3S8PA

Crystal structure of the set domain of human histone-lysine n-methyltransferase suv420h1 in complex with s-adenosyl-l-methionine
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
263
structure length
233
Chain Sequence
MSAKELCENDDLATSLVLDPYLGFQTHKMNTRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKEHVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEENMLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYTCERRGTGAFKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase SUV420H1
publication title Crystal structures of the human histone H4K20 methyltransferases SUV420H1 and SUV420H2.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 60
structure length 233
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1700 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3s8pA01
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s8pA02
4C1QA 2W5YA 3N71A 4NJ5A 5EX0A 3F9XA 3CBMA 4QENA 3MEKA 2QPWA 3K5KA 5KJLA 4WUYA 5JHNA 5AYFA 3M57A 3DB5A 3S7JA 2R3AA 3OS5A 5KJKA 5TEGA 1MVXA 5CPRB 2O8JA 3KMJA 4J7IA 4YPAA 5T5GA 5LSXA 4JDSA 5JINA 4AU7A 5KJNA 3M53A 4NVQA 3DALA 3F9YA 3EP0A 5TH7A 1N6AA 5HI7A 5CCLA 5JIYA 3OXGA 4YNPA 3RAYA 1O9SA 3SW9A 1MT6A 1N3JA 3VUZA 1XQHA 1MVHA 2W5ZA 4RZ0A 3BO5A 3M59A 2F69A 3M56A 5F6KC 4MI0A 3KMAA 4O6FA 3CBOA 3RQ4A 4QEPA 2IGQA 3RU0A 5F5EA 4E47A 5KJMA 3IHXA 2JV0A 4IJ8A 3S7DA 1PEGA 3SWCA 5ARFA 3S8PA 3S7FA 4JLGA 4FMUA 4YNDA 1MUFA 3CBPA 4J7FA 2BQZA 5EX3A 3HNAA 4YPUA 5LSZA 3QWVA 4YPEA 4H12A 5T0KA 5EG2A 3FPDA 4J83A 1N6CA 3F9ZA 3M5AA 3OXLA 3M55A 1H3IA 3S7BA 4Z4PA 3MO5A 3OOIA 3MO2A 4IJDA 4QEOA 3QWPA 5T0MA 3VV0A 3KMTA 2RFIA 3TG4A 3F9WA 3TG5A 3RIBA 4BUPA 1ZKKA 5F6LA 5HQ8A 3OXFA 1ML9A 5ARGA 3OPEA 4LDGA 5F59A 4I51A 5TTFA 3RJWA 3M58A 4O30A 3M54A 4J8OA 3QWWA 3MO0A 5CCMA 3PDNA 2G46A 5JJ0A 4MI5A 4YNMA
chains in the Genus database with same CATH superfamily
2CQKA 1ZRFA 4U0WA 4XOTA 5HLGA 1X1BA 5HLIA 2GA2A 3CTAA 1UHWA 2FU4A 2O0YA 3K2AA 3CCEI 3S1QJ 3F9XA 2R4GA 3FM3A 3H0GJ 1YTYA 1YIOA 4M3GA 1R7JA 2HQ5A 3ZQFA 5JHNA 3CDHA 5EYRA 4CYDA 1BIAA 4A93J 3S7JA 4PSXA 3ELKA 2DK8A 3FXLA 4ESBA 5J1UA 2FNAA 1B8IB 2X1CA 2EZKA 3RKXA 2JT1A 2P7VB 1SFOJ 4I0AA 3CMEI 2JRTA 2JZYA 3TKYA 5HS9A 3DEUA 3JRFA 1T39A 3OYCA 2XDVA 1FEXA 4IX7A 2Q2EA 2X6YA 3J7YJ 4KIFA 3L2RA 4ENNA 3I56I 3F22A 4WWCA 2GLOA 2VBWA 1A04A 2UUZA 2X48A 1G59A 2DMNA 2FX0A 1FP2A 3W6JB 1EH7A 2H8RA 1XPXA 4L5IA 3RU0A 1KU7A 3W2VA 3EPZA 4E47A 1YW7A 4A3MJ 2H8WA 2VJ5A 3BZKA 3OYIA 2HGCA 3BZ6A 2F4MB 2JSPA 1FX7A 1MDMA 2BHYA 1B1BA 5J40A 2O8XA 3PNYA 1CQTA 1VQ5I 1LVKA 4ABZA 3NQOA 2LDUA 4A3LJ 2VI6A 3WTXC 3VYRB 4KDPA 4LB5A 3ZPLA 3MKYB 2A05A 2Q8KA 4IHWA 1KONA 3LSHA 3I54A 3ECOA 1LDJA 2KJCA 5KAFC 4UXNA 3K69A 2LY9A 2QQ8A 2V4JC 1VQPI 2VUMJ 5D5WB 1NK3P 4A3CJ 2X1DA 3G1OA 3LSTA 1FBQA 3LAPA 3IHUA 3TG5A 4BUPA 1DP7P 3FXJA 2BVMA 3IH3A 1P92A 2VBXA 1KU9A 3LSKA 3G6EI 1J7KA 3OYFA 5HQ8A 3PSFA 4IQ4A 1YS7A 4I51A 2GAUA 2CG4A 1IC8A 5E8GA 2RQPA 2OAZA 3HRTA 2RVCA 3OIOA 4E7HA 2D2WA 1EH8A 2BXZA 3D5RC 1K79A 3CC4I 4HNTA 3A02A 3KP6A 5F04A 4ZDLA 4BE0A 4HEA2 2EIJH 2AXTC 2EIKH 2FQ4A 4MTDA 5CVRA 3GLXA 1VQ7I 2M9HA 3GTJJ 1DU6A 4HNUA 2VKEA 3JRIA 2M7AA 1U78A 3H3VK 3K5KA 2E19A 1I6HJ 3ECHA 4GRIA 4ZYAA 3S2HJ 3T0YA 1W36D 2V1NA 4PJNA 3EDPA 5HNFA 1T38A 2V1UA 2MG4A 5KNLA 3CCQI 1UCRA 2VPRA 4LB6B 2VLAA 1ORKA 3MZ8A 4II3A 3M9AA 1T98A 3KYLA 2CWEA 3E6MA 1ZG3A 3K6GA 1R49A 1XG1A 3H0DA 4HX7A 4I02A 1P4AA 2P7CB 2IS4A 1C0WA 3DV8A 1XC5A 3DCFA 3OXGA 3MEXA 4YNPA 1MJAA 1WCMJ 3WGIA 4B47A 2ACJA 4ZZDA 3I55I 1MVHA 3W2WA 1FMWA 2LP0A 2UV1A 1XGNA 5M5WJ 5TRDA 2V7FA 1D3YA 3DKWA 3IP4B 5LFAA 4B09A 3GCMA 2QQ9A 2DA6A 3AFHA 2JUGA 1T8IA 2LG4A 2COBA 5B5EC 2FXAA 3EUHA 3H36A 1O3TA 2DJNA 2H6BA 3RKWA 5IP7J 4EJWA 5LGTA 5GAEJ 5K5RA 1XD7A 2HPIA 5LLQA 1WVRA 5GTHC 4HBLA 1ZGJA 4L9NA 1R4MB 1K6YA 1KU3A 1TQPA 3H92A 5M3MJ 1MH3A 2B0LA 4A5MA 4EGZA 1PYVA 3L2QA 3OYMA 3J7AY 4DBRA 2BW3B 1SFKA 2DMUA 2QQAA 2HOTA 2Y0SA 5ILSA 3IL2A 1AKHA 3FPDA 4HDVA 2FUG2 1WI3A 2M30A 1SVOA 3GZ6A 1X3UA 4E7KA 1Z21A 3A2KA 3QRFF 3I4PA 2R93J 2W57A 4BE2A 2DTRA 2EH3A 2KDOA 5IT9K 3VWBA 3S15J 2PN6A 4FTHA 1D5VA 1K7AA 3OYEA 1I5ZA 2W24A 1QHHD 4QPOA 3OR1C 3S3MA 1ZREA 3DKXA 2XAJA 5E17F 4AIDA 4KN7X 5TTFA 2Z1DA 4O30A 4JQFA 2DYRH 1SD6A 2K9LA 1MH4A 2VXZA 4B3XA 4IL6C 5H6QA 3MZHA 1U6GA 1U2WA 2CMPA 3RPUD 2R92J 2PI0A 5FKOA 2VXDA 2E1CA 4UB6C 3LWFA 4LG0A 2CYYA 4BJ6C 4RB0A 1CF7B 4V2GA 3KZIC 1S7OA 1X19A 2CUZA 2KZGA 2TDXA 2IXSA 1X3WB 2F48A 1LDDA 4I2OA 3IC7A 5FRNA 3S14J 2RGVA 1O3QA 4MNUA 3U1DA 4KN4X 3PUFA 1NG6A 3KMJA 4E7SA 5IYDJ 3BG3A 4IRHA 4ENMA 2LK2A 3A01A 4IJAA 4NC8A 1R5GA 4NVQA 3LAJA 3ULQB 1S7EA 1OYWA 2FE3A 2Y69H 4C30A 1RR7A 2A5WA 2O8KA 2R5YB 1BOAA 1X1PA 1Y8RB 4OWRB 1TL8A 1A5JA 2LY2A 5M5YJ 4RMNA 1S8NA 1XGSA 5AIPA 3CMAI 1T0FC 4UVBA 1TW3A 5GP9A 4U7BA 2HVQA 2VBYA 3RDIA 2CV2A 4UB8C 5C4XJ 2Y30A 1R1UA 2IEKA 1X1DA 6PAXA 5F6KC 2JUCA 1YW8A 3R60A 3I59B 3GEZA 4L5JA 3MKWB 1W5CC 3CBOA 1ETWA 2PMZN 5KAIC 1W1WE 2FOWA 2ID3A 2R7SA 4IHXA 1FOWA 3BY6A 3RI4A 1HF0A 2V79A 3GFMA 4N4OB 3S1MJ 2JV0A 3S7DA 1XTAA 3LQQA 4BYYA 4NBQA 5DCMB 2G9WA 1F4KA 5E20A 4A0XA 1B8IA 1U8BA 4JOMA 3JRDA 2MA3A 3ZMDA 3ZQGA 3GTOJ 4XLNF 3B02A 2XUBA 4D7MA 1XMAA 4CO8A 5J3LA 4FASD 4XLAA 2KDZA 1VQNI 3F0CA 2RKHA 2KPMA 1U5TC 1AU7A 2VKVA 2NRAC 4YIIA 4PGGA 1T2KA 2XASA 4JP0A 2COMA 4M72A 4Z4PA 1WHUA 2V9VA 3LSMA 3OOIA 4Y17A 1Z9CA 2IS1A 4A3FJ 4XMYA 3OYNA 3A1YA 2DOFA 2DA2A 2CQ7A 3ERMA 2XKOA 4ZJZA 2CJJA 2BHZA 1UMQA 3MWMA 4I01A 3I9V2 1Q1HA 4BQQA 2DMQA 2HVSA 3QWLA 2D45A 2X85A 2GQQA 2K4BA 4UUTA 1E3OC 1P6RA 1QPMA 5ARGA 4IXAA 5ILUA 3RJWA 1M1EB 3FXQA 3REOA 4QSHA 3GZNB 3KLOA 3HSRA 4HA8A 4LFUA 5AIQA 3E7LA 3V7RA 3HL2A 2ZJQF 1FOXA 5GAHJ 4YNMA 1W5TA 4QLCU 2WV1A 4XSXF 3JTGA 2ZMEC 2MW8A 3LL7A 4UUVA 1HKSA 2IA2A 2BV6A 3P9IA 3E1SA 3FHNA 4LMYA 5BPIA 2O03A 4XLPF 4MO7A 3S2DJ 2QKMB 3G73A 1WI9A 4WX9A 2HQAA 1XCBA 4EJVA 4LIVA 2YS9A 2HI3A 4W97A 4XKBA 1JHHA 3M8JA 2HKOA 1QA6A 4KMUX 3HTSB 1USTA 5DD8A 4GO1A 5DD4A 5E79C 1K83J 3WTSC 1MNMC 4IRIA 2HYGD 2R7QA 2WAQN 4UUSB 3K4LA 2O8JA 2MD0A 4XIDA 3DF8A 3SDGA 3NEUA 2D1HA 4P55A 2L9SA 1VZ0A 4CSWA 2FOKA 5CQGA 2GBYA 3F9YA 2F5EA 4B1RA 5TH7A 4YFXF 1BR4A 1R5ID 5ED4A 2EILH 1OCPA 1XMKA 3GFIA 2DT7B 3DXJF 2E5NA 3PJRA 3E97A 4E6KG 2ISYA 2R5ZB 2ME0A 4IHYA 1R4NB 4DBQA 3F3XA 3U9GA 4M6VA 4A2UA 3OSGA 3LA2A 2HXOA 4D5CA 1LUJB 2XPVA 4I6ZA 4CCNA 4FISA 2BGCA 3WG9A 1ZRDA 3SJMA 3GFJA 2GOXB 3NWSA 5KCMA 4ASNA 2IGQA 2E1MB 5F5EA 1B6AA 2ZXWH 4EM0B 2K9SA 3RYRA 1Z91A 2CQQA 1RKTA 3IUOA 1KGSA 2M8GX 5JLWA 3KYCB 4JLGA 4BJTA 1P4XA 2VKHA 4M9ZA 5J8FA 3ZGKA 3SZPA 5T0KA 1OR7C 3A0HC 3HRSA 3TOAA 5HDGA 3PQKA 3I64A 3V42A 1DU0A 2KQRA 1X4OA 5J47A 2M4KA 2EINH 3EYYA 1G3TA 2UXNA 4A3JJ 2G0EA 1IN6A 1RNLA 4MQVA 5D6FA 2ELHA 4OMZA 5CVJA 2A6TA 1H88C 2FBIA 3VV0A 3Q5FA 3VSKA 2FBHA 5JI6A 4HYEA 1JTYA 2BXYA 1KQ0A 2F5DA 2FF4A 1QVTA 3DBRB 2V1XA 4HV6A 3GTQJ 3SZTA 1XS9A 4N0BA 3IWFA 1Q1VA 1WJBA 4J8OA 1K6OA 3QU6A 3ASOH 3B6AA 3L2VA 3CJRB 3JRHA 2NS0A 4ON0A 1RIOH 1J59A 3ZN0A 1O3RA 1GXQA 2IT0A 2BW3A 4N9IA 4PCQA 4KIBA 4LIUA 3BR5A 4HPQA 4HW0A 1DQUA 5HS7A 3WU0A 2NOGA 1IUFA 3BG7A 4G6TB 1Y1VJ 3TOBA 3P9KA 1Z6TA 3HPHA 2AQEA 2QPWA 3TO9A 2F5VA 3TW7A 2HKXA 4E7JA 2DPDA 1J0RA 2GIVA 5D8KB 3M8EA 2R7DA 2ZSHB 2OTLI 2HQNA 1FSEA 2VT3A 2WBMA 3K70C 2LTPA 3ZQHA 1A31A 3EP0A 2VODA 5LD2C 3LFKA 2KIQA 1SMTA 3K10A 1JUPA 2HZTA 5LGUA 1K4TA 2NVTJ 3DLAA 1D8JA 1V4RA 2B9SA 2DPUA 3H5NA 3FMRA 2W5ZA 2KJBA 2GA1A 3HSEA 3OOPA 3HZJA 5E3MA 1GV5A 3J80K 2M34A 5E3OA 1ZHFA 2E1MC 3S17J 3FXUA 1P2FA 4QEPA 1CF7A 4HX4A 5EZGA 1YJ9I 1SAXA 4FX4A 3GTLJ 4A3IJ 4IHTA 4XLFA 3RZDJ 1XGMA 4V19K 1T56A 3DPTA 4CA0A 1HKQA 2WAEA 4MIMA 3CBPA 4ENJA 1YRNA 1U0JA 4YPEA 4L5EA 4QTRA 3CJTB 4R79A 3HEFA 3H9GA 3F9ZA 2H1LA 3V4GA 1IXRC 1ULYA 3MMYB 4I76A 3O8HA 2F4OB 4UHTA 1TWCJ 1YE9A 3WHBA 3WTZA 1MNEA 2Z33A 3HUGA 2DOEA 4HSTA 1UG2A 2CW0F 3Q9VA 1IN7A 3MO2A 4IJDA 1W4MA 4OMYA 1YQAA 2HOAA 2BEOA 3HG9A 3E5UA 3M1EA 4LK0F 1R1VA 3OMYA 2MSYA 3HB9A 3I59A 4YG2F 5LEJA 3TG4A 2ZSIB 5JLXA 4B44A 5IT9Z 2EQRA 2P8TA 5K7HA 4IHSA 5F6LA 1PP7U 1ETVA 1BW5A 3ZQQA 3DU5A 5FLMJ 3Q0UA 1VQOI 1MMAA 2V1DA 5DCMA 2NVYJ 4HF1A 1S5LC 5DS9A 4UNOA 3K1NA 3BTCA 3HOSA 2KIUA 3SFZA 4C1QA 5FLVA 1I27A 2DTZA 4XK4A 2STWA 4RM3A 2I5UA 3N71A 2PLYA 2HTSA 2NOJB 3GLLA 5EF6A 1HDPA 4NB5A 2EV0A 4LITA 4ANJA 3KP2A 4IVNA 1KQ8A 1RI7A 1EKEA 1MKMA 1JT6A 2E7WA 3WE2A 1ZARA 2K9MA 1SFUA 2LNBA 2JSCA 1V55H 4HF0A 4M9XA 1UHMA 2O9LA 3DB5A 4G12A 2DA3A 3A03A 5EEHA 1BI1A 1IZ1A 4BU2A 3VODA 3MVPA 3K7AJ 1ZELA 3QPHA 4KITB 3GVAA 2YPRA 1VQ8I 2VASA 2E36A 1QU3A 1NK2P 9ANTA 1POGA 2LOOA 5GADJ 2VE9A 3M53A 3TBIA 1JKOC 4HOBA 2DT6A 2BY2A 2Y0MA 1TP4A 3TW6A 2X6XA 3OL3A 3CD6I 3BWGA 3FWEA 1VQ6I 4CCMA 1YO5C 1QPIA 3IAM2 1A35A 1IV8A 2EJRA 1LJ9A 1JHFA 3M3YJ 3X2QH 2EZLA 3T8RA 3BG6A 3BTLA 4MI0A 1U9NA 3JRBA 5JR3A 2K5CA 3KP7A 4E7LA 4GCVA 5EEGA 2JVHA 2IA1A 5BOXA 4ETSA 2QGUA 3ZR8X 4A3GJ 3R0AA 3E0JB 2RNGA 1A36A 4UUSA 1NG7A 3BJAA 1UFMA 3KX2A 2X0LA 5DUKA 1HSTA 1YI2I 1ZKGA 3KIOA 2MH2A 4D5FA 3LOCA 1ETOA 4FT8A 1QRYA 5IP6A 1WJDA 3COAC 5IPAA 1ETXA 3MFKA 1VQMI 2NVQJ 4A3BJ 4GDFA 2A61A 2GWRA 3R6SA 2BY3A 2OUMA 2Z5UA 1Y56A 2O3FA 3QAHA 2R5ZA 1DUXC 3K0LA 1XN7A 1R22A 4HRIA 2LR8A 2XF5A 2NAZA 4BEHB 5EG0A 1H9GA 2RN7A 4G7OF 1N75A 5JVGF 2WC2A 1TQIA 2ZNYA 3IAS2 3QOPA 1LEBA 3CDLA 5GPAA 4B8XA 2HZDA 2OCCH 3DEEA 4DJAA 3FKIJ 3M58A 4RM2A 3H1CA 4G7HF 3QODA 3MN2A 2QBYB 4MLOA 2DA1A 4S0HB 4CCJA 4PGHA 2VL8A 4Y3OA 3LSRA 5L3BA 2KISA 4X0GA 1AWCA 2IAIA 1RR8C 1IRFA 1WKMA 2DA7A 4ZH4F 2R7TA 1VF9A 2HU9A 4P9FA 3J81K 1UJ8A 3K4KA 4XONA 4AVPA 2Y31A 3OYHA 1W0UA 3CLQA 5JVTA 4IOCF 1N78A 1KZHA 4C9YA 1WH5A 1V3FA 3TO6A 2L3DA 5FJ8J 4WUYA 3OV8A 2L2OA 1H89C 3M57A 4RAZA 2QF7A 5J1RA 1XB4A 4Y33A 2X51A 1G6NA 2KLOA 4MHGA 3IRQA 1Y0NA 5H20A 2H27A 3K1MA 3BQYA 2NS7A 1FC3A 2XPUA 3W6VA 1WSUA 1QZEA 3WTUC 2DT5A 4M73A 1WPKA 3G1MA 3WG7H 3HOZJ 3EYIA 2LC2A 2FMYA 2QLZA 3FBIB 4L0YB 4G8XA 1RESA 4A3KJ 2W48A 1EJ9A 1N6AA 3F8BA 2KRFA 3A4CA 3BR1A 4GYGA 1Z6RA 2YU9J 3KFWX 4PSWA 2O6GE 1HOMA 3L00A 4DW6A 3GTPJ 1S3JA 3F21A 3SW9A 5FKNA 4U7DA 3FXOA 3IH2A 4ZYDA 1S72I 4MFEA 1G3WA 1XGOA 1NH3A 2AS5F 2DCEA 1T6SA 2QSGX 3RQ4A 4DZPA 2UXXA 1MMDA 3L2UA 3RJPA 2DODA 2JPCA 1BR2A 1SFEA 5ERIA 1VI0A 4XORA 3ZQ7A 1Y39A 1IO2A 3PO2J 4LK1F 2TCTA 2ETHA 5L3DA 4HG2A 2FQ3A 5F27A 4ESJA 5F0FA 3BJOA 1MBGA 2RDPA 5E8IA 5L3GA 4XICA 1R1TA 1T08B 3M4OJ 2CUEA 1N6CA 3M5AA 3CF2A 2HWVA 4A0ZA 2Z16A 5C4JJ 1E3HA 1P7IA 1QO0D 3HXLA 1ZG1A 1K78B 3CQZJ 1GT0C 2E2IJ 1Z77A 2G7UA 1APLC 5CLSA 5BS6A 1Y8QB 3LSPA 1E3PA 4UVAA 1PP8F 3KMTA 2ELKA 2W82A 3LFUA 1YYVA 4KMFA 4JX5A 1NHAA 2A6EF 5ICGA 2R7RA 3RKQA 1HBXG 4E70A 4LDGA 4HDUA 2LF8A 3CLOA 3TP3A 2BBYA 3IH4A 2L01A 1S6LA 2LMDA 1UELB 2R7OA 3U1KA 5JHFA 4S05A 2R7XA 2EWNA 4BNCA 5CCMA 3TMOA 1FTZA 3CCJI 1JT0A 2CQXA 2L4AA 1U5TB 4DIQA 1O7FA 2W5YA 5A2QZ 1JJ6C 1I3QJ 4BE1A 2Q1ZB 4JX4A 2EK5A 3FZVA 3C3WA 3E3VA 3I3LA 4PJJA 5B3SH 1JXSA 2PMZA 1I50J 3MKLA 3AG4H 1L0OC 2R0QC 3H5RA 4G6DA 2MC3A 4BXUA 2DMTA 5HS8A 2V26A 2K27A 4EJOA 5ICEA 1UAAA 2NS8A 4BHCA 4WF2A 2HDWA 4V2FA 2DFIA 5B66C 3DLLF 3F23A 3R4KA 4A6EA 2MYSA 1RUNA 3CCLI 2ZMEB 2VQLA 1FJLA 1XX5A 2EIMH 3OYLA 3FX3A 3GX4X 4IHVA 3ABMH 4OAYA 1O9SA 4CCKA 3GMEA 3DU6A 3SYTA 4RZ0A 1WGXA 4CCOA 2RNJA 4D0PA 3MCZA 2QYOA 3E5XA 4PJ0C 2H09A 3ZQLA 1F5TA 4MGRA 1RKWA 3CJQB 4XLEA 2MC4A 1MSEC 4NC6A 3J80Z 1ZAOA 2X9DA 2AQFA 2L7ZA 4JK1X 2CV1A 2CUFA 3TDZC 4ZTJA 2OCEA 2FSWA 4RLQA 1ZG5A 3FBNB 2NYXA 3PNVA 1ZTRA 1JUMA 3SEZA 4RS8A 4HF2A 2OPTA 5CKTA 3E6DA 5LRRA 2YUSA 1TT5B 3ML6A 2M3AA 2VQHA 2JTVA 3L2WA 3GZ5A 3S3NA 2ZJ2A 3OS1A 1WFXA 3LNQA 4B3AA 3CZ6A 3OSFA 5IY5H 1HQCA 1U8RA 4H4KC 1USSA 2XHKA 2WY8Q 1QBJA 5J4YA 2PEXA 2A07F 3K4MA 3CMYA 1OKRA 3FXMA 2EZHA 2GOMA 3H3UA 4M3EA 4Y7NJ 2OQGA 1MJ9A 2DYSH 2WAQA 3EETA 2MLKA 4J00A 5K1YA 4IO9F 4P5OA 4NQWB 2DA5A 5FFZA 3HOYJ 3GUDA 2OTJI 2X1EA 4LLLA 4F3QA 4EV0A 3BROA 1TC3C 2FBKA 4ZYGA 1S29A 4NHJA 5FKKA 3HTUA 4B48A 4Y13A 1JGGA 2E60A 1ITYA 1BIBA 3CO7C 3BOQA 1VFCA 2ZC2A 3KETA 4RLFA 2OA4A 3KEYA 2M4GA 1FP1D 3MEKA 4XRSG 2Y9YA 4KNYA 3CUQB 3L2CA 5KJLA 1H0MA 2HYJA 2XF7A 4BS9A 2M7BA 5F0CA 2GXBA 3G71I 4WXHA 3S1NJ 3GXOA 4NUBA 2FEZA 1ZRCA 3D5LA 3F8NA 3DWLE 4AVZA 4BEHA 3AG3H 1I1SA 4KT6A 1JI8A 3KEOA 2E71A 2AXLA 4UV8A 1I3AA 1WH7A 4IF4A 1KA8A 3DALA 2WWYA 2E34A 3DFGA 2IA0A 2QBYA 3I4NJ 2EZIA 2ZXHA 1MBHA 4EQQA 1Z7LA 2UWMA 3LQRA 5D4RA 2ZB9A 1N3JA 2EFPA 3BR6A 4Y15A 2E7XA 5GPCA 2IW5A 1IF1A 3HJEA 3OYBA 3G2BA 1OISA 3VYSB 1Z3YA 3NRVA 5M5XJ 4XKCA 1TNTA 1NTCA 3WGGA 5IOZA 2ESHA 3HOXJ 2R7FA 2XGCA 5IP9J 4O6JA 3AG1H 5KJMA 1BI3A 1WQ2A 4YRVA 1EA3A 5LHIA 4M6XA 3S7FA 1VQ4I 1MZBA 3I0TA 3H3ZA 4M9SA 3WTTC 4I99C 2M2EA 2OQRA 3MKZA 4O3MA 1MUFA 2ZFWA 5C44J 3JRAA 3BZCA 4PJMA 1LQ1A 1HC8A 3F8MA 2M5WA 1IDZA 2HXIA 4H12A 1SC7A 2OD5A 4XQFA 2CO5A 4A5NA 1WJ5A 2K4JA 2LD5A 1BA5A 4U88A 5FD5A 3L09A 3D5SC 2LLKA 3ZCOA 2RC4A 3M1CA 4UV9A 5HLTA 2EFQA 2BY0A 3QU3A 3T5XA 1BOBA 3MO5A 3LSIA 4I09A 4F7ZA 3QQAA 3TDUC 3QWPA 1IJWC 4Z2YA 5E3LA 4QIWN 1FSHA 1QQIA 3CESA 1Z3XA 2LKPA 4CICA 2JA5J 2VJ4A 5D8LB 2DK5A 3BJ6A 2KRCA 4RGUA 1F43A 4C3IJ 3KP3A 4B4CA 3PIPF 4KJZA 3MD2A 2RV8A 3BCBA 1FMVA 3OPEA 2M87A 2DQLA 2XAQA 2OU2A 2E2HJ 3BCAA 3GTMJ 3KCCA 3B73A 4BXFA 3U2RA 1YITI 1D0YA 2IGNA 1R58A 4X1EA 3WE3A 2XAUA 3BTIA 2UZKA 1HW2A 1T0FA 3F8FA 4C3HJ 4FHTA 4AUXA 2FNPA 4RGRA 3WU1B 3BR0A 5KVRA 5EX0A 3CUQC 2PJRB 2N8GA 2R7WA 3PL8A 4ZZLA 2EFWA 3CBMA 2ADUA 2L7MP 3J81Z 2CQNA 1K78A 1BI2A 1ZR4A 4JX6A 3V8LA 1WJAA 2L7FP 4M3BA 4U87A 1QNTA 3PUBA 5LGNA 2K3PA 3EQLF 4KT5C 3JSOA 2VT2A 4KICA 2QVOA 3FM5A 4J7IA 3HPGA 4E7ZA 1TZLA 3I71A 2QA4I 4WCGA 5KJNA 4XRSA 1OFCX 4XM3A 2R3SA 3OYGA 1MJBA 2ZBKA 1IXSB 1HKTA 2WADA 3VSLA 2IJLA 4IEJA 1HA8A 2LYCA 2HVRA 3JW4A 1QZYA 3HSFA 5HDNA 4FE7A 1U5TA 3BP8A 4AIHA 5TJJA 1R36A 4AC0A 1O57A 4M3DA 1FIPA 4A3EJ 4IOAF 4EEFG 2IRFG 2F2EA 3F8CA 2QWWA 2WAFA 2VE8A 3O2PE 2XKPA 2MABA 3FDYA 4EM1A 1SANA 1L3LA 2VPLA 3IHXA 3KLNA 2P6SA 5ARFA 5ICFA 1SVLA 1TNSA 1IN8A 2YU3A 3M8FA 5HOOA 3ISPA 3CCVI 2YSRA 1MD0A 1V54H 3Q0WA 1DPRA 1UHSA 1JKQC 1N25A 3RZOJ 2XPWA 5EDNA 2HOSA 2ZMEA 3BQZA 2XGDA 3K9TA 4XSZF 1JKPC 2LH9A 4YEJA 1FIAA 2WB1N 2Y75A 1Y1WJ 1ON1A 2HS5A 5DDGA 1X1CA 1S7AA 1LFPA 4LLGF 4HSRA 3PIOF 5T0MA 2X4HA 2KT0A 3KE2A 1E2XA 1FYLA 3RPQA 4Z6YA 1XDUA 1TWGJ 1W5SA 3JSPA 2KFDA 1V5FA 3G4SI 2F6CA 1RRJA 4RAYA 2ICWG 5CVIA 4KISA 2KP6A 4OIRF 3CCMI 4II2A 3M54A 2CFXA 2VBZA 3FKJA 2XB0X 3RIRA 2R5YA 2P6TA 3MO0A 2H6CA 4PZJA 1OPCA 4A3DJ 3FMSA 3N97A 3BPVA 3O3KA 3HDDA 2ZFUA 3TL4X 4CZZA 2BY1A 3A0BC 3DPUA 2EBIA 3PO3J 3ONQA 2V9KA 4EM2A 3PSIA 2PBIA 1RUOA 2QM3A 2E2JJ 1SEUA 5TGTA 3ERED 1PDNC 2ZO4A 1BM9A 3DKYA 4M6YA 1PJRA 3JAMK 5FLXK 4TV7A 5AYFA 4CZCA 1BJZA 2NNNA 3VYTB 1R23A 3OS5A 2VKDA 3LSJA 5KJKA 1YOVB 4XRMA 1IGNA 1LVAA 3H35A 4ZYEA 3C1DA 4LJZF 4A12A 4IKFA 1IG7A 2MH9A 2WA0A 3GO5A 5J6XA 5EGOB 1W36C 2M0MA 2QEXI 1H9TA 1HCRA 5DTDA 5CCLA 2A68F 1OR7A 4RGSA 5H2FC 3RAYA 1J9IA 4I0BA 2ZXJA 2IS2A 1H8AC 1CGPA 1XQHA 3B6CA 3W3CA 4OIOF 4XRFA 2RAEA 3PNTA 4CXFA 3AKZA 2KIFA 4L9TA 2VB6A 3GW2A 4OOIA 5EJCA 2DW4A 2XGEA 5M3FJ 3LSGA 5CYVA 2DDAA 2VJIA 4BHBA 3BR3A 2VOOA 4BAYA 1BW6A 2M0CA 3JCUC 4ENKA 5FD6A 2Y9ZA 2FJ1A 1YHQI 5D5VB 2RREA 4WXDA 3MQ0A 2KKOA 4BKXA 4YFNF 1RPWA 2DAOA 1SAUA 2PQ8A 1WZ2A 1TTYA 4FMUA 4DYQA 4Y4RA 1OYIA 3O6BB 4C2MJ 2KRHA 1K4SA 1KYWA 1OYYA 1ZN2A 2HTJA 3VPRA 2DFEA 1B72B 2H94A 5BPDA 2IGOA 2QENA 2M1BA 5F6FA 4XLCA 5HVQC 1LFUP 4XR6A 3M55A 1IDYA 4XKWA 2HQRA 3GBGA 1YW9A 3WTVC 4I7HA 3J7ZI 1TWHJ 2AO9A 3EUHC 2L9NA 2JA2A 4PUSA 4NNJA 2F5CA 1JKRC 3QPLA 3CCYA 3RIBA 2JA6J 3P9CA 4CYCB 1MSFC 2CV0A 3HOVJ 4AIKA 3OR2C 1YJWI 2EPFA 2K7LA 4FQGA 2F4IA 4HQEA 2CW8A 4CDGA 2WV0A 2NXNB 2IPQX 3T8TA 2G46A 1HXDA 2HFHA 2XGXA 4N9HA 2F5FA 1YX3A 3JRCA 1WJFA 3SEQA 4P1WA 4D7NA 1X2MA 1ZLKA 1ODDA 4IQJA 1X58A 2LSOA 1VTNC 3BC8A 3V8KA 3QPSA 3K70D 3C2BA 1FOYA 3FK7A 2E5ZA 2MGQA 4KIGA 1RC9A 1FT9A 1OCRH 1UZCA 4C3JJ 2V6CA 5TEGA 2LBFB 1A6QA 5TISC 5IT3A 4UVCA 4OINF 3ZXSA 1TQMA 3Q9SA 5F0HA 1SD5A 4ITVA 1XDSA 3DP7A 5J8CA 4H0EA 2JQ7A 4ZTFA 2DMPA 2J5PA 1X3ZB 2LVSA 4PJLA 4HNVA 1FWZA 4RB2C 4KA4A 2NVUB 5D4SA 1ZGWA 2IGKA 2PMUA 4PDKA 1SD7A 2L5QA 3FXKA 2DDBA 1XSXA 3VUZA 2J5OA 2Z2SB 2M45A 5FRMA 1LPQA 1SMYF 2L9RA 5HNHA 4HQMA 3KMAA 2JMWA 2PJRA 1IN5A 4O6FA 5LHHA 5K5OA 1IUYA 3DBHB 5D6EA 4GGGA 2BE5F 2EV6A 3P5JA 2JA7J 1VNDA 2DU9A 4NC7A 4DQ2A 3SFIA 1I1GA 4DOZA 2QSHX 4EGYA 5F1RA 3HKZA 3ZMVA 3IKTA 3AG2H 1HLVA 5EX3A 5BQTA 4M71A 5H6RA 5DM7F 3LA7A 1HW5A 4L18B 3S2WA 1WJCA 3BLYA 1G4DA 1XSDA 2ISZA 1Z1DA 2JWTA 5J4VA 1O4XA 5FROA 1D0ZA 2A69F 3SZGA 2VOPA 1ERDA 5FO5A 1UB9A 1OMIA 2QZ8A 3BTJA 1TBXA 1MNDA 3K4CA 1D1CA 2A5YB 3S7BA 3JRGA 3HOTA 4OIQF 3L7WA 2CFOA 5DM6F 1U3EM 1OJLA 3KP4A 1LDKB 4L9JA 3W6KB 1ZR2A 2HR3A 2BVLA 2KMUA 2HPMA 2PFBA 3V8JA 3SQNA 2YX4A 4G6QA 2HEOA 1ENHA 4MFDA 1Y0UA 4A69C 5F59A 1OCZH 4MEYF 4AIJA 2VQGA 1B4AA 