3S8PA

Crystal structure of the set domain of human histone-lysine n-methyltransferase suv420h1 in complex with s-adenosyl-l-methionine
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
263
structure length
233
Chain Sequence
MSAKELCENDDLATSLVLDPYLGFQTHKMNTRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKEHVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEENMLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYTCERRGTGAFKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase SUV420H1
publication title Crystal structures of the human histone H4K20 methyltransferases SUV420H1 and SUV420H2.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 60
structure length 233
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1700 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3s8pA01
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s8pA02
1ZKKA 4RZ0A 3M56A 3RQ4A 2BQZA 5EG2A 3QWPA 1MUFA 5JINA 3DB5A 3S7JA 5KJNA 4AU7A 2O8JA 5F6KC 3F9XA 5ARGA 3RIBA 3M55A 3CBMA 5KJKA 5EX3A 3OPEA 2G46A 3FPDA 3M57A 3F9WA 4NJ5A 4J7FA 3S8PA 2W5ZA 2QPWA 2R3AA 4QENA 3RU0A 3M58A 2W5YA 1ML9A 3CBPA 4IJ8A 5TTFA 3TG4A 4LDGA 4YNMA 3SW9A 4FMUA 3CBOA 5HQ8A 4H12A 3QWWA 3IHXA 3S7BA 4J7IA 3S7FA 3BO5A 3PDNA 3KMAA 4I51A 3M5AA 5HI7A 4J8OA 4MI0A 4YNPA 1N3JA 3M59A 2RFIA 4YPUA 2F69A 3OXFA 4YPEA 4WUYA 4YPAA 3OXGA 4QEPA 4IJDA 3K5KA 3OS5A 5LSXA 5TEGA 3EP0A 3OXLA 5AYFA 3SWCA 2IGQA 1N6AA 4JDSA 5KJMA 1O9SA 3VUZA 5JIYA 1MT6A 5F6LA 4MI5A 1H3IA 5LSZA 5F59A 3OOIA 3MEKA 3KMTA 3QWVA 3DALA 4Z4PA 3MO5A 1PEGA 4JLGA 1XQHA 1MVHA 5CCLA 4BUPA 5CPRB 5CCMA 5KJLA 4QEOA 2JV0A 3S7DA 3N71A 4NVQA 3M54A 3M53A 5T5GA 3TG5A 3RAYA 5ARFA 5TH7A 3MO2A 4J83A 3HNAA 3F9YA 4E47A 5T0MA 5EX0A 3MO0A 5T0KA 3RJWA 5JHNA 5JJ0A 1MVXA 4O30A 3F9ZA 3KMJA 4C1QA 1N6CA 4O6FA 4YNDA 5F5EA 3VV0A
chains in the Genus database with same CATH superfamily
