  2IS6 A;  1OR7 C;  4ZDP A;  4CCN A;  2R7X A;  2DT6 A;  1ZKK A;  1MMD A;  3K5K A;  4KJZ A;  4HNT A;  1WFX A;  5EG2 A;  3DEE A;  3ZR8 X;  2Z16 A;  1X1B A;  4C9Y A;  3AL0 C;  3N71 A;  3S93 A;  4E7J A;  4MLO A;  2MC4 A;  3HXL A;  1PYV A;  2KP6 A;  1P9Q C;  3S3N A;  4Y4R A;  1UAA A;  2HVQ A;  3HC7 A;  5TGT A;  2WAF A;  3OYF A;  4NJ5 A;  1WJE A;  2UWM A;  4BJT A;  2MAB A;  4E7H A;  4XMY A;  3K4M A;  3MMY B;  2VPL A;  1MUF A;  4XLH A;  4BEH A;  4BL0 B;  2VQH A;  3OR1 C;  2PJR A;  3M55 A;  2VKH A;  1Z7L A;  4F55 A;  3HG9 A;  3SWC A;  4OAZ A;  3E1S A;  1U0J A;  3K4C A;  3RAY A;  5EX0 A;  4QEN A;  3C2H A;  4BGD A;  3H9G A;  1TT0 A;  4PJN A;  3S8P A;  5HOO A;  1H3I A;  2RQQ A;  4RLF A;  2VB6 A;  4YNM A;  3FBN B;  2CW8 A;  3DLA A;  4U87 A;  2HVS A;  2KQR A;  3RPU D;  3ZQQ A;  4XOT A;  3L2W A;  1OLT A;  3SEQ A;  1AA7 A;  3H5A A;  3TG5 A;  2L2O A;  2ZXH A;  3OIQ A;  4D9J A;  2KPM A;  3EUA A;  3K6G A;  3VSL A;  4E6K G;  4BU2 A;  4YPA A;  3DU5 A;  4OAY A;  3ZGK A;  2XSJ C;  5LSX A;  2IXS A;  3CF2 A;  3DU6 A;  3ZCO A;  2E5Z A;  2VJ5 A;  4QEP A;  2E1M B;  1LDK B;  3OYC A;  1UEL B;  2KRH A;  3OYM A;  4BAC A;  2IGQ A;  2XF6 A;  2F4I A;  5HVQ C;  5HLT A;  2X6X A;  3MKZ A;  3BG6 A;  3BC8 A;  2JSP A;  1Z3X A;  2WBM A;  4QPQ A;  3UR3 C;  4ZJZ A;  3DPU A;  2V26 A;  2UV1 A;  3K4J A;  3RJW A;  2WAE A;  2WB1 A;  5TTF A;  3J7A Y;  1V5F A;  3PNY A;  1QU3 A;  2XF7 A;  4LIV A;  2KDO A;  1D1B A;  2JVG A;  3I3L A;  4PSW A;  4ZTJ A;  4E7I A;  3RIB A;  4FET A;  4RMN A;  1ZEL A;  4N4O B;  4LDG A;  3L2R A;  4GRI A;  2BOL A;  2LRE A;  2LY1 A;  2GOX B;  1K6Y A;  2VXZ A;  3OXF A;  3OPE A;  4QPO A;  4CUG A;  4H12 A;  2L7K A;  4XKC A;  3QWV A;  2VXD A;  4XON A;  1LVK A;  2BVL A;  2VQC A;  2QPW A;  4J83 A;  4CZC A;  2E5N A;  4HRI A;  2CUJ A;  2ELJ A;  4NNJ A;  4O30 A;  2DCE A;  3OYH A;  2X6Y A;  1MW7 A;  2R7U A;  2V7F A;  3D5S C;  2CV0 A;  4C2U A;  4F92 B;  2E60 A;  5FRM A;  2UUZ A;  3N05 A;  2AQE A;  4ITV A;  2VJ4 A;  2KMU A;  2X51 A;  3OL4 A;  3PL8 A;  4P1W A;  2VLA A;  4B3X A;  4IZZ A;  2R7W A;  2JUG A;  4FMU A;  4RLQ A;  4BXF A;  2R7V A;  4YPE A;  4BDZ A;  4C1Q A;  3H9J A;  3FHN A;  2MD0 A;  2XF5 A;  3SDB A;  5CPR B;  4HG2 A;  4JDS A;  2LBF A;  1LKX A;  3OYL A;  3HUG B;  2VIX A;  3C2G A;  1N78 A;  3M59 A;  1WJD A;  3CP2 A;  2VQG A;  3PNV A;  1D0X A;  1DGW Y;  2HDW A;  2KRC A;  3A1Y A;  3AFH A;  3K10 A;  3LFU A;  3RQ4 A;  4BE0 A;  1X19 A;  5F6K C;  3F9Y A;  2DT7 B;  1X1A A;  2IGM A;  4YEL A;  2XC7 A;  5JIY A;  1MVX A;  1X4O A;  1TZL A;  5T0M A;  4XOP A;  2DJI A;  3F9Z A;  1YE9 A;  3OS1 A;  4CCO A;  4E7K A;  3BO5 A;  2R7Q A;  4ANJ A;  4AVZ A;  5F59 A;  3MO0 A;  3OL3 A;  5KJN A;  3VYU B;  4CCK A;  5FRO A;  3OYN A;  5AYF A;  4ZYA A;  1O9S A;  1EA3 A;  4CH7 A;  3OOI A;  1MMG A;  3HPH A;  4MI5 A;  2LH9 A;  1BR4 A;  3OOU A;  3VWB A;  1X1D A;  3EUK L;  2CV2 A;  1J09 A;  3OYI A;  3PSI A;  4IQJ A;  5TH7 A;  1GLN A;  2JV0 A;  2W5Z A;  1DGR M;  3E0J B;  1WJF A;  3TL4 X;  2BQZ A;  4IJ8 A;  3FPD A;  4DIQ A;  2X1D A;  4KIS A;  4PJJ A;  4PJM A;  5JIN A;  2IS4 A;  4IKF A;  3H5N A;  4AYB A;  5CCM A;  3H9Q A;  4NC7 A;  4DGW B;  3OYG A;  3ZRG A;  2HQA A;  5CQE A;  2CFO A;  4DBQ A;  2A5W A;  3RCO A;  3OIP A;  5JHF A;  2QKL B;  1HA8 A;  3MD2 A;  1N77 A;  1Y56 A;  5ARF A;  3W3C A;  4KIT B;  3VV0 A;  3AKZ A;  3LL7 A;  4YND A;  3L2Q A;  5HNF A;  3VYR B;  4CCM A;  2Z2S B;  4R79 A;  3S7J A;  1X1C A;  2ZXI A;  1D0Z A;  3H5R A;  3M53 A;  2LYC A;  3OXL A;  3IAS 2;  4HNU A;  2IGO A;  4E47 A;  1QHG A;  1QHH D;  3K70 D;  3NWT A;  2X6W A;  4XKW A;  4XN0 A;  2M0M A;  3DTK A;  2HNH A;  5LFA A;  3QYB A;  1D1A A;  3BCB A;  1T95 A;  5T5G A;  4YNP A;  4I51 A;  4YEJ A;  3OYD A;  3LSG A;  4CA0 A;  2LG4 A;  2X1C A;  4LIT A;  1VZ0 A;  4BUP A;  3I9V 2;  4IX7 A;  4HSR A;  3IAM 2;  4E7L A;  1N6A A;  2CH0 A;  3S7D A;  3IHX A;  4CCJ A;  3L2V A;  3IUO A;  5JJ0 A;  3CBO A;  1YX5 A;  3D5L A;  2WY7 Q;  3H35 A;  3L2U A;  5FRN A;  3DKY A;  1NG7 A;  2M4G A;  4C2T A;  2GOM A;  4NVQ A;  3M56 A;  3MKW B;  4RM2 A;  2BW3 B;  1NG6 A;  1ERD A;  3CJQ B;  3OMY A;  3EPZ A;  5JHN A;  4JQF A;  3HL2 A;  4BDY A;  2NOJ B;  2HU9 A;  4BE2 A;  2JVH A;  2LRD A;  3OYB A;  4J7F A;  4QEO A;  3DTI A;  3S7F A;  1UG0 A;  3CZ6 A;  2M4K A;  4XQF A;  2L5Q A;  1T0F C;  2WA0 A;  4XLF A;  3LSM A;  1MNE A;  2Y0S A;  4XM3 A;  3RSN A;  4IJD A;  1MMA A;  4IQ4 A;  3U21 A;  4U7B A;  4XNF A;  1G8X A;  2V4J C;  3MEK A;  4PSX A;  2IS2 A;  4G6T B;  3PJR A;  4DJA A;  3EUH C;  3ZXS A;  5LD2 C;  3OYA A;  3K70 C;  1X4P A;  2MFZ A;  4JLG A;  2HPI A;  2ZSI B;  4BE1 A;  2KZV A;  3VUZ A;  3PSF A;  3CMM A;  2Z1D A;  2KLO A;  3M1C A;  1MND A;  3LSK A;  4JOM A;  1MVH A;  2KHM A;  4XN3 A;  3OYJ A;  2E1M C;  2JA2 A;  1W36 D;  1FMV A;  4NQW B;  5ARG A;  3M54 A;  3SYT A;  4BQO A;  2F5V A;  3DWL E;  3OYK A;  4WUY A;  3FDY A;  5HI7 A;  1V5G A;  4F52 A;  3F9W A;  4E7Z A;  3QOE A;  1V5E A;  1Z21 A;  1D1C A;  2W5Y A;  3M57 A;  3KEY A;  2VQL A;  4PFP A;  2LC2 A;  2OUM A;  3ONQ A;  2F6C A;  1Z3Y A;  4HST A;  1SAU A;  3SEZ A;  2M3A A;  3VYS B;  5T0K A;  4C30 A;  1E0E A;  2O5R A;  3KMA A;  3IP4 B;  3OS5 A;  4LIU A;  3K4B A;  3OXG A;  3DAL A;  4MI0 A;  4BEH B;  4NUB A;  3CP8 A;  2PJR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...