3VDXA 4BBRJ 1X1AA 3OYJA 3PM1A 1Y6IA 4QPQA 4LGWA 5CJ9A 2K9QA 2HDCA 4BBSJ 2GZWA 4R1HA 3VB2A 2P5VA 5F64A 1FZPB 1ZQ3P 2I10A 2HOEA 3HGYA 4WK8F 3EUAA 2I8DA 3G3ZA 1YFHA 1E0EA 4XLHA 5EZHA 3FMQA 4J19A 1BC7C 5FKMA 4EJTA 3OIPA 4XN3A 1KQ9A 2ZNZA 2L9VA 3KYDB 2DBBA 1QHGA 5CVVA 5LBQA 4G94A 4DGWB 2MLGA 1MVXA 2PG4A 2LY1A 2BYVE 1DP3A 1G2HA 3HKZN 1GVJA 3L9FA 3PQJA 4LLNA 1QZZA 2GIZA 1IAWA 5LSXA 4YIRX 4JYKA 4ZYHA 5JINA 3E5QA 5EEAA 4AU7A 5F1JA 3S3OA 2NVXJ 3F6VA 1PUFB 3H5AA 5D5UB 1GVDA 4QWQA 1JJ8C 1J75A 2STTA 3TP0A 3RCOA 2A6HF 2XRNA 3BR2A 2WY7Q 3CO6C 3V7CA 3S32A 3ZMTA 2IP2A 3QYBA 3E6BA 2QCOA 2L7KA 3ASNH 4G9YA 4BJ5C 1LB2A 2ZJRF 2VJJA 3ZOBA 3NAUA 2P0WA 3DEWA 3M59A 2F69A 4C2UA 1JTXA 1YJNI 1MBEA 3IWZA 4BACA 2A3SA 2JA8J 3KPHA 1W7PB 4HX8A 5K7FA 4D9JA 3OIQA 2IBDA 5KK1A 4ZDPA 3CC2I 4KYWA 3SHFA 3VFZA 3ESWB 3VYUB 1IV6A 4AM3A 1R00A 3VEPA 1R5HA 2D1VA 2EA4A 1HW1A 1EV7A 4DYCA 4IJ8A 1PEGA 2ME6A 4R8HA 2W7NA 1X2NA 1YX5A 1FBUA 5E1ZB 4GYIA 1Z05A 3G1LA 3RTRA 2VONA 3I5UA 3CMMA 3RPUA 4J7FA 3CJNA 3HNAA 4YPUA 5LSZA 3HOUJ 1TWAJ 3TO7A 3ZQCA 3CC7I 5D5XB 2E1NA 2OJED 3DTKA 2YX7A 1FYKA 3IV5A 5F08A 5EGOA 2HYFA 4U0YA 2ZKZA 4RDUA 3I58A 1F36A 2DQRA 4B43A 1TT0A 3VOEA 1Z7UA 1LEAA 1BJAA 3CCRI 1BR1A 4F92B 2XIGA 3OY9A 1J5YA 3QYEA 3K4BA 3CDIA 3HRUA 3FXRA 5JHUA 1OCTC 2VC1A 2ECCA 3FHZA 1VQ9I 1UG0A 3I4MJ 3PFYA 4AD9A 2DFFA 4M74A 1D5YA 2FA5A 1IN4A 1P4WA 1V5GA 5AONA 3OXFA 4A6DA 4DYRA 5ICCA 3WTYC 4FCYA 3R0JA 2XC7A 4P9UA 1TWFJ 3D0SA 2H1KA 1J2XA 4FE4A 3DTEA 2VN2A 4EATA 3ZQIA 1B9MA 3RYPA 1YRNB 5DV5A 2C6YA 3QPTA 2EA2A 4M3FA 4XN0A 3Q3SA 1G3YA 4Q5SF 2Z3YA 2Y0SN 1B72A 2DLLA 2ZXIA 5CQEA 1P7JA 2EV5A 3MAJA 4FETA 3OYDA 3SXYA 5B1BH 2K86A 3WODF 3HUGB 1YG2A 3QOEA 1QGPA 2KIMA 1W0TA 2IVMA 2EB7A 2IGMA 3JAMZ 5FLXZ 3WHCA 1D8KA 1MGTA 3K1PA 4E4HA 4MTEA 3WU2C 2DFHA 2OBPA 4EMSA 4CYCA 1FTTA 1SVMA 3GYHX 2BZTA 1OCCH 3EUKL 4F93B 2M8EA 3KZYA 2V6EA 4MEXF 5HI7A 1HSJA 1LKXA 3F9KA 2XVCA 3ABKH 4DZJA 3FK6A 2B63J 2OC6A 3S93A 5IYCJ 3ABTA 1OCOH 3WTWC 3CCSI 1AOYA 1IXCA 4BGDA 3HHHA 1I39A 3OL4A 4Q48A 1D0XA 3R61A 3HHGA 1I6XA 1RZ4A 2KL4A 4KUMA 1DPUA 2ESNA 5C3EJ 3M7GA 3DPLC 5HODA 1LE8B 1OQYA 4BY1J 5ILVA 2MD5A 2XV4S 4AYBA 1P9QC 2DO7A 1G3SA 2ELJA 1DDNA 2ZCWA 4YELA 1FY7A 2R7ZJ 2CGPA 4YNDA 1PVEA 1KYZA 2L02A 2LBFA 2Z99A 3GFLA 2X6WA 2E35A 3F72A 3Q0VA 2BOLA 4HLXA 5FFXA 1T95A 4U0VA 3BG9A 3CF5F 1ETKA 3N05A 4L9VA 2CUJA 5HLHA 3TGNA 5B1AH 3I53A 4O5VA 1WRJA 3BT9A 4N4NB 1K61A 4XNFA 4CUGA 1H3IA 3F6OA 5K5QA 2Y48A 3DTIA 5FGMA 1R9TJ 1ONVA 2JRMA 3CUOA 1FOKA 4QEOA 5L3FA 2DN0A 3PFIA 1BN5A 3OS2A 1MMGA 2XAHA 2LREA 5K7ZA 4Q4ZF 3F9WA 1ZH5A 4ESFA 2K3FA 4XBFA 2XROA 1O7LA 1XMXA 2EFNA 2AHQA 1WWXA 2PMHA 2Y2ZA 3ZMUA 4RGXA 4LG3A 4KFCA 1F9NA 2GXGA 4JBAA 4J01A 1IRZA 1MBFA 2JPBA 4BY7J 3OYAA 3N4MA 3TQNA 4F55A 1EF4A 1Z67A 2QUFA 4HLYA 3PDNA 5DCFA 3V7SA 2Q2EB 3QP5A 2EFOA 4DNCA 5JFRA 4MI5A 5L3CA 2XB5A 1KU2A 3OWTA 5FB2A 2LF7A 4S04A 3NARA 4PK4A 4GXOA 2CS3A 2VIXA 3CP8A 1IW7F 1ZK8A 2W84A 3K2ZA 1T33A 2GM4A 2QQBA 5DYMA 2X6OA 2W4SA 4AYBN 2MFZA 4W1UA 4RA2A 2O7OA 5LHGA 1ZYRF 2OF7A 4OIPF 1ZLJA 3IKVA 1MDMB 1PUEE 4IRGA 1VQLI 5EG0B 1BC8C 4BH9A 2L54A 5CPRB 4K2EA 4PFOA 1GHCA 3D1NI 5T5GA 2LRDA 1QVUA 2DXIA 4JDSA 3C7JA 2ID6A 1J09A 2DA4A 4LD5A 4OAZA 3RSNA 2OZUA 2Q0OA 4RAGA 3S1RJ 2QKLB 5E1XA 3S16J 1GV2A 2XSJC 4FX0A 1YLFA 2ECBA 1MT6A 3ROUA 4AWXB 3HC7A 2W1OA 4IPAA 4BQNA 1BI0A 3RQIA 3LMMA 2WB1A 4OU0A 1GDTA 3QYFA 2OZ6A 3HGGA 1R6RA 1ETQA 4XKVA 1LFBA 4HAMA 4BDZA 4Q47A 4BQOA 3U21A 3K4JA 3T1BA 2LKSA 1VQKI 4BL0B 2CW7A 2P81A 1ACIA 2B7EA 5IYBJ 4YIFA 4MQ9F 2OV7A 1F1ZA 1FNNA 3NWTA 3S8PA 3ZP5A 3GTKJ 3GTGJ 3H9JA 1BBYA 3OS0A 2Z9OA 2PX9A 1STZA 5DEQA 1ON2A 4HV5A 2XAFA 5BNGA 2FD5A 4YFKF 1AHDP 3UNGC 4CH7A 2HNHA 1PUFA 3ZMZA 4IZZA 4RBOA 1EH6A 1YIJI 3OXLA 2FMLA 3AL0B 1Z0XA 4NDLA 2L4MA 4EJUA 4HZFA 5LRSA 3O8GA 5A2QK 1N77A 4Y52J 2V9PA 2TRTA 2G7HA 1A6IA 1MBJA 4RAFA 4RB3C 3M07A 5J1YA 2IS6A 2XAGA 1JUSA 2JVGA 4C2TA 3BPXA 3K4NA 1DGWY 2O61A 1W7PA 4ZC3A 1S9HA 1ML9A 4XOPA 2K02A 3CCUI 1SFXA 4G7ZF 1LNWA 2KHMA 5LEKA 2VC0A 2D5VA 1JGSA 2FRHA 2XF6A 4ZDOA 2K9NA 4F52A 1D1AA 2GXAA 2CH0A 3DQVC 1W7PD 2YR2A 1E17A 3ABUA 3FF5A 1TW2A 1XCVA 3SDBA 3TEDA 2DJIA 4NJ5A 4WXCA 1FYMA 1ZGAA 5HDKA 2NNYA 2CRGA 4QENA 2XSDC 4I98B 2P5LC 2JK3A 3WGHA 1D1BA 2W00A 2LFBA 3H9QA 2QSFX 3HIFA 3UR3C 3BDDA 2DI3A 3FIWA 2R3AA 3HRMA 4UY8I 4EVIA 4A0YA 2O5RA 1O3SA 5BMZA 2VQCA 3OOUA 1XSVA 4YPAA 5L3EA 3DBLB 4X6AJ 3ZRGA 4CGZA 2P4WA 1FPQA 3CP2A 1JE8A 1AA7A 3JR9A 4RB1A 1AKHB 5JIYA 3C18A 4F91B 5E18F 3IRRA 1TLHB 1B9NA 3KZZA 1GLNA 4D1QA 1X4PA 3JREA 3HM5A 4XL9A 3HYIA 3QP6A 2MBFA 3GF2A 5CVUA 5GAGJ 3C2HA 2XRLA 3BO5A 2CSOA 3E6CC 3M56A 5E1WA 1RETA 4BHPA 3UKGA 4LOCA 3L1PA 3FISA 3MZYA 4BXXJ 1MMNA 3AAFA 2K85A 1YS6A 2RQQA 3P7NA 4PFPA 3KEQA 5E3NA 1SD4A 2CU7A 2LKXA 1MIJA 4NQWA 5GTIC 3SWCA 5IOYA 1DGRM 1MBKA 2K40A 2P5KA 3OYKA 1WJEA 1FBSA 1IRXA 3ZMSA 1U9OA 4CCLA 3BG5A 3GWZA 2BQZA 3C2GA 1IRGA 3QWVA 2WTEA 3LA3A 1BL0A 2E1OA 3KP5A 2W85A 3AL0C 3HBLA 5EG2A 3W2AA 4J83A 4LG0B 1V5EA 1OLTA 3RKYA 2JN6A 1FLIA 3ZN1A 1MW7A 2KZVA 3CUQA 4L0ZB 2R7VA 5DUIA 2R7UA 3J7AO 1R71A 2HDDA 2RFIA 1GXPA 4P96A 2JJ7A 5FKLA 4GFBA 3ABLH 1ZKKA 1ETYA 4E7IA 2W25A 3A01B 1LE8A 2PJPA 1GUUA 1B59A 2L0KA 3JTHA 1HDDC 4BQAA 2ZJPF 5KHDA 1G8XA 4CHUA 3QWWA 4BDYA 1REPC 3HOWJ 1MMSA 2DOAA 5JJ0A
chains in the Genus database with same CATH topology
4B48A 2BW3A 2E60A 1X1BA 4XOTA 4LIUA 4HPQA 1DQUA 4G6TB 3BG7A 4RLFA 3F9XA 3KEYA 2R4GA 2M4GA 3EUAA 2I8DA 3HPHA 3MEKA 2AQEA 1E0EA 2QPWA 2F5VA 4XLHA 5KJLA 4E7JA 2XF7A 4BS9A 5JHNA 2M7BA 3OIPA 4XN3A 3S7JA 4PSXA 4NUBA 2ZSHB 1QHGA 3D5LA 4BEHA 3DWLE 4AVZA 4DGWB 1MVXA 2LY1A 4KT6A 2X1CA 1DP3A 1JI8A 5LSXA 2WBMA 3K70C 5JINA 4AU7A 3S3OA 3H5AA 3DALA 3EP0A 5LD2C 3RCOA 2WY7Q 2ZXHA 3K10A 3S32A 2XDVA 1Z7LA 3QYBA 3OYCA 2UWMA 4IX7A 2L7KA 3DLAA 1N3JA 2X6YA 3H5NA 4BJ5C 2W5ZA 2VJJA 3L2RA 2P0WA 3OYBA 3M59A 2UUZA 2F69A 3G2BA 1G59A 4C2UA 3VYSB 4BACA 1Z3YA 2E1MC 4XKCA 4D9JA 3OIQA 4QEPA 4ZDPA 3RU0A 3VYUB 3W2VA 3EPZA 4E47A 5KJMA 2VJ5A 3OYIA 4YRVA 4IJ8A 1EA3A 4XLFA 2JSPA 1PEGA 2W7NA 3DPTA 3S7FA 1YX5A 3PNYA 4CA0A 2WAEA 3RTRA 1LVKA 3CMMA 3MKZA 1MUFA 3CBPA 4J7FA 4YPUA 3HNAA 4PJMA 5LSZA 1U0JA 4YPEA 4H12A 3DTKA 3VYRB 4R79A 4XQFA 1WJ5A 3H9GA 3F9ZA 3MKYB 4B43A 1TT0A 1KONA 3D5SC 3MMYB 3LSHA 3ZCOA 1YE9A 3M1CA 5HLTA 1MNEA 4HSTA 1BR1A 4F92B 3MO5A 2V4JC 1BOBA 3MO2A 3LSIA 3OY9A 3QWPA 4IJDA 3QYEA 2X1DA 3K4BA 3HG9A 1UG0A 3OMYA 3CESA 3PFYA 1Z3XA 3TG4A 2ZSIB 2VJ4A 4B44A 3TG5A 4BUPA 2KRCA 2BVMA 5F6LA 1V5GA 3LSKA 3OXFA 5HQ8A 4KJZA 3OYFA 3MD2A 3ZQQA 3DU5A 3BCBA 1FMVA 3PSFA 4IQ4A 3OPEA 4I51A 1MMAA 2XC7A 3BCAA 4E7HA 4BXFA 3D5RC 3DTEA 4EATA 4HNTA 1D0YA 2IGNA 4XN0A 2XAUA 4ZDLA 4BE0A 3HOSA 4HEA2 2ZXIA 5CQEA 4C1QA 4RM3A 3N71A 2NOJB 4FETA 2PJRB 3OYDA 5EX0A 2R7WA 4LITA 4ANJA 3PL8A 3CBMA 4HNUA 3HUGB 2M7AA 3K5KA 2K9MA 3QOEA 4GRIA 4ZYAA 1W36D 2V1NA 4PJNA 3DB5A 1WJAA 4U87A 3PUBA 4BU2A 2IGMA 5HNFA 5KNLA 2K3PA 1ZELA 4E4HA 4KITB 2VLAA 4J7IA 2VASA 3HPGA 4II3A 4E7ZA 1QU3A 3KYLA 1TZLA 2LOOA 5KJNA 3K6GA 3M53A 3H0DA 3EUKL 3TBIA 4F93B 2V6EA 2DT6A 4XM3A 3OYGA 2IS4A 5HI7A 1LKXA 2X6XA 3F9KA 3OXGA 2WADA 3VSLA 3OL3A 4YNPA 4CCMA 4B47A 1HA8A 2LYCA 3IAM2 2HVRA 2OC6A 3S93A 3W2WA 1FMWA 1MVHA 2UV1A 2V7FA 4BGDA 3IP4B 3OL4A 5LFAA 1D0XA 3BG6A 3AFHA 2JUGA 4MI0A 2LG4A 2KL4A 2K5CA 2WAFA 3DPLC 2MABA 3FDYA 4E7LA 4AYBA 1P9QC 2VPLA 2JVHA 3IHXA 2ELJA 2HPIA 3ZR8X 5ARFA 4YELA 3E0JB 2RNGA 1K6YA 4YNDA 1NG7A 5HOOA 2LBFA 3KX2A 2X6WA 2BOLA 1T95A 1PYVA 3L2QA 3OYMA 3N05A 4DBRA 3J7AY 2CUJA 2BW3B 1SFKA 2Y0SA 3FPDA 1WJDA 2FUG2 4N4NB 4XNFA 2LH9A 4CUGA 1H3IA 2OUMA 1Z21A 4E7KA 3A2KA 1Y56A 3DTIA 4YEJA 4BE2A 4QEOA 1X1CA 2KDOA 1LFPA 4HSRA 5T0MA 3VWBA 3OS2A 1MMGA 4HRIA 2XF5A 4BEHB 2LREA 3OYEA 3F9WA 1QHHD 1N75A 4QPOA 1V5FA 2F6CA 4KISA 3IAS2 3OR1C 3S3MA 3DKXA 4LG3A 2KP6A 2HZDA 3DEEA 4DJAA 5TTFA 2Z1DA 4II2A 4RM2A 3M58A 4JQFA 3M54A 3QODA 3FKJA 4J01A 2K9LA 4O30A 2VXZA 3OYAA 3MO0A 4B3XA 4MLOA 4F55A 4CCJA 3PDNA 2VL8A 4Y3OA 2Q2EB 4MI5A 2ZFUA 3TL4X 4X0GA 2CMPA 3OWTA 3RPUD 2R7TA 2HU9A 3DPUA 4PK4A 2VXDA 3ONQA 2V9KA 3PSIA 3K4KA 4XONA 2CS3A 2VIXA 4BJ6C 3OYHA 3CP8A 5TGTA 1N78A 4C9YA 3DKYA 2W4SA 4WUYA 1PJRA 1X19A 2MFZA 2CUZA 5FRNA 2IXSA 2L2OA 5AYFA 4CZCA 3M57A 3VYTB 3OS5A 4Y33A 2X51A 2VKDA 2KLOA 5KJKA 5CPRB 4PFOA 3H35A 1NG6A 3KMJA 4E7SA 5T5GA 2LRDA 2DXIA 4JDSA 4NC8A 4NVQA 4IKFA 1J09A 2LC2A 2WA0A 3FBIB 4OAZA 2A5WA 4C30A 3RSNA 