5DD4A 2QQAA 3RQ4A 2L9VA 2WADA 3PNYA 2QCOA 1E3OC 1XSXA 2OCEA 3QP6A 1VQLI 2HPIA 1U5TA 2ZXJA 2CQQA 2A69F 4RLFA 5FLVA 2NS0A 3BZCA 1GVDA 5F0FA 3DF8A 1XD7A 3WU2C 5M3MJ 3TOAA 1BN5A 5KJKA 1KU2A 4FISA 1S72I 2A5WA 2EBIA 3Q0WA 4PJJA 2O61A 5LEKA 4AIJA 4IHTA 1OCCH 4ZZLA 1XMAA 5E17F 5ICCA 2BY1A 4A5NA 3HUGA 4BE1A 4EJTA 4L0YB 2W5ZA 5HLTA 1T98A 2ME6A 2M0CA 2R3AA 2E19A 3C2BA 4HSTA 4M3GA 4PUSA 4HQEA 5B3SH 3ELKA 2E71A 2AXTC 3X2QH 2KJCA 4P5OA 2JRMA 1F36A 5E3LA 2PMZN 4ENKA 3CDHA 5DDGA 3K1MA 4PJ0C 1YX5A 2WAQN 5E18F 1FC3A 1ZREA 3KYLA 5HQ8A 5E8GA 3ZMTA 1XGNA 1B8IB 4FX0A 4B47A 5J40A 1E0EA 2LY1A 2HI3A 3ABMH 4HNUA 2X48A 2DFHA 2EFWA 4L18B 4P1WA 2DMUA 4FQGA 4I51A 1TTYA 2W84A 2LOOA 2DK8A 4BHPA 3GTPJ 2GQQA 3I55I 1UG2A 3HPGA 1HW5A 3QPLA 1LKXA 2XAQA 1T39A 1FYMA 2M87A 2C6YA 4EJWA 1B9MA 2DA3A 3OIPA 2M45A 1K7AA 1XDSA 4U0VA 3FXLA 1MH3A 2Z3YA 3Q9VA 4HV6A 2CV0A 3A03A 1T08B 5F59A 1XGMA 3OOIA 3OR1C 3P9CA 2PFBA 5TGTA 2GXAA 2TDXA 1YX3A 4HBLA 5AIPA 1FNNA 1QPMA 1OFCX 1R23A 2LVSA 5DCMA 3K70D 3C2GA 4RB3C 4BXXJ 1DGRM 2ZJPF 4C3IJ 3WTZA 1KU7A 3ZXSA 4O6JA 2H6BA 1VTNC 1G3YA 1JTYA 4J83A 1ZYRF 2IS2A 5JJ0A 5BPIA 2ID3A 3MAJA 1ON2A 1RZ4A 1RIOH 3DPTA 3KZZA 3TP0A 1R6RA 4L0ZB 4JK1X 3VV0A 4X0GA 2NVXJ 4MNUA 4Q47A 3CCYA 4Q5SF 3M56A 2QQ8A 2M1BA 4RM3A 3BY6A 3QWPA 4A3CJ 1G2HA 2HKOA 1D5VA 3CLOA 2A3SA 2R7OA 1ZN2A 3QQAA 4IL6C 3OWTA 3M55A 2DOEA 1Z7LA 2JN6A 4HNVA 3CCMI 2J5PA 3N4MA 1IXSB 2ZJ2A 3LSPA 1EF4A 3ASOH 1LVKA 4DQ2A 3P9KA 4GYGA 3ZPLA 3GWZA 3M57A 2X6WA 4IRGA 4M9XA 4F92B 2CV1A 4I2OA 3B02A 5LGUA 3GFIA 1X1PA 3CMEI 3A4CA 1ZK8A 4DGWB 5CQEA 1MMAA 1Z3YA 4ZJZA 4BYYA 1R4NB 1P7IA 1ZLKA 2VLAA 4ABZA 5TRDA 2YS9A 2Q2EB 5A2QK 5JI6A 2W48A 5IYCJ 1J2XA 2LF7A 1AA7A 2V9VA 2HVRA 2RAEA 4LIUA 1Y6IA 2DQRA 1USTA 4BXFA 3BR3A 3TO9A 2GOMA 2L7MP 4OU0A 1RKWA 2RNGA 2HOEA 4CCKA 4EM1A 2RGVA 1IGNA 2V1UA 2VPLA 4KICA 3B6CA 2QUFA 4BBRJ 1BBYA 4XRFA 5E79C 5LBQA 4WUYA 1UHSA 4IPAA 3I4PA 2XGCA 4II3A 2W00A 3M9AA 3K5KA 3QYBA 3A2KA 4HLXA 1IW7F 3ISPA 4QWQA 2M2EA 1FOWA 2X1EA 3WTXC 1B9NA 3PNTA 4QPOA 3LSGA 1IUFA 5D4RA 2KISA 2XKPA 1D0XA 3GLLA 5FB2A 1VFCA 2IGNA 2P5LC 3A01B 3MEKA 3VODA 1R22A 3SHFA 1E2XA 4RB1A 4HDVA 1J5YA 2R3SA 3J7YJ 2L4AA 4G6QA 1HXDA 2R7WA 1YIJI 2WAEA 4GGGA 1IN6A 1MKMA 2YX4A 3LSKA 3SDBA 2IA1A 4S05A 2FBIA 1NH3A 2FX0A 4AVPA 2M8GX 2EV6A 3U21A 3BJAA 3R6SA 1IXRC 5AIQA 4UUSB 1R5ID 2P5KA 2XV4S 3E6MA 3F9YA 2VUMJ 1USSA 5DS9A 5JHNA 1RKTA 4UV9A 3MZHA 3BLYA 5ED4A 2LYCA 1Z6RA 2PMUA 3CDIA 1QNTA 3U1KA 1ZKKA 2BV6A 1HKQA 3AKZA 1MUFA 1R58A 4YEJA 2DI3A 2XPVA 3J7AO 2W4SA 2PEXA 5EEGA 1JI8A 3R60A 2WY7Q 5BNGA 3F8CA 3V8JA 4E7ZA 2XRNA 1ZG5A 3OV8A 2GXBA 3BR1A 5JLXA 1FYKA 2K9MA 2XPWA 2FU4A 4EJUA 2A68F 4JX5A 2QQBA 1ETKA 2J5OA 3P7NA 4OMZA 2BXZA 3Q0VA 2NVYJ 2X9DA 5LHGA 2LNBA 3WU1B 3SEQA 2KP6A 2F4OB 1AKHB 3K4NA 2M7AA 3EUAA 3TW7A 4HX4A 4EGYA 3R61A 2XB5A 2M5WA 1X1AA 3FMQA 2CFOA 5TTFA 4CICA 4G94A 1OKRA 5E8IA 3WTVC 5F64A 4XLFA 2HWVA 1RR8C 1DU6A 1JUPA 5BPDA 1S5LC 4XIDA 3E5UA 2OA4A 1HCRA 1VQ7I 1TZLA 3H35A 4YG2F 1WZ2A 1GV2A 3F6VA 3GFLA 4KMFA 1Z1DA 2KL4A 2E1MB 1JT0A 1J7KA 5FD5A 3H9GA 1B8IA 3JRHA 1I6HJ 4XICA 2FXAA 2JPBA 1FIAA 3I5UA 2CGPA 2AQEA 3M1CA 5EYRA 1G3SA 3HZJA 4CYCB 1IUYA 2W25A 3GZ5A 1OR7A 2LP0A 2VBYA 4FASD 1MBEA 5JFRA 3G4SI 2I5UA 1LPQA 3J80Z 3OMYA 2FOKA 4ZC3A 3BQYA 5E3OA 5KJMA 2P8TA 4J01A 4Y52J 2V9KA 3OR2C 4YIFA 2WBMA 1W4MA 1O3SA 3GO5A 3HDDA 3S2DJ 3GXOA 2LF8A 3RCOA 4ZYDA 1ZHFA 3WGIA 1T38A 5CPRB 3FXMA 2QYOA 3Q5FA 1DU0A 1TWGJ 3H0GJ 3V7SA 3B6AA 1MMNA 3D5LA 4W1UA 4E47A 3SJMA 3DKXA 2E60A 4HF0A 1XCVA 2KDOA 1R49A 3KPHA 2W57A 3L2QA 4C2UA 4FE7A 3KMJA 3HBLA 5CKTA 3OIQA 4XLNF 1S29A 6PAXA 3I59B 3BCAA 3BJOA 1GT0C 3WU0A 2LBFB 3Q9SA 4Y4RA 2HOAA 3ASNH 2XIGA 2FE3A 4A3MJ 1LQ1A 2H27A 2CS3A 2E5NA 2OTLI 5JINA 1FT9A 1B72A 5FLXZ 1YJWI 4XKCA 2WAFA 3ROUA 4YIIA 1JKQC 5TJJA 2MH2A 3KP2A 2K4BA 3LFUA 3IH2A 4M9ZA 3OSGA 2VQLA 3HL2A 5LGTA 1K4TA 3G3ZA 2ICWG 1VQMI 2QSGX 