1N6AA 5CCLA 1W36C 4OWRB 2M0MA 3A4CA 2QKLB 2LY2A 4PSWA 4RMNA 2XSJC 3RAYA 1T0FC 4U7BA 2IS2A 3SW9A 1MT6A 1XQHA 3HC7A 2W1OA 3W3CA 2HVQA 4BQNA 3LMMA 2CV2A 2WB1A 3QYFA 1X1DA 2DCEA 3PNTA 1R6RA 4XKVA 5F6KC 3AKZA 2VB6A 3MKWB 4BDZA 4BQOA 3CBOA 3LSGA 3RQ4A 3U21A 3K4JA 2VJIA 1MMDA 3L2UA 2R7SA 4BL0B 2CW7A 2RREA 1BR2A 4N4OB 2JV0A 3S7DA 2OV7A 1SAUA 3NWTA 4XORA 3S8PA 3H9JA 3OS0A 4FMUA 4Y4RA 4HG2A 2KRHA 4JOMA 3UNGC 4CH7A 2HNHA 4IZZA 4FASD 4XLAA 2IGOA 1N6CA 3M5AA 3OXLA 3CF2A 3AL0B 2Z16A 4XLCA 5HVQC 4XR6A 2KPMA 3M55A 4XKWA 3GBGA 3HXLA 1N77A 4Z4PA 3OOIA 3LSMA 2IS1A 3EUHC 4XMYA 3OYNA 3A1YA 2L9NA 2JA2A 4PUSA 4NNJA 2IS6A 3KMTA 2W82A 4ZJZA 2JVGA 3LFUA 3I9V2 4C2TA 3K4NA 1DGWY 4BQQA 3RIBA 2HVSA 4ZC3A 2X85A 1S9HA 2R7RA 1ML9A 4XOPA 2CV0A 5ARGA 4LDGA 3RJWA 3OR2C 2R7OA 1UELB 2KHMA 5JHFA 2R7XA 2F4IA 2CW8A 5CCMA 3TMOA 3HL2A 2XF6A 4ZDOA 2G46A 4YNMA 4F52A 1D1AA 1YX3A 2CH0A 3DQVC 1WJFA 3LL7A 4DIQA 3SEQA 4P1WA 3SDBA 3E1SA 3FHNA 4IQJA 2DJIA 2QKMB 2W5YA 4NJ5A 4BE1A 3BC8A 2Q1ZB 3K70D 4QENA 2HQAA 3I3LA 4PJJA 4LIVA 2E5ZA 2PMZA 4XKBA 1D1BA 2W00A 3H9QA 3M8JA 3UR3C 3H5RA 2R3AA 2O5RA 2V26A 2R7QA 5TEGA 2VQCA 3K4LA 3OOUA 2LBFB 1UAAA 2O8JA 2MD0A 4YPAA 3ZXSA 3ZRGA 4ITVA 2HDWA 1VZ0A 2L9SA 4CSWA 3CP2A 5CQGA 3F9YA 4ZTFA 4PJLA 5TH7A 1AA7A 1BR4A 2MYSA 5JIYA 4F91B 2IGKA 2VQLA 3OYLA 1GLNA 2DT7B 2E5NA 2L5QA 4D1QA 3PJRA 1X4PA 4OAYA 1O9SA 4XL9A 4CCKA 3VUZA 3DU6A 4E6KG 3SYTA 4RZ0A 2Z2SB 4DBQA 3C2HA 4CCOA 3BO5A 5FRMA 3M56A 5HNHA 3CJQB 3KMAA 4CCNA 4O6FA 4XLEA 2PJRA 1MMNA 2MC4A 2RQQA 2GOXB 3NWSA 4PFPA 5KCMA 2IGQA 2AQFA 2E1MB 5F5EA 2CV1A 4ZTJA 3SWCA 4NC7A 1DGRM 3IUOA 4RLQA 4JLGA 4BJTA 3FBNB 3PNVA 3SEZA 4DOZA 3OYKA 1WJEA 1IRXA 3HKZA 2VKHA 5CKTA 4CCLA 2BQZA 5EX3A 3C2GA 3ZGKA 3QWVA 2M3AA 2VQHA 1WJCA 3BLYA 1OR7C 3L2WA 3AL0C 5T0KA 3S3NA 5EG2A 5FROA 1D0ZA 3V42A 3OS1A 3W2AA 4J83A 1WFXA 3SZGA 2KQRA 1ERDA 3CZ6A 1V5EA 1OLTA 1X4OA 2M4KA 1MNDA 3K4CA 1D1CA 4H4KC 3S7BA 3HOTA 1MW7A 2KZVA 2WY8Q 2A6TA 3K4MA 2R7VA 2CFOA 3VV0A 2R7UA 2GOMA 1LDKB 3VSKA 2RFIA 2WAQA 2BVLA 2KMUA 2HPMA 4J00A 1ZKKA 4E7IA 4P5OA 4NQWB 5F59A 5KHDA 1WJBA 2VQGA 3VDXA 4J8OA 1G8XA 3QWWA 4BDYA 2X1EA 3L2VA 3CJRB 1X1AA 4F3QA 3OYJA 2DOAA 1Y6IA 4QPQA 5JJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C1Q A;  2W5Y A;  3N71 A;  4NJ5 A;  5EX0 A;  3F9X A;  3CBM A;  4QEN A;  3MEK A;  2QPW A;  3K5K A;  5KJL A;  4WUY A;  5JHN A;  5AYF A;  3M57 A;  3DB5 A;  3S7J A;  2R3A A;  3OS5 A;  5KJK A;  5TEG A;  1MVX A;  5CPR B;  2O8J A;  3KMJ A;  4J7I A;  4YPA A;  5T5G A;  5LSX A;  4JDS A;  5JIN A;  4AU7 A;  5KJN A;  3M53 A;  4NVQ A;  3DAL A;  3F9Y A;  3EP0 A;  5TH7 A;  1N6A A;  5HI7 A;  5CCL A;  5JIY A;  3OXG A;  4YNP A;  3RAY A;  1O9S A;  3SW9 A;  1MT6 A;  1N3J A;  3VUZ A;  1XQH A;  1MVH A;  2W5Z A;  4RZ0 A;  3BO5 A;  3M59 A;  2F69 A;  3M56 A;  5F6K C;  4MI0 A;  3KMA A;  4O6F A;  3CBO A;  3RQ4 A;  4QEP A;  2IGQ A;  3RU0 A;  5F5E A;  4E47 A;  5KJM A;  3IHX A;  2JV0 A;  4IJ8 A;  3S7D A;  1PEG A;  3SWC A;  5ARF A;  3S8P A;  3S7F A;  4JLG A;  4FMU A;  4YND A;  1MUF A;  3CBP A;  4J7F A;  2BQZ A;  5EX3 A;  3HNA A;  4YPU A;  5LSZ A;  3QWV A;  4YPE A;  4H12 A;  5T0K A;  5EG2 A;  3FPD A;  4J83 A;  1N6C A;  3F9Z A;  3M5A A;  3OXL A;  3M55 A;  1H3I A;  3S7B A;  4Z4P A;  3MO5 A;  3OOI A;  3MO2 A;  4IJD A;  4QEO A;  3QWP A;  5T0M A;  3VV0 A;  3KMT A;  2RFI A;  3TG4 A;  3F9W A;  3TG5 A;  3RIB A;  4BUP A;  1ZKK A;  5F6L A;  5HQ8 A;  3OXF A;  1ML9 A;  5ARG A;  3OPE A;  4LDG A;  5F59 A;  4I51 A;  5TTF A;  3RJW A;  3M58 A;  4O30 A;  3M54 A;  4J8O A;  3QWW A;  3MO0 A;  5CCM A;  3PDN A;  2G46 A;  5JJ0 A;  4MI5 A;  4YNM A; 
#chains in the Genus database with same CATH topology
 2CQK A;  1ZRF A;  4U0W A;  4XOT A;  5HLG A;  1X1B A;  5HLI A;  2GA2 A;  3CTA A;  1UHW A;  2FU4 A;  2O0Y A;  3K2A A;  3CCE I;  3S1Q J;  3F9X A;  2R4G A;  3FM3 A;  3H0G J;  1YTY A;  1YIO A;  4M3G A;  1R7J A;  2HQ5 A;  3ZQF A;  5JHN A;  3CDH A;  5EYR A;  4CYD A;  1BIA A;  4A93 J;  3S7J A;  4PSX A;  3ELK A;  2DK8 A;  3FXL A;  4ESB A;  5J1U A;  2FNA A;  1B8I B;  2X1C A;  2EZK A;  3RKX A;  2JT1 A;  2P7V B;  1SFO J;  4I0A A;  3CME I;  2JRT A;  2JZY A;  3TKY A;  5HS9 A;  3DEU A;  3JRF A;  1T39 A;  3OYC A;  2XDV A;  1FEX A;  4IX7 A;  2Q2E A;  2X6Y A;  3J7Y J;  4KIF A;  3L2R A;  4ENN A;  3I56 I;  3F22 A;  4WWC A;  2GLO A;  2VBW A;  1A04 A;  2UUZ A;  2X48 A;  1G59 A;  2DMN A;  2FX0 A;  1FP2 A;  3W6J B;  1EH7 A;  2H8R A;  1XPX A;  4L5I A;  3RU0 A;  1KU7 A;  3W2V A;  3EPZ A;  4E47 A;  1YW7 A;  4A3M J;  2H8W A;  2VJ5 A;  3BZK A;  3OYI A;  2HGC A;  3BZ6 A;  2F4M B;  2JSP A;  1FX7 A;  1MDM A;  2BHY A;  1B1B A;  5J40 A;  2O8X A;  3PNY A;  1CQT A;  1VQ5 I;  1LVK A;  4ABZ A;  3NQO A;  2LDU A;  4A3L J;  2VI6 A;  3WTX C;  3VYR B;  4KDP A;  4LB5 A;  3ZPL A;  3MKY B;  2A05 A;  2Q8K A;  4IHW A;  1KON A;  3LSH A;  3I54 A;  3ECO A;  1LDJ A;  2KJC A;  5KAF C;  4UXN A;  3K69 A;  2LY9 A;  2QQ8 A;  2V4J C;  1VQP I;  2VUM J;  5D5W B;  1NK3 P;  4A3C J;  2X1D A;  3G1O A;  3LST A;  1FBQ A;  3LAP A;  3IHU A;  3TG5 A;  4BUP A;  1DP7 P;  3FXJ A;  2BVM A;  3IH3 A;  1P92 A;  2VBX A;  1KU9 A;  3LSK A;  3G6E I;  1J7K A;  3OYF A;  5HQ8 A;  3PSF A;  4IQ4 A;  1YS7 A;  4I51 A;  2GAU A;  2CG4 A;  1IC8 A;  5E8G A;  2RQP A;  2OAZ A;  3HRT A;  2RVC A;  3OIO A;  4E7H A;  2D2W A;  1EH8 A;  2BXZ A;  3D5R C;  1K79 A;  3CC4 I;  4HNT A;  3A02 A;  3KP6 A;  5F04 A;  4ZDL A;  4BE0 A;  4HEA 2;  2EIJ H;  2AXT C;  2EIK H;  2FQ4 A;  4MTD A;  5CVR A;  3GLX A;  1VQ7 I;  2M9H A;  3GTJ J;  1DU6 A;  4HNU A;  2VKE A;  3JRI A;  2M7A A;  1U78 A;  3H3V K;  3K5K A;  2E19 A;  1I6H J;  3ECH A;  4GRI A;  4ZYA A;  3S2H J;  3T0Y A;  1W36 D;  2V1N A;  4PJN A;  3EDP A;  5HNF A;  1T38 A;  2V1U A;  2MG4 A;  5KNL A;  3CCQ I;  1UCR A;  2VPR A;  4LB6 B;  2VLA A;  1ORK A;  3MZ8 A;  4II3 A;  3M9A A;  1T98 A;  3KYL A;  2CWE A;  3E6M A;  1ZG3 A;  3K6G A;  1R49 A;  1XG1 A;  3H0D A;  4HX7 A;  4I02 A;  1P4A A;  2P7C B;  2IS4 A;  1C0W A;  3DV8 A;  1XC5 A;  3DCF A;  3OXG A;  3MEX A;  4YNP A;  1MJA A;  1WCM J;  3WGI A;  4B47 A;  2ACJ A;  4ZZD A;  3I55 I;  1MVH A;  3W2W A;  1FMW A;  2LP0 A;  2UV1 A;  1XGN A;  5M5W J;  5TRD A;  2V7F A;  1D3Y A;  3DKW A;  3IP4 B;  5LFA A;  4B09 A;  3GCM A;  2QQ9 A;  2DA6 A;  3AFH A;  2JUG A;  1T8I A;  2LG4 A;  2COB A;  5B5E C;  2FXA A;  3EUH A;  3H36 A;  1O3T A;  2DJN A;  2H6B A;  3RKW A;  5IP7 J;  4EJW A;  5LGT A;  5GAE J;  5K5R A;  1XD7 A;  2HPI A;  5LLQ A;  1WVR A;  5GTH C;  4HBL A;  1ZGJ A;  4L9N A;  1R4M B;  1K6Y A;  1KU3 A;  1TQP A;  3H92 A;  5M3M J;  1MH3 A;  2B0L A;  4A5M A;  4EGZ A;  1PYV A;  3L2Q A;  3OYM A;  3J7A Y;  4DBR A;  2BW3 B;  1SFK A;  2DMU A;  2QQA A;  2HOT A;  2Y0S A;  5ILS A;  3IL2 A;  1AKH A;  3FPD A;  4HDV A;  2FUG 2;  1WI3 A;  2M30 A;  1SVO A;  3GZ6 A;  1X3U A;  4E7K A;  1Z21 A;  3A2K A;  3QRF F;  3I4P A;  2R93 J;  2W57 A;  4BE2 A;  2DTR A;  2EH3 A;  2KDO A;  5IT9 K;  3VWB A;  3S15 J;  2PN6 A;  4FTH A;  1D5V A;  1K7A A;  3OYE A;  1I5Z A;  2W24 A;  1QHH D;  4QPO A;  3OR1 C;  3S3M A;  1ZRE A;  3DKX A;  2XAJ A;  5E17 F;  4AID A;  4KN7 X;  5TTF A;  2Z1D A;  4O30 A;  4JQF A;  2DYR H;  1SD6 A;  2K9L A;  1MH4 A;  2VXZ A;  4B3X A;  4IL6 C;  5H6Q A;  3MZH A;  1U6G A;  1U2W A;  2CMP A;  3RPU D;  2R92 J;  2PI0 A;  5FKO A;  2VXD A;  2E1C A;  4UB6 C;  3LWF A;  4LG0 A;  2CYY A;  4BJ6 C;  4RB0 A;  1CF7 B;  4V2G A;  3KZI C;  1S7O A;  1X19 A;  2CUZ A;  2KZG A;  2TDX A;  2IXS A;  1X3W B;  2F48 A;  1LDD A;  4I2O A;  3IC7 A;  5FRN A;  3S14 J;  2RGV A;  1O3Q A;  4MNU A;  3U1D A;  4KN4 X;  3PUF A;  1NG6 A;  3KMJ A;  4E7S A;  5IYD J;  3BG3 A;  4IRH A;  4ENM A;  2LK2 A;  3A01 A;  4IJA A;  4NC8 A;  1R5G A;  4NVQ A;  3LAJ A;  3ULQ B;  1S7E A;  1OYW A;  2FE3 A;  2Y69 H;  4C30 A;  1RR7 A;  2A5W A;  2O8K A;  2R5Y B;  1BOA A;  1X1P A;  1Y8R B;  4OWR B;  1TL8 A;  1A5J A;  2LY2 A;  5M5Y J;  4RMN A;  1S8N A;  1XGS A;  5AIP A;  3CMA I;  1T0F C;  4UVB A;  1TW3 A;  5GP9 A;  4U7B A;  2HVQ A;  2VBY A;  3RDI A;  2CV2 A;  4UB8 C;  5C4X J;  2Y30 A;  1R1U A;  2IEK A;  1X1D A;  6PAX A;  5F6K C;  2JUC A;  1YW8 A;  3R60 A;  3I59 B;  3GEZ A;  4L5J A;  3MKW B;  1W5C C;  3CBO A;  1ETW A;  2PMZ N;  5KAI C;  1W1W E;  2FOW A;  2ID3 A;  2R7S A;  4IHX A;  1FOW A;  3BY6 A;  3RI4 A;  