1HW1A 3HSRA 4WX9A 2MC3A 2BXYA 3T5XA 4P9UA 5ILSA 3HTUA 4C2TA 1R5GA 1YIOA 4KNYA 3M58A 2KRCA 1MMSA 2L5QA 3F9KA 5E1XA 2BBYA 3PSIA 4AIDA 5TISC 5A2QZ 2W24A 4BNCA 5FRMA 3ZP5A 3SW9A 3RPQA 5DUIA 2I8DA 3T0YA 1R5HA 1UFMA 3RIRA 1U0JA 3GFJA 4B8XA 4RAFA 4G7ZF 4KISA 5IY5H 2Q2EA 4UY8I 1RESA 3OYBA 5LGNA 3GBGA 4D7MA 5BOXA 2NAZA 1YLFA 2UZKA 5HI7A 4HLYA 5E3NA 1R71A 3ABTA 2DJNA 2P81A 2P6SA 4Y7NJ 1HLVA 2FQ3A 2H1KA 4JP0A 3EPZA 3WG7H 3PJRA 4YPAA 3MFKA 4D5CA 3ZR8X 2IPQX 3I4NJ 3OYFA 1U5TC 4FTHA 3S3MA 4MO7A 4MTDA 1EV7A 3BR6A 3I71A 1U78A 1NK2P 4DYCA 1YJ9I 3C18A 1PP7U 3LSJA 3GTMJ 4S04A 2VKDA 2O9LA 1ULYA 3DWLE 2QVOA 3ZMSA 4UXNA 1NK3P 2QF7A 4II2A 1U9OA 4UV8A 4L9NA 4E7JA 2PJRB 4U0WA 1W7PB 1FLIA 2L02A 1YG2A 2RNJA 1BC8C 3PUFA 2Z99A 3EDPA 1PYVA 5ICFA 3A01A 2R7TA 2HDWA 3MO2A 3MVPA 3CMMA 1YITI 4BBSJ 1W36C 1WJBA 2D2WA 2DA1A 2X6OA 3C2HA 4E7IA 5EX0A 2ELJA 3F9ZA 1X2MA 2DTZA 4C1QA 3AG2H 4XR6A 2G7UA 1TWAJ 3FK7A 3LSRA 3CC4I 4UUSA 5B1BH 4ESFA 5CQGA 3RI4A 1XMKA 2K02A 2IS4A 3CUQB 4UB6C 4IHXA 2CU7A 1CF7B 1LJ9A 1FTZA 4N9HA 1FTTA 2GOXB 2MABA 4M3EA 1JKRC 1EH7A 1BI3A 2LY9A 4BJ6C 4F55A 3GTGJ 2OU2A 5KJNA 2K4JA 3OL3A 3D0SA 2FSWA 4B44A 5KHDA 1E17A 5CLSA 2R7QA 2JA7J 1MZBA 5EZHA 3KE2A 4QPQA 2OC6A 1ZGAA 4DYRA 4D1QA 4EM0B 2OBPA 5FRNA 3WTYC 1ORKA 4AIHA 2PI0A 2OZ6A 3FPDA 2EFOA 2E35A 4BQQA 3SEZA 2M9HA 2X6YA 5HODA 3G1MA 2CW0F 1FIPA 3L2UA 1YW8A 1XN7A 1RUNA 1SFUA 5CVVA 1P2FA 3LQRA 1MBHA 3F72A 1HDDC 4HA8A 5F0HA 1MSEC 1OQYA 1A35A 4N9IA 2UXNA 2IS1A 3LWFA 4MEYF 1YRNB 2ZSIB 1G3TA 4IQ4A 4OOIA 1KU3A 2KRHA 2R4GA 2V26A 3L2CA 3RJPA 1S7OA 4Y17A 5M5WJ 4CZCA 2O0YA 3ZQCA 1QZEA 2XF7A 4F7ZA 4CGZA 3S17J 1DPRA 4IHVA 2DA7A 2JZYA 3HOZJ 5DYMA 3TP3A 2Y31A 3EETA 2ADUA 4PSXA 4ZTJA 4A93J 2BY3A 3H3UA 3VYUB 2X6XA 2H6CA 4ZTFA 1K78A 4RMNA 2LD5A 2Q8KA 3HPHA 2JTVA 4HW0A 2D1VA 3OS2A 1MT6A 1FMVA 4LGWA 5D5XB 4CYCA 3OYJA 1HC8A 3ZQ7A 5GADJ 4UVBA 3CF2A 2E7XA 1KQ8A 2H09A 1X3ZB 3IH3A 1VNDA 3E6BA 5LD2C 2ZXWH 3DALA 1X4PA 2HOTA 1PEGA 3CO6C 4JLGA 1W5CC 4NC6A 4XLHA 4WK8F 4LB5A 2RV8A 1ZG1A 4U7BA 4WXDA 4XOPA 1NG6A 1EKEA 1MJ9A 4DBQA 4G7HF 3QRFF 4CCJA 3S7DA 3TDZC 2Y30A 3HB9A 1W0TA 1UAAA 3OIOA 1X1DA 1WJCA 4YIRX 1XSVA 3WTTC 3JRDA 2FD5A 3DKWA 3UNGC 1IN8A 3BCBA 1A5JA 4FCYA 3IRQA 1SVLA 3MKWB 4G12A 4P96A 1MDMB 2OTJI 3HGYA 2GLOA 3BTCA 2JUCA 3DQVC 3KYCB 2WV0A 2CG4A 2Z5UA 1MMGA 1ZARA 2R7RA 1RUOA 1I6XA 5CVJA 3HSEA 1JTXA 1IJWC 3CUOA 3ABKH 1WJEA 2F5VA 1F1ZA 1F4KA 4CZZA 3DB5A 3ESWB 1Y0UA 2JUGA 3MN2A 3NRVA 3F22A 3I59A 5F6KC 2LBFA 2GIVA 2NXNB 1WJDA 3K0LA 4RAZA 3E97A 1TQMA 5J1RA 2L3DA 3FHZA 4O3MA 4MTEA 4F93B 1ITYA 1X1BA 1WH5A 2F5DA 5HS9A 3F8MA 2HYFA 4KITB 2V79A 2ISYA 2EWNA 4RS8A 1OCTC 3QPTA 2DCEA 1K6OA 4YFXF 2L0KA 2IP2A 2MD0A 3DPUA 2YU3A 1FMWA 3S3NA 3S2HJ 1S8NA 3OYNA 4FE4A 1BA5A 5IP9J 1XB4A 3F6OA 5KNLA 2DFIA 2PMZA 1LDJA 1TC3C 4YNMA 4GCVA 2WAQA 3HOWJ 3S14J 5FJ8J 1GLNA 4CUGA 3RZOJ 4I98B 4DYQA 5J8CA 3IH4A 1B6AA 1W0UA 1ZRDA 3IHXA 4RLQA 1FEXA 2KMUA 3MKZA 2DYSH 1ETOA 2FOWA 3ZN0A 2A6HF 4CDGA 4YPUA 4V19K 5EZGA 2VJJA 2DBBA 1ON1A 2E34A 4FT8A 3LA2A 3OS5A 4ZYGA 2CUJA 3HOYJ 5LSXA 3S3OA 3CCLI 2DLLA 4DIQA 5GP9A 3ZQLA 2YUSA 3IWFA 2R7XA 1MD0A 5L3FA 2HR3A 3FBIB 4MI5A 5IYBJ 1W5TA 4I09A 4ITVA 3NWTA 2CFXA 2EV0A 4KUMA 3HIFA 1VQ9I 3N05A 5KAIC 4H0EA 2XAGA 1R1UA 1BR2A 3KMTA 1IZ1A 3OYEA 2JT1A 4DOZA 1I50J 4Y3OA 2YPRA 1XGSA 3GUDA 4XLAA 4KN7X 2R5ZA 1VQKI 3AG1H 2XB0X 2EFQA 4CCOA 3JAMK 2EA2A 2H8RA 3J80K 4IEJA 3K70C 5DCFA 1W7PA 4F52A 1JXSA 5IP6A 2DPDA 3OYIA 4X6AJ 2V1DA 1ZR4A 2DFEA 2VN2A 3T8TA 1WSUA 1PUFB 4XK4A 4OINF 1G59A 3J7ZI 1SAUA 2FJ1A 3K4BA 1SMYF 2NOJB 4ENMA 2RKHA 1HOMA 2F5CA 2F48A 3BG3A 4XORA 2O03A 3ABUA 1LE8B 3I4MJ 1K6YA 2KKOA 5GPCA 2IGOA 1J9IA 3QWLA 1WRJA 4WCGA 5E1ZB 3MMYB 1QZZA 3K1PA 3PNVA 4DW6A 3F9XA 3CUQA 5JHFA 4V2GA 1Y0NA 1Z0XA 1P4WA 1OR7C 1CF7A 2LR8A 5HLGA 3P9IA 2ZFWA 4B09A 5EX3A 1OCOH 3CMYA 1D5YA 3SXYA 2VBWA 4WF2A 1ZLJA 3KP4A 