1HF0 A;  2V79 A;  3GFM A;  4N4O B;  3S1M J;  2JV0 A;  3S7D A;  1XTA A;  3LQQ A;  4BYY A;  4NBQ A;  5DCM B;  2G9W A;  1F4K A;  5E20 A;  4A0X A;  1B8I A;  1U8B A;  4JOM A;  3JRD A;  2MA3 A;  3ZMD A;  3ZQG A;  3GTO J;  4XLN F;  3B02 A;  2XUB A;  4D7M A;  1XMA A;  4CO8 A;  5J3L A;  4FAS D;  4XLA A;  2KDZ A;  1VQN I;  3F0C A;  2RKH A;  2KPM A;  1U5T C;  1AU7 A;  2VKV A;  2NRA C;  4YII A;  4PGG A;  1T2K A;  2XAS A;  4JP0 A;  2COM A;  4M72 A;  4Z4P A;  1WHU A;  2V9V A;  3LSM A;  3OOI A;  4Y17 A;  1Z9C A;  2IS1 A;  4A3F J;  4XMY A;  3OYN A;  3A1Y A;  2DOF A;  2DA2 A;  2CQ7 A;  3ERM A;  2XKO A;  4ZJZ A;  2CJJ A;  2BHZ A;  1UMQ A;  3MWM A;  4I01 A;  3I9V 2;  1Q1H A;  4BQQ A;  2DMQ A;  2HVS A;  3QWL A;  2D45 A;  2X85 A;  2GQQ A;  2K4B A;  4UUT A;  1E3O C;  1P6R A;  1QPM A;  5ARG A;  4IXA A;  5ILU A;  3RJW A;  1M1E B;  3FXQ A;  3REO A;  4QSH A;  3GZN B;  3KLO A;  3HSR A;  4HA8 A;  4LFU A;  5AIQ A;  3E7L A;  3V7R A;  3HL2 A;  2ZJQ F;  1FOX A;  5GAH J;  4YNM A;  1W5T A;  4QLC U;  2WV1 A;  4XSX F;  3JTG A;  2ZME C;  2MW8 A;  3LL7 A;  4UUV A;  1HKS A;  2IA2 A;  2BV6 A;  3P9I A;  3E1S A;  3FHN A;  4LMY A;  5BPI A;  2O03 A;  4XLP F;  4MO7 A;  3S2D J;  2QKM B;  3G73 A;  1WI9 A;  4WX9 A;  2HQA A;  1XCB A;  4EJV A;  4LIV A;  2YS9 A;  2HI3 A;  4W97 A;  4XKB A;  1JHH A;  3M8J A;  2HKO A;  1QA6 A;  4KMU X;  3HTS B;  1UST A;  5DD8 A;  4GO1 A;  5DD4 A;  5E79 C;  1K83 J;  3WTS C;  1MNM C;  4IRI A;  2HYG D;  2R7Q A;  2WAQ N;  4UUS B;  3K4L A;  2O8J A;  2MD0 A;  4XID A;  3DF8 A;  3SDG A;  3NEU A;  2D1H A;  4P55 A;  2L9S A;  1VZ0 A;  4CSW A;  2FOK A;  5CQG A;  2GBY A;  3F9Y A;  2F5E A;  4B1R A;  5TH7 A;  4YFX F;  1BR4 A;  1R5I D;  5ED4 A;  2EIL H;  1OCP A;  1XMK A;  3GFI A;  2DT7 B;  3DXJ F;  2E5N A;  3PJR A;  3E97 A;  4E6K G;  2ISY A;  2R5Z B;  2ME0 A;  4IHY A;  1R4N B;  4DBQ A;  3F3X A;  3U9G A;  4M6V A;  4A2U A;  3OSG A;  3LA2 A;  2HXO A;  4D5C A;  1LUJ B;  2XPV A;  4I6Z A;  4CCN A;  4FIS A;  2BGC A;  3WG9 A;  1ZRD A;  3SJM A;  3GFJ A;  2GOX B;  3NWS A;  5KCM A;  4ASN A;  2IGQ A;  2E1M B;  5F5E A;  1B6A A;  2ZXW H;  4EM0 B;  2K9S A;  3RYR A;  1Z91 A;  2CQQ A;  1RKT A;  3IUO A;  1KGS A;  2M8G X;  5JLW A;  3KYC B;  4JLG A;  4BJT A;  1P4X A;  2VKH A;  4M9Z A;  5J8F A;  3ZGK A;  3SZP A;  5T0K A;  1OR7 C;  3A0H C;  3HRS A;  3TOA A;  5HDG A;  3PQK A;  3I64 A;  3V42 A;  1DU0 A;  2KQR A;  1X4O A;  5J47 A;  2M4K A;  2EIN H;  3EYY A;  1G3T A;  2UXN A;  4A3J J;  2G0E A;  1IN6 A;  1RNL A;  4MQV A;  5D6F A;  2ELH A;  4OMZ A;  5CVJ A;  2A6T A;  1H88 C;  2FBI A;  3VV0 A;  3Q5F A;  3VSK A;  2FBH A;  5JI6 A;  4HYE A;  1JTY A;  2BXY A;  1KQ0 A;  2F5D A;  2FF4 A;  1QVT A;  3DBR B;  2V1X A;  4HV6 A;  3GTQ J;  3SZT A;  1XS9 A;  4N0B A;  3IWF A;  1Q1V A;  1WJB A;  4J8O A;  1K6O A;  3QU6 A;  3ASO H;  3B6A A;  3L2V A;  3CJR B;  3JRH A;  2NS0 A;  4ON0 A;  1RIO H;  1J59 A;  3ZN0 A;  1O3R A;  1GXQ A;  2IT0 A;  2BW3 A;  4N9I A;  4PCQ A;  4KIB A;  4LIU A;  3BR5 A;  4HPQ A;  4HW0 A;  1DQU A;  5HS7 A;  3WU0 A;  2NOG A;  1IUF A;  3BG7 A;  4G6T B;  1Y1V J;  3TOB A;  3P9K A;  1Z6T A;  3HPH A;  2AQE A;  2QPW A;  3TO9 A;  2F5V A;  3TW7 A;  2HKX A;  4E7J A;  2DPD A;  1J0R A;  2GIV A;  5D8K B;  3M8E A;  2R7D A;  2ZSH B;  2OTL I;  2HQN A;  1FSE A;  2VT3 A;  2WBM A;  3K70 C;  2LTP A;  3ZQH A;  1A31 A;  3EP0 A;  2VOD A;  5LD2 C;  3LFK A;  2KIQ A;  1SMT A;  3K10 A;  1JUP A;  2HZT A;  5LGU A;  1K4T A;  2NVT J;  3DLA A;  1D8J A;  1V4R A;  2B9S A;  2DPU A;  3H5N A;  3FMR A;  2W5Z A;  2KJB A;  2GA1 A;  3HSE A;  3OOP A;  3HZJ A;  5E3M A;  1GV5 A;  3J80 K;  2M34 A;  5E3O A;  1ZHF A;  2E1M C;  3S17 J;  3FXU A;  1P2F A;  4QEP A;  1CF7 A;  4HX4 A;  5EZG A;  1YJ9 I;  1SAX A;  4FX4 A;  3GTL J;  4A3I J;  4IHT A;  4XLF A;  3RZD J;  1XGM A;  4V19 K;  1T56 A;  3DPT A;  4CA0 A;  1HKQ A;  2WAE A;  4MIM A;  3CBP A;  4ENJ A;  1YRN A;  1U0J A;  4YPE A;  4L5E A;  4QTR A;  3CJT B;  4R79 A;  3HEF A;  3H9G A;  3F9Z A;  2H1L A;  3V4G A;  1IXR C;  1ULY A;  3MMY B;  4I76 A;  3O8H A;  2F4O B;  4UHT A;  1TWC J;  1YE9 A;  3WHB A;  3WTZ A;  1MNE A;  2Z33 A;  3HUG A;  2DOE A;  4HST A;  1UG2 A;  2CW0 F;  3Q9V A;  1IN7 A;  3MO2 A;  4IJD A;  1W4M A;  4OMY A;  1YQA A;  2HOA A;  2BEO A;  3HG9 A;  3E5U A;  3M1E A;  4LK0 F;  1R1V A;  3OMY A;  2MSY A;  3HB9 A;  3I59 A;  4YG2 F;  5LEJ A;  3TG4 A;  2ZSI B;  5JLX A;  4B44 A;  5IT9 Z;  2EQR A;  2P8T A;  5K7H A;  4IHS A;  5F6L A;  1PP7 U;  1ETV A;  1BW5 A;  3ZQQ A;  3DU5 A;  5FLM J;  3Q0U A;  1VQO I;  1MMA A;  2V1D A;  5DCM A;  2NVY J;  4HF1 A;  1S5L C;  5DS9 A;  4UNO A;  3K1N A;  3BTC A;  3HOS A;  2KIU A;  3SFZ A;  4C1Q A;  5FLV A;  1I27 A;  2DTZ A;  4XK4 A;  2STW A;  4RM3 A;  2I5U A;  3N71 A;  2PLY A;  2HTS A;  2NOJ B;  3GLL A;  5EF6 A;  1HDP A;  4NB5 A;  2EV0 A;  4LIT A;  4ANJ A;  3KP2 A;  4IVN A;  1KQ8 A;  1RI7 A;  1EKE A;  1MKM A;  1JT6 A;  2E7W A;  3WE2 A;  1ZAR A;  2K9M A;  1SFU A;  2LNB A;  2JSC A;  1V55 H;  4HF0 A;  4M9X A;  1UHM A;  2O9L A;  3DB5 A;  4G12 A;  2DA3 A;  3A03 A;  5EEH A;  1BI1 A;  1IZ1 A;  4BU2 A;  3VOD A;  3MVP A;  3K7A J;  1ZEL A;  3QPH A;  4KIT B;  3GVA A;  2YPR A;  1VQ8 I;  2VAS A;  2E36 A;  1QU3 A;  1NK2 P;  9ANT A;  1POG A;  2LOO A;  5GAD J;  2VE9 A;  3M53 A;  3TBI A;  1JKO C;  4HOB A;  2DT6 A;  2BY2 A;  2Y0M A;  1TP4 A;  3TW6 A;  2X6X A;  3OL3 A;  3CD6 I;  3BWG A;  3FWE A;  1VQ6 I;  4CCM A;  1YO5 C;  1QPI A;  3IAM 2;  1A35 A;  1IV8 A;  2EJR A;  1LJ9 A;  1JHF A;  3M3Y J;  3X2Q H;  2EZL A;  3T8R A;  3BG6 A;  3BTL A;  4MI0 A;  1U9N A;  3JRB A;  5JR3 A;  2K5C A;  3KP7 A;  4E7L A;  4GCV A;  5EEG A;  2JVH A;  2IA1 A;  5BOX A;  4ETS A;  2QGU A;  3ZR8 X;  4A3G J;  3R0A A;  3E0J B;  2RNG A;  1A36 A;  4UUS A;  1NG7 A;  3BJA A;  1UFM A;  3KX2 A;  2X0L A;  5DUK A;  1HST A;  1YI2 I;  1ZKG A;  3KIO A;  2MH2 A;  4D5F A;  3LOC A;  1ETO A;  4FT8 A;  1QRY A;  5IP6 A;  1WJD A;  3COA C;  5IPA A;  1ETX A;  3MFK A;  1VQM I;  2NVQ J;  4A3B J;  4GDF A;  2A61 A;  2GWR A;  3R6S A;  2BY3 A;  2OUM A;  2Z5U A;  1Y56 A;  2O3F A;  3QAH A;  2R5Z A;  1DUX C;  3K0L A;  1XN7 A;  1R22 A;  4HRI A;  2LR8 A;  2XF5 A;  2NAZ A;  4BEH B;  5EG0 A;  1H9G A;  2RN7 A;  4G7O F;  1N75 A;  5JVG F;  2WC2 A;  1TQI A;  2ZNY A;  3IAS 2;  3QOP A;  1LEB A;  3CDL A;  5GPA A;  4B8X A;  2HZD A;  2OCC H;  3DEE A;  4DJA A;  3FKI J;  3M58 A;  4RM2 A;  3H1C A;  4G7H F;  3QOD A;  3MN2 A;  2QBY B;  4MLO A;  2DA1 A;  4S0H B;  4CCJ A;  4PGH A;  2VL8 A;  4Y3O A;  3LSR A;  5L3B A;  2KIS A;  4X0G A;  1AWC A;  2IAI A;  1RR8 C;  1IRF A;  1WKM A;  2DA7 A;  4ZH4 F;  2R7T A;  1VF9 A;  2HU9 A;  4P9F A;  3J81 K;  1UJ8 A;  3K4K A;  4XON A;  4AVP A;  2Y31 A;  3OYH A;  1W0U A;  3CLQ A;  5JVT A;  4IOC F;  1N78 A;  1KZH A;  4C9Y A;  1WH5 A;  1V3F A;  3TO6 A;  2L3D A;  5FJ8 J;  4WUY A;  3OV8 A;  2L2O A;  1H89 C;  3M57 A;  4RAZ A;  2QF7 A;  5J1R A;  1XB4 A;  4Y33 A;  2X51 A;  1G6N A;  2KLO A;  4MHG A;  3IRQ A;  1Y0N A;  5H20 A;  2H27 A;  3K1M A;  3BQY A;  2NS7 A;  1FC3 A;  2XPU A;  3W6V A;  1WSU A;  1QZE A;  3WTU C;  2DT5 A;  4M73 A;  1WPK A;  3G1M A;  3WG7 H;  3HOZ J;  3EYI A;  2LC2 A;  2FMY A;  2QLZ A;  3FBI B;  4L0Y B;  4G8X A;  1RES A;  4A3K J;  2W48 A;  1EJ9 A;  1N6A A;  3F8B A;  2KRF A;  3A4C A;  3BR1 A;  4GYG A;  1Z6R A;  2YU9 J;  3KFW X;  4PSW A;  2O6G E;  1HOM A;  3L00 A;  4DW6 A;  3GTP J;  1S3J A;  3F21 A;  3SW9 A;  5FKN A;  4U7D A;  3FXO A;  3IH2 A;  4ZYD A;  1S72 I;  4MFE A;  1G3W A;  1XGO A;  1NH3 A;  2AS5 F;  2DCE A;  1T6S A;  2QSG X;  3RQ4 A;  4DZP A;  2UXX A;  1MMD A;  3L2U A;  3RJP A;  2DOD A;  2JPC A;  1BR2 A;  1SFE A;  5ERI A;  1VI0 A;  4XOR A;  3ZQ7 A;  1Y39 A;  1IO2 A;  3PO2 J;  4LK1 F;  2TCT A;  2ETH A;  5L3D A;  4HG2 A;  2FQ3 A;  5F27 A;  4ESJ A;  5F0F A;  3BJO A;  1MBG A;  2RDP A;  5E8I A;  5L3G A;  4XIC A;  1R1T A;  1T08 B;  3M4O J;  2CUE A;  1N6C A;  3M5A A;  3CF2 A;  2HWV A;  4A0Z A;  2Z16 A;  5C4J J;  1E3H A;  1P7I A;  1QO0 D;  3HXL A;  1ZG1 A;  1K78 B;  3CQZ J;  1GT0 C;  2E2I J;  1Z77 A;  2G7U A;  1APL C;  5CLS A;  5BS6 A;  1Y8Q B;  3LSP A;  1E3P A;  4UVA A;  1PP8 F;  3KMT A;  2ELK A;  2W82 A;  3LFU A;  1YYV A;  4KMF A;  4JX5 A;  1NHA A;  2A6E F;  5ICG A;  2R7R A;  3RKQ A;  1HBX G;  4E70 A;  4LDG A;  4HDU A;  2LF8 A;  3CLO A;  3TP3 A;  2BBY A;  3IH4 A;  2L01 A;  1S6L A;  2LMD A;  1UEL B;  2R7O A;  3U1K A;  5JHF A;  4S05 A;  2R7X A;  2EWN A;  4BNC A;  5CCM A;  3TMO A;  1FTZ A;  3CCJ I;  1JT0 A;  2CQX A;  2L4A A;  1U5T B;  4DIQ A;  1O7F A;  2W5Y A;  5A2Q Z;  1JJ6 C;  1I3Q J;  4BE1 A;  2Q1Z B;  4JX4 A;  2EK5 A;  3FZV A;  3C3W A;  3E3V A;  3I3L A;  4PJJ A;  5B3S H;  1JXS A;  2PMZ A;  1I50 J;  3MKL A;  3AG4 H;  1L0O C;  2R0Q C;  3H5R A;  4G6D A;  2MC3 A;  4BXU A;  2DMT A;  5HS8 A;  2V26 A;  2K27 A;  4EJO A;  5ICE A;  1UAA A;  2NS8 A;  4BHC A;  4WF2 A;  2HDW A;  4V2F A;  2DFI A;  5B66 C;  3DLL F;  3F23 A;  3R4K A;  4A6E A;  2MYS A;  1RUN A;  3CCL I;  2ZME B;  2VQL A;  1FJL A;  1XX5 A;  2EIM H;  3OYL A;  3FX3 A;  3GX4 X;  4IHV A;  3ABM H;  4OAY A;  1O9S A;  4CCK A;  3GME A;  3DU6 A;  3SYT A;  4RZ0 A;  1WGX A;  4CCO A;  2RNJ A;  4D0P A;  3MCZ A;  2QYO A;  3E5X A;  4PJ0 C;  2H09 A;  3ZQL A;  1F5T A;  4MGR A;  1RKW A;  3CJQ B;  4XLE A;  2MC4 A;  1MSE C;  4NC6 A;  3J80 Z;  1ZAO A;  2X9D A;  2AQF A;  2L7Z A;  4JK1 X;  2CV1 A;  2CUF A;  3TDZ C;  4ZTJ A;  2OCE A;  2FSW A;  4RLQ A;  1ZG5 A;  3FBN B;  2NYX A;  3PNV A;  1ZTR A;  1JUM A;  3SEZ A;  4RS8 A;  4HF2 A;  2OPT A;  5CKT A;  3E6D A;  5LRR A;  2YUS A;  1TT5 B;  3ML6 A;  2M3A A;  2VQH A;  2JTV A;  3L2W A;  3GZ5 A;  3S3N A;  2ZJ2 A;  3OS1 A;  1WFX A;  3LNQ A;  4B3A A;  3CZ6 A;  3OSF A;  5IY5 H;  1HQC A;  1U8R A;  4H4K C;  1USS A;  2XHK A;  2WY8 Q;  1QBJ A;  5J4Y A;  2PEX A;  2A07 F;  3K4M A;  3CMY A;  1OKR A;  3FXM A;  2EZH A;  2GOM A;  3H3U A;  4M3E A;  4Y7N J;  2OQG A;  1MJ9 A;  2DYS H;  2WAQ A;  3EET A;  2MLK A;  4J00 A;  5K1Y A;  4IO9 F;  4P5O A;  4NQW B;  2DA5 A;  5FFZ A;  3HOY J;  3GUD A;  2OTJ I;  2X1E A;  4LLL A;  4F3Q A;  4EV0 A;  3BRO A;  1TC3 C;  2FBK A;  4ZYG A;  1S29 A;  4NHJ A;  5FKK A;  3HTU A;  4B48 A;  4Y13 A;  1JGG A;  2E60 A;  1ITY A;  1BIB A;  3CO7 C;  3BOQ A;  1VFC A;  2ZC2 A;  3KET A;  4RLF A;  2OA4 A;  3KEY A;  2M4G A;  1FP1 D;  3MEK A;  4XRS G;  2Y9Y A;  4KNY A;  3CUQ B;  3L2C A;  5KJL A;  1H0M A;  2HYJ A;  2XF7 A;  4BS9 A;  2M7B A;  5F0C A;  2GXB A;  3G71 I;  4WXH A;  3S1N J;  3GXO A;  4NUB A;  2FEZ A;  1ZRC A;  3D5L A;  3F8N A;  3DWL E;  4AVZ A;  4BEH A;  3AG3 H;  1I1S A;  4KT6 A;  1JI8 A;  3KEO A;  2E71 A;  2AXL A;  4UV8 A;  1I3A A;  1WH7 A;  4IF4 A;  1KA8 A;  3DAL A;  2WWY A;  2E34 A;  3DFG A;  2IA0 A;  2QBY A;  3I4N J;  2EZI A;  2ZXH A;  1MBH A;  4EQQ A;  1Z7L A;  2UWM A;  3LQR A;  5D4R A;  2ZB9 A;  1N3J A;  2EFP A;  3BR6 A;  4Y15 A;  2E7X A;  5GPC A;  2IW5 A;  1IF1 A;  3HJE A;  3OYB A;  3G2B A;  1OIS A;  3VYS B;  1Z3Y A;  3NRV A;  5M5X J;  4XKC A;  1TNT A;  1NTC A;  3WGG A;  5IOZ A;  2ESH A;  3HOX J;  2R7F A;  2XGC A;  5IP9 J;  4O6J A;  3AG1 H;  5KJM A;  1BI3 A;  1WQ2 A;  4YRV A;  1EA3 A;  5LHI A;  4M6X A;  3S7F A;  1VQ4 I;  1MZB A;  3I0T A;  3H3Z A;  4M9S A;  3WTT C;  4I99 C;  2M2E A;  2OQR A;  3MKZ A;  4O3M A;  1MUF A;  2ZFW A;  5C44 J;  3JRA A;  3BZC A;  4PJM A;  1LQ1 A;  1HC8 A;  3F8M A;  2M5W A;  1IDZ A;  2HXI A;  4H12 A;  1SC7 A;  2OD5 A;  4XQF A;  2CO5 A;  4A5N A;  1WJ5 A;  2K4J A;  2LD5 A;  1BA5 A;  4U88 A;  5FD5 A;  3L09 A;  3D5S C;  2LLK A;  3ZCO A;  2RC4 A;  3M1C A;  4UV9 A;  5HLT A;  2EFQ A;  2BY0 A;  3QU3 A;  3T5X A;  1BOB A;  3MO5 A;  3LSI A;  4I09 A;  4F7Z A;  3QQA A;  3TDU C;  3QWP A;  1IJW C;  4Z2Y A;  5E3L A;  4QIW N;  1FSH A;  1QQI A;  3CES A;  1Z3X A;  2LKP A;  4CIC A;  2JA5 J;  2VJ4 A;  5D8L B;  2DK5 A;  3BJ6 A;  2KRC A;  4RGU A;  1F43 A;  4C3I J;  3KP3 A;  4B4C A;  3PIP F;  4KJZ A;  3MD2 A;  2RV8 A;  3BCB A;  1FMV A;  3OPE A;  2M87 A;  2DQL A;  2XAQ A;  2OU2 A;  2E2H J;  3BCA A;  3GTM J;  3KCC A;  3B73 A;  4BXF A;  3U2R A;  1YIT I;  1D0Y A;  2IGN A;  1R58 A;  4X1E A;  3WE3 A;  2XAU A;  3BTI A;  2UZK A;  1HW2 A;  1T0F A;  3F8F A;  4C3H J;  4FHT A;  4AUX A;  2FNP A;  4RGR A;  3WU1 B;  3BR0 A;  5KVR A;  5EX0 A;  3CUQ C;  2PJR B;  2N8G A;  2R7W A;  3PL8 A;  4ZZL A;  2EFW A;  3CBM A;  2ADU A;  2L7M P;  3J81 Z;  2CQN A;  1K78 A;  1BI2 A;  1ZR4 A;  4JX6 A;  3V8L A;  1WJA A;  2L7F P;  4M3B A;  4U87 A;  1QNT A;  3PUB A;  5LGN A;  2K3P A;  3EQL F;  4KT5 C;  3JSO A;  2VT2 A;  4KIC A;  2QVO A;  3FM5 A;  4J7I A;  3HPG A;  4E7Z A;  1TZL A;  3I71 A;  2QA4 I;  4WCG A;  5KJN A;  4XRS A;  1OFC X;  4XM3 A;  2R3S A;  3OYG A;  1MJB A;  2ZBK A;  1IXS B;  1HKT A;  2WAD A;  3VSL A;  2IJL A;  4IEJ A;  1HA8 A;  2LYC A;  2HVR A;  3JW4 A;  1QZY A;  3HSF A;  5HDN A;  4FE7 A;  1U5T A;  3BP8 A;  4AIH A;  5TJJ A;  1R36 A;  4AC0 A;  1O57 A;  4M3D A;  1FIP A;  4A3E J;  4IOA F;  4EEF G;  2IRF G;  2F2E A;  3F8C A;  2QWW A;  2WAF A;  2VE8 A;  3O2P E;  2XKP A;  2MAB A;  3FDY A;  4EM1 A;  1SAN A;  1L3L A;  2VPL A;  3IHX A;  3KLN A;  2P6S A;  5ARF A;  5ICF A;  1SVL A;  1TNS A;  1IN8 A;  2YU3 A;  3M8F A;  5HOO A;  3ISP A;  3CCV I;  2YSR A;  1MD0 A;  1V54 H;  3Q0W A;  1DPR A;  1UHS A;  1JKQ C;  1N25 A;  3RZO J;  2XPW A;  5EDN A;  2HOS A;  2ZME A;  3BQZ A;  2XGD A;  3K9T A;  4XSZ F;  1JKP C;  2LH9 A;  4YEJ A;  1FIA A;  2WB1 N;  2Y75 A;  1Y1W J;  1ON1 A;  2HS5 A;  5DDG A;  1X1C A;  1S7A A;  1LFP A;  4LLG F;  4HSR A;  3PIO F;  5T0M A;  2X4H A;  2KT0 A;  3KE2 A;  1E2X A;  1FYL A;  3RPQ A;  4Z6Y A;  1XDU A;  1TWG J;  1W5S A;  3JSP A;  2KFD A;  1V5F A;  3G4S I;  2F6C A;  1RRJ A;  4RAY A;  2ICW G;  5CVI A;  4KIS A;  2KP6 A;  4OIR F;  3CCM I;  4II2 A;  3M54 A;  2CFX A;  2VBZ A;  3FKJ A;  2XB0 X;  3RIR A;  2R5Y A;  2P6T A;  3MO0 A;  2H6C A;  4PZJ A;  1OPC A;  4A3D J;  3FMS A;  3N97 A;  3BPV A;  3O3K A;  3HDD A;  2ZFU A;  3TL4 X;  4CZZ A;  2BY1 A;  3A0B C;  3DPU A;  2EBI A;  3PO3 J;  3ONQ A;  2V9K A;  4EM2 A;  3PSI A;  2PBI A;  1RUO A;  2QM3 A;  2E2J J;  1SEU A;  5TGT A;  3ERE D;  1PDN C;  2ZO4 A;  1BM9 A;  3DKY A;  4M6Y A;  1PJR A;  3JAM K;  5FLX K;  4TV7 A;  5AYF A;  4CZC A;  1BJZ A;  2NNN A;  3VYT B;  1R23 A;  3OS5 A;  2VKD A;  3LSJ A;  5KJK A;  1YOV B;  4XRM A;  1IGN A;  1LVA A;  3H35 A;  4ZYE A;  3C1D A;  4LJZ F;  4A12 A;  4IKF A;  1IG7 A;  2MH9 A;  2WA0 A;  3GO5 A;  5J6X A;  5EGO B;  1W36 C;  2M0M A;  2QEX I;  1H9T A;  1HCR A;  5DTD A;  5CCL A;  2A68 F;  1OR7 A;  4RGS A;  5H2F C;  3RAY A;  1J9I A;  4I0B A;  2ZXJ A;  2IS2 A;  1H8A C;  1CGP A;  1XQH A;  3B6C A;  3W3C A;  4OIO F;  4XRF A;  2RAE A;  3PNT A;  4CXF A;  3AKZ A;  2KIF A;  4L9T A;  2VB6 A;  3GW2 A;  4OOI A;  5EJC A;  2DW4 A;  2XGE A;  5M3F J;  3LSG A;  5CYV A;  2DDA A;  2VJI A;  4BHB A;  3BR3 A;  2VOO A;  4BAY A;  1BW6 A;  2M0C A;  3JCU C;  4ENK A;  5FD6 A;  2Y9Z A;  2FJ1 A;  1YHQ I;  5D5V B;  2RRE A;  4WXD A;  3MQ0 A;  2KKO A;  4BKX A;  4YFN F;  1RPW A;  2DAO A;  1SAU A;  2PQ8 A;  1WZ2 A;  1TTY A;  4FMU A;  4DYQ A;  4Y4R A;  1OYI A;  3O6B B;  4C2M J;  2KRH A;  1K4S A;  1KYW A;  1OYY A;  1ZN2 A;  2HTJ A;  3VPR A;  2DFE A;  1B72 B;  2H94 A;  5BPD A;  2IGO A;  2QEN A;  2M1B A;  5F6F A;  4XLC A;  5HVQ C;  1LFU P;  4XR6 A;  3M55 A;  1IDY A;  4XKW A;  2HQR A;  3GBG A;  1YW9 A;  3WTV C;  4I7H A;  3J7Z I;  1TWH J;  2AO9 A;  3EUH C;  2L9N A;  2JA2 A;  4PUS A;  4NNJ A;  2F5C A;  1JKR C;  3QPL A;  3CCY A;  3RIB A;  2JA6 J;  3P9C A;  4CYC B;  1MSF C;  2CV0 A;  3HOV J;  4AIK A;  3OR2 C;  1YJW I;  2EPF A;  2K7L A;  4FQG A;  2F4I A;  4HQE A;  2CW8 A;  4CDG A;  2WV0 A;  2NXN B;  2IPQ X;  3T8T A;  2G46 A;  1HXD A;  2HFH A;  2XGX A;  4N9H A;  2F5F A;  1YX3 A;  3JRC A;  1WJF A;  3SEQ A;  4P1W A;  4D7N A;  1X2M A;  1ZLK A;  1ODD A;  4IQJ A;  1X58 A;  2LSO A;  1VTN C;  3BC8 A;  3V8K A;  3QPS A;  3K70 D;  3C2B A;  1FOY A;  3FK7 A;  2E5Z A;  2MGQ A;  4KIG A;  1RC9 A;  1FT9 A;  1OCR H;  1UZC A;  4C3J J;  2V6C A;  5TEG A;  2LBF B;  1A6Q A;  5TIS C;  5IT3 A;  4UVC A;  4OIN F;  3ZXS A;  1TQM A;  3Q9S A;  5F0H A;  1SD5 A;  4ITV A;  1XDS A;  3DP7 A;  5J8C A;  4H0E A;  2JQ7 A;  4ZTF A;  2DMP A;  2J5P A;  1X3Z B;  2LVS A;  4PJL A;  4HNV A;  1FWZ A;  4RB2 C;  4KA4 A;  2NVU B;  5D4S A;  1ZGW A;  2IGK A;  2PMU A;  4PDK A;  1SD7 A;  2L5Q A;  3FXK A;  2DDB A;  1XSX A;  3VUZ A;  2J5O A;  2Z2S B;  2M45 A;  5FRM A;  1LPQ A;  1SMY F;  2L9R A;  5HNH A;  4HQM A;  3KMA A;  2JMW A;  2PJR A;  1IN5 A;  4O6F A;  5LHH A;  5K5O A;  1IUY A;  3DBH B;  5D6E A;  4GGG A;  2BE5 F;  2EV6 A;  3P5J A;  2JA7 J;  1VND A;  2DU9 A;  4NC7 A;  4DQ2 A;  3SFI A;  1I1G A;  4DOZ A;  2QSH X;  4EGY A;  5F1R A;  3HKZ A;  3ZMV A;  3IKT A;  3AG2 H;  1HLV A;  5EX3 A;  5BQT A;  4M71 A;  5H6R A;  5DM7 F;  3LA7 A;  1HW5 A;  4L18 B;  3S2W A;  1WJC A;  3BLY A;  1G4D A;  1XSD A;  2ISZ A;  1Z1D A;  2JWT A;  5J4V A;  1O4X A;  5FRO A;  1D0Z A;  2A69 F;  3SZG A;  2VOP A;  1ERD A;  5FO5 A;  1UB9 A;  1OMI A;  2QZ8 A;  3BTJ A;  1TBX A;  1MND A;  3K4C A;  1D1C A;  2A5Y B;  3S7B A;  3JRG A;  3HOT A;  4OIQ F;  3L7W A;  2CFO A;  5DM6 F;  1U3E M;  1OJL A;  3KP4 A;  1LDK B;  4L9J A;  3W6K B;  1ZR2 A;  2HR3 A;  2BVL A;  2KMU A;  2HPM A;  2PFB A;  3V8J A;  3SQN A;  2YX4 A;  4G6Q A;  2HEO A;  1ENH A;  4MFD A;  1Y0U A;  4A69 C;  5F59 A;  1OCZ H;  4MEY F;  4AIJ A;  2VQG A;  1B4A A;  3VDX A;  4BBR J;  1X1A A;  3OYJ A;  3PM1 A;  1Y6I A;  4QPQ A;  4LGW A;  5CJ9 A;  2K9Q A;  2HDC A;  4BBS J;  2GZW A;  4R1H A;  3VB2 A;  2P5V A;  5F64 A;  1FZP B;  1ZQ3 P;  2I10 A;  2HOE A;  3HGY A;  4WK8 F;  3EUA A;  2I8D A;  3G3Z A;  1YFH A;  1E0E A;  4XLH A;  5EZH A;  3FMQ A;  4J19 A;  1BC7 C;  5FKM A;  4EJT A;  3OIP A;  4XN3 A;  1KQ9 A;  2ZNZ A;  2L9V A;  3KYD B;  2DBB A;  1QHG A;  5CVV A;  5LBQ A;  4G94 A;  4DGW B;  2MLG A;  1MVX A;  2PG4 A;  2LY1 A;  2BYV E;  1DP3 A;  1G2H A;  3HKZ N;  1GVJ A;  3L9F A;  3PQJ A;  4LLN A;  1QZZ A;  2GIZ A;  1IAW A;  5LSX A;  4YIR X;  4JYK A;  4ZYH A;  5JIN A;  3E5Q A;  5EEA A;  4AU7 A;  5F1J A;  3S3O A;  2NVX J;  3F6V A;  1PUF B;  3H5A A;  5D5U B;  1GVD A;  4QWQ A;  1JJ8 C;  1J75 A;  2STT A;  3TP0 A;  3RCO A;  2A6H F;  2XRN A;  3BR2 A;  2WY7 Q;  3CO6 C;  3V7C A;  3S32 A;  3ZMT A;  2IP2 A;  3QYB A;  3E6B A;  2QCO A;  2L7K A;  3ASN H;  4G9Y A;  4BJ5 C;  1LB2 A;  2ZJR F;  2VJJ A;  3ZOB A;  3NAU A;  2P0W A;  3DEW A;  3M59 A;  2F69 A;  4C2U A;  1JTX A;  1YJN I;  1MBE A;  3IWZ A;  4BAC A;  2A3S A;  2JA8 J;  3KPH A;  1W7P B;  4HX8 A;  5K7F A;  4D9J A;  3OIQ A;  2IBD A;  5KK1 A;  4ZDP A;  3CC2 I;  4KYW A;  3SHF A;  3VFZ A;  3ESW B;  3VYU B;  1IV6 A;  4AM3 A;  1R00 A;  3VEP A;  1R5H A;  2D1V A;  2EA4 A;  1HW1 A;  1EV7 A;  4DYC A;  4IJ8 A;  1PEG A;  2ME6 A;  4R8H A;  2W7N A;  1X2N A;  1YX5 A;  1FBU A;  5E1Z B;  4GYI A;  1Z05 A;  3G1L A;  3RTR A;  2VON A;  3I5U A;  3CMM A;  3RPU A;  4J7F A;  3CJN A;  3HNA A;  4YPU A;  5LSZ A;  3HOU J;  1TWA J;  3TO7 A;  3ZQC A;  3CC7 I;  5D5X B;  2E1N A;  2OJE D;  3DTK A;  2YX7 A;  1FYK A;  3IV5 A;  5F08 A;  5EGO A;  2HYF A;  4U0Y A;  2ZKZ A;  4RDU A;  3I58 A;  1F36 A;  2DQR A;  4B43 A;  1TT0 A;  3VOE A;  1Z7U A;  1LEA A;  1BJA A;  3CCR I;  1BR1 A;  4F92 B;  2XIG A;  3OY9 A;  1J5Y A;  3QYE A;  3K4B A;  3CDI A;  3HRU A;  3FXR A;  5JHU A;  1OCT C;  2VC1 A;  2ECC A;  3FHZ A;  1VQ9 I;  1UG0 A;  3I4M J;  3PFY A;  4AD9 A;  2DFF A;  4M74 A;  1D5Y A;  2FA5 A;  1IN4 A;  1P4W A;  1V5G A;  5AON A;  3OXF A;  4A6D A;  4DYR A;  5ICC A;  3WTY C;  4FCY A;  3R0J A;  2XC7 A;  4P9U A;  1TWF J;  3D0S A;  2H1K A;  1J2X A;  4FE4 A;  3DTE A;  2VN2 A;  4EAT A;  3ZQI A;  1B9M A;  3RYP A;  1YRN B;  5DV5 A;  2C6Y A;  3QPT A;  2EA2 A;  4M3F A;  4XN0 A;  3Q3S A;  1G3Y A;  4Q5S F;  2Z3Y A;  2Y0S N;  1B72 A;  2DLL A;  2ZXI A;  5CQE A;  1P7J A;  2EV5 A;  3MAJ A;  4FET A;  3OYD A;  3SXY A;  5B1B H;  2K86 A;  3WOD F;  3HUG B;  1YG2 A;  3QOE A;  1QGP A;  2KIM A;  1W0T A;  2IVM A;  2EB7 A;  2IGM A;  3JAM Z;  5FLX Z;  3WHC A;  1D8K A;  1MGT A;  3K1P A;  4E4H A;  4MTE A;  3WU2 C;  2DFH A;  2OBP A;  4EMS A;  4CYC A;  1FTT A;  1SVM A;  3GYH X;  2BZT A;  1OCC H;  3EUK L;  4F93 B;  2M8E A;  3KZY A;  2V6E A;  4MEX F;  5HI7 A;  1HSJ A;  1LKX A;  3F9K A;  2XVC A;  3ABK H;  4DZJ A;  3FK6 A;  2B63 J;  2OC6 A;  3S93 A;  5IYC J;  3ABT A;  1OCO H;  3WTW C;  3CCS I;  1AOY A;  1IXC A;  4BGD A;  3HHH A;  1I39 A;  3OL4 A;  4Q48 A;  1D0X A;  3R61 A;  3HHG A;  1I6X A;  1RZ4 A;  2KL4 A;  4KUM A;  1DPU A;  2ESN A;  5C3E J;  3M7G A;  3DPL C;  5HOD A;  1LE8 B;  1OQY A;  4BY1 J;  5ILV A;  2MD5 A;  2XV4 S;  4AYB A;  1P9Q C;  2DO7 A;  1G3S A;  2ELJ A;  1DDN A;  2ZCW A;  4YEL A;  1FY7 A;  2R7Z J;  2CGP A;  4YND A;  1PVE A;  1KYZ A;  2L02 A;  2LBF A;  2Z99 A;  3GFL A;  2X6W A;  2E35 A;  3F72 A;  3Q0V A;  2BOL A;  4HLX A;  5FFX A;  1T95 A;  4U0V A;  3BG9 A;  3CF5 F;  1ETK A;  3N05 A;  4L9V A;  2CUJ A;  5HLH A;  3TGN A;  5B1A H;  3I53 A;  4O5V A;  1WRJ A;  3BT9 A;  4N4N B;  1K61 A;  4XNF A;  4CUG A;  1H3I A;  3F6O A;  5K5Q A;  2Y48 A;  3DTI A;  5FGM A;  1R9T J;  1ONV A;  2JRM A;  3CUO A;  1FOK A;  4QEO A;  5L3F A;  2DN0 A;  3PFI A;  1BN5 A;  3OS2 A;  1MMG A;  2XAH A;  2LRE A;  5K7Z A;  4Q4Z F;  3F9W A;  1ZH5 A;  4ESF A;  2K3F A;  4XBF A;  2XRO A;  1O7L A;  1XMX A;  2EFN A;  2AHQ A;  1WWX A;  2PMH A;  2Y2Z A;  3ZMU A;  4RGX A;  4LG3 A;  4KFC A;  1F9N A;  2GXG A;  4JBA A;  4J01 A;  1IRZ A;  1MBF A;  2JPB A;  4BY7 J;  3OYA A;  3N4M A;  3TQN A;  4F55 A;  1EF4 A;  1Z67 A;  2QUF A;  4HLY A;  3PDN A;  5DCF A;  3V7S A;  2Q2E B;  3QP5 A;  2EFO A;  4DNC A;  5JFR A;  4MI5 A;  5L3C A;  2XB5 A;  1KU2 A;  3OWT A;  5FB2 A;  2LF7 A;  4S04 A;  3NAR A;  4PK4 A;  4GXO A;  2CS3 A;  2VIX A;  3CP8 A;  1IW7 F;  1ZK8 A;  2W84 A;  3K2Z A;  1T33 A;  2GM4 A;  2QQB A;  5DYM A;  2X6O A;  2W4S A;  4AYB N;  2MFZ A;  4W1U A;  4RA2 A;  2O7O A;  5LHG A;  1ZYR F;  2OF7 A;  4OIP F;  1ZLJ A;  3IKV A;  1MDM B;  1PUE E;  4IRG A;  1VQL I;  5EG0 B;  1BC8 C;  4BH9 A;  2L54 A;  5CPR B;  4K2E A;  4PFO A;  1GHC A;  3D1N I;  5T5G A;  2LRD A;  1QVU A;  2DXI A;  4JDS A;  3C7J A;  2ID6 A;  1J09 A;  2DA4 A;  4LD5 A;  4OAZ A;  3RSN A;  2OZU A;  2Q0O A;  4RAG A;  3S1R J;  2QKL B;  5E1X A;  3S16 J;  1GV2 A;  2XSJ C;  4FX0 A;  1YLF A;  2ECB A;  1MT6 A;  3ROU A;  4AWX B;  3HC7 A;  2W1O A;  4IPA A;  4BQN A;  1BI0 A;  3RQI A;  3LMM A;  2WB1 A;  4OU0 A;  1GDT A;  3QYF A;  2OZ6 A;  3HGG A;  1R6R A;  1ETQ A;  4XKV A;  1LFB A;  4HAM A;  4BDZ A;  4Q47 A;  4BQO A;  3U21 A;  3K4J A;  3T1B A;  2LKS A;  1VQK I;  4BL0 B;  2CW7 A;  2P81 A;  1ACI A;  2B7E A;  5IYB J;  4YIF A;  4MQ9 F;  2OV7 A;  1F1Z A;  1FNN A;  3NWT A;  3S8P A;  3ZP5 A;  3GTK J;  3GTG J;  3H9J A;  1BBY A;  3OS0 A;  2Z9O A;  2PX9 A;  1STZ A;  5DEQ A;  1ON2 A;  4HV5 A;  2XAF A;  5BNG A;  2FD5 A;  4YFK F;  1AHD P;  3UNG C;  4CH7 A;  2HNH A;  1PUF A;  3ZMZ A;  4IZZ A;  4RBO A;  1EH6 A;  1YIJ I;  3OXL A;  2FML A;  3AL0 B;  1Z0X A;  4NDL A;  2L4M A;  4EJU A;  4HZF A;  5LRS A;  3O8G A;  5A2Q K;  1N77 A;  4Y52 J;  2V9P A;  2TRT A;  2G7H A;  1A6I A;  1MBJ A;  4RAF A;  4RB3 C;  3M07 A;  5J1Y A;  2IS6 A;  2XAG A;  1JUS A;  2JVG A;  4C2T A;  3BPX A;  3K4N A;  1DGW Y;  2O61 A;  1W7P A;  4ZC3 A;  1S9H A;  1ML9 A;  4XOP A;  2K02 A;  3CCU I;  1SFX A;  4G7Z F;  1LNW A;  2KHM A;  5LEK A;  2VC0 A;  2D5V A;  1JGS A;  2FRH A;  2XF6 A;  4ZDO A;  2K9N A;  4F52 A;  1D1A A;  2GXA A;  2CH0 A;  3DQV C;  1W7P D;  2YR2 A;  1E17 A;  3ABU A;  3FF5 A;  1TW2 A;  1XCV A;  3SDB A;  3TED A;  2DJI A;  4NJ5 A;  4WXC A;  1FYM A;  1ZGA A;  5HDK A;  2NNY A;  2CRG A;  4QEN A;  2XSD C;  4I98 B;  2P5L C;  2JK3 A;  3WGH A;  1D1B A;  2W00 A;  2LFB A;  3H9Q A;  2QSF X;  3HIF A;  3UR3 C;  3BDD A;  2DI3 A;  3FIW A;  2R3A A;  3HRM A;  4UY8 I;  4EVI A;  4A0Y A;  2O5R A;  1O3S A;  5BMZ A;  2VQC A;  3OOU A;  1XSV A;  4YPA A;  5L3E A;  3DBL B;  4X6A J;  3ZRG A;  4CGZ A;  2P4W A;  1FPQ A;  3CP2 A;  1JE8 A;  1AA7 A;  3JR9 A;  4RB1 A;  1AKH B;  5JIY A;  3C18 A;  4F91 B;  5E18 F;  3IRR A;  1TLH B;  1B9N A;  3KZZ A;  1GLN A;  4D1Q A;  1X4P A;  3JRE A;  3HM5 A;  4XL9 A;  3HYI A;  3QP6 A;  2MBF A;  3GF2 A;  5CVU A;  5GAG J;  3C2H A;  2XRL A;  3BO5 A;  2CSO A;  3E6C C;  3M56 A;  5E1W A;  1RET A;  4BHP A;  3UKG A;  4LOC A;  3L1P A;  3FIS A;  3MZY A;  4BXX J;  1MMN A;  3AAF A;  2K85 A;  1YS6 A;  2RQQ A;  3P7N A;  4PFP A;  3KEQ A;  5E3N A;  1SD4 A;  2CU7 A;  2LKX A;  1MIJ A;  4NQW A;  5GTI C;  3SWC A;  5IOY A;  1DGR M;  1MBK A;  2K40 A;  2P5K A;  3OYK A;  1WJE A;  1FBS A;  1IRX A;  3ZMS A;  1U9O A;  4CCL A;  3BG5 A;  3GWZ A;  2BQZ A;  3C2G A;  1IRG A;  3QWV A;  2WTE A;  3LA3 A;  1BL0 A;  2E1O A;  3KP5 A;  2W85 A;  3AL0 C;  3HBL A;  5EG2 A;  3W2A A;  4J83 A;  4LG0 B;  1V5E A;  1OLT A;  3RKY A;  2JN6 A;  1FLI A;  3ZN1 A;  1MW7 A;  2KZV A;  3CUQ A;  4L0Z B;  2R7V A;  5DUI A;  2R7U A;  3J7A O;  1R71 A;  2HDD A;  2RFI A;  1GXP A;  4P96 A;  2JJ7 A;  5FKL A;  4GFB A;  3ABL H;  1ZKK A;  1ETY A;  4E7I A;  2W25 A;  3A01 B;  1LE8 A;  2PJP A;  1GUU A;  1B59 A;  2L0K A;  3JTH A;  1HDD C;  4BQA A;  2ZJP F;  5KHD A;  1G8X A;  4CHU A;  3QWW A;  4BDY A;  1REP C;  3HOW J;  1MMS A;  2DOA A;  5JJ0 A; 
#chains in the Genus database with same CATH homology
 4B48 A;  2BW3 A;  2E60 A;  1X1B A;  4XOT A;  4LIU A;  4HPQ A;  1DQU A;  4G6T B;  3BG7 A;  4RLF A;  3F9X A;  3KEY A;  2R4G A;  2M4G A;  3EUA A;  2I8D A;  3HPH A;  3MEK A;  2AQE A;  1E0E A;  2QPW A;  2F5V A;  4XLH A;  5KJL A;  4E7J A;  2XF7 A;  4BS9 A;  5JHN A;  2M7B A;  3OIP A;  4XN3 A;  3S7J A;  4PSX A;  4NUB A;  2ZSH B;  1QHG A;  3D5L A;  4BEH A;  3DWL E;  4AVZ A;  4DGW B;  1MVX A;  2LY1 A;  4KT6 A;  2X1C A;  1DP3 A;  1JI8 A;  5LSX A;  2WBM A;  3K70 C;  5JIN A;  4AU7 A;  3S3O A;  3H5A A;  3DAL A;  3EP0 A;  5LD2 C;  3RCO A;  2WY7 Q;  2ZXH A;  3K10 A;  3S32 A;  2XDV A;  1Z7L A;  3QYB A;  3OYC A;  2UWM A;  4IX7 A;  2L7K A;  3DLA A;  1N3J A;  2X6Y A;  3H5N A;  4BJ5 C;  2W5Z A;  2VJJ A;  3L2R A;  2P0W A;  3OYB A;  3M59 A;  2UUZ A;  2F69 A;  3G2B A;  1G59 A;  4C2U A;  3VYS B;  4BAC A;  1Z3Y A;  2E1M C;  4XKC A;  4D9J A;  3OIQ A;  4QEP A;  4ZDP A;  3RU0 A;  3VYU B;  3W2V A;  3EPZ A;  4E47 A;  5KJM A;  2VJ5 A;  3OYI A;  4YRV A;  4IJ8 A;  1EA3 A;  4XLF A;  2JSP A;  1PEG A;  2W7N A;  3DPT A;  3S7F A;  1YX5 A;  3PNY A;  4CA0 A;  2WAE A;  3RTR A;  1LVK A;  3CMM A;  3MKZ A;  1MUF A;  3CBP A;  4J7F A;  4YPU A;  3HNA A;  4PJM A;  5LSZ A;  1U0J A;  4YPE A;  4H12 A;  3DTK A;  3VYR B;  4R79 A;  4XQF A;  1WJ5 A;  3H9G A;  3F9Z A;  3MKY B;  4B43 A;  1TT0 A;  1KON A;  3D5S C;  3MMY B;  3LSH A;  3ZCO A;  1YE9 A;  3M1C A;  5HLT A;  1MNE A;  4HST A;  1BR1 A;  4F92 B;  3MO5 A;  2V4J C;  1BOB A;  3MO2 A;  3LSI A;  3OY9 A;  3QWP A;  4IJD A;  3QYE A;  2X1D A;  3K4B A;  3HG9 A;  1UG0 A;  3OMY A;  3CES A;  3PFY A;  1Z3X A;  3TG4 A;  2ZSI B;  2VJ4 A;  4B44 A;  3TG5 A;  4BUP A;  2KRC A;  2BVM A;  5F6L A;  1V5G A;  3LSK A;  3OXF A;  5HQ8 A;  4KJZ A;  3OYF A;  3MD2 A;  3ZQQ A;  3DU5 A;  3BCB A;  1FMV A;  3PSF A;  4IQ4 A;  3OPE A;  4I51 A;  1MMA A;  2XC7 A;  3BCA A;  4E7H A;  4BXF A;  3D5R C;  3DTE A;  4EAT A;  4HNT A;  1D0Y A;  2IGN A;  4XN0 A;  2XAU A;  4ZDL A;  4BE0 A;  3HOS A;  4HEA 2;  2ZXI A;  5CQE A;  4C1Q A;  4RM3 A;  3N71 A;  2NOJ B;  4FET A;  2PJR B;  3OYD A;  5EX0 A;  2R7W A;  4LIT A;  4ANJ A;  3PL8 A;  3CBM A;  4HNU A;  3HUG B;  2M7A A;  3K5K A;  2K9M A;  3QOE A;  4GRI A;  4ZYA A;  1W36 D;  2V1N A;  4PJN A;  3DB5 A;  1WJA A;  4U87 A;  3PUB A;  4BU2 A;  2IGM A;  5HNF A;  5KNL A;  2K3P A;  1ZEL A;  4E4H A;  4KIT B;  2VLA A;  4J7I A;  2VAS A;  3HPG A;  4II3 A;  4E7Z A;  1QU3 A;  3KYL A;  1TZL A;  2LOO A;  5KJN A;  3K6G A;  3M53 A;  3H0D A;  3EUK L;  3TBI A;  4F93 B;  2V6E A;  2DT6 A;  4XM3 A;  3OYG A;  2IS4 A;  5HI7 A;  1LKX A;  2X6X A;  3F9K A;  3OXG A;  2WAD A;  3VSL A;  3OL3 A;  4YNP A;  4CCM A;  4B47 A;  1HA8 A;  2LYC A;  3IAM 2;  2HVR A;  2OC6 A;  3S93 A;  3W2W A;  1FMW A;  1MVH A;  2UV1 A;  2V7F A;  4BGD A;  3IP4 B;  3OL4 A;  5LFA A;  1D0X A;  3BG6 A;  3AFH A;  2JUG A;  4MI0 A;  2LG4 A;  2KL4 A;  2K5C A;  2WAF A;  3DPL C;  2MAB A;  3FDY A;  4E7L A;  4AYB A;  1P9Q C;  2VPL A;  2JVH A;  3IHX A;  2ELJ A;  2HPI A;  3ZR8 X;  5ARF A;  4YEL A;  3E0J B;  2RNG A;  1K6Y A;  4YND A;  1NG7 A;  5HOO A;  2LBF A;  3KX2 A;  2X6W A;  2BOL A;  1T95 A;  1PYV A;  3L2Q A;  3OYM A;  3N05 A;  4DBR A;  3J7A Y;  2CUJ A;  2BW3 B;  1SFK A;  2Y0S A;  3FPD A;  1WJD A;  2FUG 2;  4N4N B;  4XNF A;  2LH9 A;  4CUG A;  1H3I A;  2OUM A;  1Z21 A;  4E7K A;  3A2K A;  1Y56 A;  3DTI A;  4YEJ A;  4BE2 A;  4QEO A;  1X1C A;  2KDO A;  1LFP A;  4HSR A;  5T0M A;  3VWB A;  3OS2 A;  1MMG A;  4HRI A;  2XF5 A;  4BEH B;  2LRE A;  3OYE A;  3F9W A;  1QHH D;  1N75 A;  4QPO A;  1V5F A;  2F6C A;  4KIS A;  3IAS 2;  3OR1 C;  3S3M A;  3DKX A;  4LG3 A;  2KP6 A;  2HZD A;  3DEE A;  4DJA A;  5TTF A;  2Z1D A;  4II2 A;  4RM2 A;  3M58 A;  4JQF A;  3M54 A;  3QOD A;  3FKJ A;  4J01 A;  2K9L A;  4O30 A;  2VXZ A;  3OYA A;  3MO0 A;  4B3X A;  4MLO A;  4F55 A;  4CCJ A;  3PDN A;  2VL8 A;  4Y3O A;  2Q2E B;  4MI5 A;  2ZFU A;  3TL4 X;  4X0G A;  2CMP A;  3OWT A;  3RPU D;  2R7T A;  2HU9 A;  3DPU A;  4PK4 A;  2VXD A;  3ONQ A;  2V9K A;  3PSI A;  3K4K A;  4XON A;  2CS3 A;  2VIX A;  4BJ6 C;  3OYH A;  3CP8 A;  5TGT A;  1N78 A;  4C9Y A;  3DKY A;  2W4S A;  4WUY A;  1PJR A;  1X19 A;  2MFZ A;  2CUZ A;  5FRN A;  2IXS A;  2L2O A;  5AYF A;  4CZC A;  3M57 A;  3VYT B;  3OS5 A;  4Y33 A;  2X51 A;  2VKD A;  2KLO A;  5KJK A;  5CPR B;  4PFO A;  3H35 A;  1NG6 A;  3KMJ A;  4E7S A;  5T5G A;  2LRD A;  2DXI A;  4JDS A;  4NC8 A;  4NVQ A;  4IKF A;  1J09 A;  2LC2 A;  2WA0 A;  3FBI B;  4OAZ A;  2A5W A;  4C30 A;  3RSN A;  1N6A A;  5CCL A;  1W36 C;  4OWR B;  2M0M A;  3A4C A;  2QKL B;  2LY2 A;  4PSW A;  4RMN A;  2XSJ C;  3RAY A;  1T0F C;  4U7B A;  2IS2 A;  3SW9 A;  1MT6 A;  1XQH A;  3HC7 A;  2W1O A;  3W3C A;  2HVQ A;  4BQN A;  3LMM A;  2CV2 A;  2WB1 A;  3QYF A;  1X1D A;  2DCE A;  3PNT A;  1R6R A;  4XKV A;  5F6K C;  3AKZ A;  2VB6 A;  3MKW B;  4BDZ A;  4BQO A;  3CBO A;  3LSG A;  3RQ4 A;  3U21 A;  3K4J A;  2VJI A;  1MMD A;  3L2U A;  2R7S A;  4BL0 B;  2CW7 A;  2RRE A;  1BR2 A;  4N4O B;  2JV0 A;  3S7D A;  2OV7 A;  1SAU A;  3NWT A;  4XOR A;  3S8P A;  3H9J A;  3OS0 A;  4FMU A;  4Y4R A;  4HG2 A;  2KRH A;  4JOM A;  3UNG C;  4CH7 A;  2HNH A;  4IZZ A;  4FAS D;  4XLA A;  2IGO A;  1N6C A;  3M5A A;  3OXL A;  3CF2 A;  3AL0 B;  2Z16 A;  4XLC A;  5HVQ C;  4XR6 A;  2KPM A;  3M55 A;  4XKW A;  3GBG A;  3HXL A;  1N77 A;  4Z4P A;  3OOI A;  3LSM A;  2IS1 A;  3EUH C;  4XMY A;  3OYN A;  3A1Y A;  2L9N A;  2JA2 A;  4PUS A;  4NNJ A;  2IS6 A;  3KMT A;  2W82 A;  4ZJZ A;  2JVG A;  3LFU A;  3I9V 2;  4C2T A;  3K4N A;  1DGW Y;  4BQQ A;  3RIB A;  2HVS A;  4ZC3 A;  2X85 A;  1S9H A;  2R7R A;  1ML9 A;  4XOP A;  2CV0 A;  5ARG A;  4LDG A;  3RJW A;  3OR2 C;  2R7O A;  1UEL B;  2KHM A;  5JHF A;  2R7X A;  2F4I A;  2CW8 A;  5CCM A;  3TMO A;  3HL2 A;  2XF6 A;  4ZDO A;  2G46 A;  4YNM A;  4F52 A;  1D1A A;  1YX3 A;  2CH0 A;  3DQV C;  1WJF A;  3LL7 A;  4DIQ A;  3SEQ A;  4P1W A;  3SDB A;  3E1S A;  3FHN A;  4IQJ A;  2DJI A;  2QKM B;  2W5Y A;  4NJ5 A;  4BE1 A;  3BC8 A;  2Q1Z B;  3K70 D;  4QEN A;  2HQA A;  3I3L A;  4PJJ A;  4LIV A;  2E5Z A;  2PMZ A;  4XKB A;  1D1B A;  2W00 A;  3H9Q A;  3M8J A;  3UR3 C;  3H5R A;  2R3A A;  2O5R A;  2V26 A;  2R7Q A;  5TEG A;  2VQC A;  3K4L A;  3OOU A;  2LBF B;  1UAA A;  2O8J A;  2MD0 A;  4YPA A;  3ZXS A;  3ZRG A;  4ITV A;  2HDW A;  1VZ0 A;  2L9S A;  4CSW A;  3CP2 A;  5CQG A;  3F9Y A;  4ZTF A;  4PJL A;  5TH7 A;  1AA7 A;  1BR4 A;  2MYS A;  5JIY A;  4F91 B;  2IGK A;  2VQL A;  3OYL A;  1GLN A;  2DT7 B;  2E5N A;  2L5Q A;  4D1Q A;  3PJR A;  1X4P A;  4OAY A;  1O9S A;  4XL9 A;  4CCK A;  3VUZ A;  3DU6 A;  4E6K G;  3SYT A;  4RZ0 A;  2Z2S B;  4DBQ A;  3C2H A;  4CCO A;  3BO5 A;  5FRM A;  3M56 A;  5HNH A;  3CJQ B;  3KMA A;  4CCN A;  4O6F A;  4XLE A;  2PJR A;  1MMN A;  2MC4 A;  2RQQ A;  2GOX B;  3NWS A;  4PFP A;  5KCM A;  2IGQ A;  2AQF A;  2E1M B;  5F5E A;  2CV1 A;  4ZTJ A;  3SWC A;  4NC7 A;  1DGR M;  3IUO A;  4RLQ A;  4JLG A;  4BJT A;  3FBN B;  3PNV A;  3SEZ A;  4DOZ A;  3OYK A;  1WJE A;  1IRX A;  3HKZ A;  2VKH A;  5CKT A;  4CCL A;  2BQZ A;  5EX3 A;  3C2G A;  3ZGK A;  3QWV A;  2M3A A;  2VQH A;  1WJC A;  3BLY A;  1OR7 C;  3L2W A;  3AL0 C;  5T0K A;  3S3N A;  5EG2 A;  5FRO A;  1D0Z A;  3V42 A;  3OS1 A;  3W2A A;  4J83 A;  1WFX A;  3SZG A;  2KQR A;  1ERD A;  3CZ6 A;  1V5E A;  1OLT A;  1X4O A;  2M4K A;  1MND A;  3K4C A;  1D1C A;  4H4K C;  3S7B A;  3HOT A;  1MW7 A;  2KZV A;  2WY8 Q;  2A6T A;  3K4M A;  2R7V A;  2CFO A;  3VV0 A;  2R7U A;  2GOM A;  1LDK B;  3VSK A;  2RFI A;  2WAQ A;  2BVL A;  2KMU A;  2HPM A;  4J00 A;  1ZKK A;  4E7I A;  4P5O A;  4NQW B;  5F59 A;  5KHD A;  1WJB A;  2VQG A;  3VDX A;  4J8O A;  1G8X A;  3QWW A;  4BDY A;  2X1E A;  3L2V A;  3CJR B;  1X1A A;  4F3Q A;  3OYJ A;  2DOA A;  1Y6I A;  4QPQ A;  5JJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...