4NJ5A 2PQ8A 4KA4A 2HEOA 1HKTA 4QTRA 2A5YB 4E6KG 2PJPA 3ERMA 1FPQA 1J09A 1UMQA 3ZQFA 5FLXK 4CA0A 2H8WA 2AS5F 2K85A 3LA3A 1BR4A 2HDDA 3CBOA 3J7AY 1IF1A 3E3VA 3S32A 3GW2A 3I0TA 2BYVE 2LH9A 3DU5A 4ESJA 3R0AA 3TKYA 3OS0A 2EZHA 4D7NA 5LFAA 3WODF 3MKYB 1MSFC 1YRNA 3MWMA 3FZVA 1TWCJ 3T8RA 3KZYA 3OXFA 1NG7A 2DA2A 1H8AC 3TMOA 2LKSA 4L5IA 2LRDA 3SWCA 2KJBA 1N6AA 1H9GA 3CP2A 3C3WA 3VDXA 4IHWA 3OYGA 5JIYA 3DV8A 4AWXB 1WJ5A 3OOPA 1H3IA 2CO5A 2HVQA 2V6CA 3HC7A 1F43A 1Y1VJ 1FY7A 5ILUA 2JA8J 2VB6A 3CQZJ 1D3YA 2MLKA 2M34A 4M3BA 2FNPA 4HSRA 3WGGA 2HYGD 3NAUA 1MNEA 4HAMA 5IT9Z 3KX2A 1JUMA 3ZMDA 3COAC 1U8RA 2ELKA 5LHIA 2DQLA 4B48A 4C3HJ 1I1SA 3HNAA 2KZGA 2OAZA 3BP8A 3MO0A 5T0KA 3RJWA 3BOQA 1SVOA 2IW5A 4N4NB 1ACIA 2Y0SN 2L9SA 3L2VA 3OYHA 2VKHA 4E4HA 3L2RA 3WG9A 5IPAA 3DXJF 3QU6A 3TQNA 2FNAA 4XRSG 3AG3H 3S93A 3I53A 3H0DA 3A02A 1VI0A 1ZGWA 2ZJQF 2QKLB 4LITA 4WWCA 1MDMA 1JHFA 1K83J 2WB1N 3CJTB 4IRHA 3S7JA 1JJ8C 1JGSA 3P5JA 3RIBA 2IBDA 2XF5A 1WJFA 2GA1A 4MGRA 3PQKA 2HZDA 1MBKA 5GTHC 2MBFA 1BM9A 3O3KA 2HZTA 2G46A 1K4SA 2WTEA 1P7JA 2CQ7A 2FUG2 1IN4A 2FA5A 2LC2A 5EEHA 2A05A 4ON0A 3V7CA 4D0PA 2L01A 2NYXA 1QZYA 3KP3A 3QU3A 2P0WA 2RREA 5GAEJ 2QPWA 2F5EA 2K27A 2XHKA 4C9YA 3AAFA 1A04A 5E3MA 3OYKA 5FKOA 2MYSA 2UUZA 2ZKZA 3DPLC 3E0JB 5J47A 3KCCA 4HYEA 5DM7F 1SANA 1XTAA 2K86A 3TGNA 2IXSA 2AXLA 3BTLA 4IXAA 1TT5B 2K9QA 4L9VA 4LD5A 4LOCA 4FMUA 1N75A 3ONQA 3RPUD 4A3FJ 3HRUA 2Y69H 3HTSB 4LFUA 5M5YJ 3S7FA 4AYBN 3PDNA 4BQOA 2KHMA 1FJLA 1U6GA 3ZCOA 1S6LA 1A31A 4E7KA 2XVCA 4XSXF 2M8EA 4BQNA 3WTWC 1W1WE 2ZXIA 3TOBA 4ZDPA 1V55H 3HM5A 4GXOA 2B0LA 3MKLA 2QWWA 3JRGA 5TEGA 2AHQA 2YSRA 5D6FA 3EP0A 1ETQA 2Q0OA 1MJBA 4R8HA 3BWGA 4M74A 5ICGA 4JDSA 2NNNA 2DK5A 4EGZA 1S7EA 1LFUP 3K7AJ 1VQ8I 3CF5F 1EA3A 2DN0A 5F0CA 4Z2YA 1FSHA 2CW8A 4EV0A 4KIBA 4MEXF 3SFZA 2D1HA 5GAGJ 3IP4B 2R7DA 2STTA 3NWSA 3ML6A 3ZQGA 1OMIA 2NS7A 1IV8A 3IAS2 4FX4A 2X1DA 1ZRFA 4QEOA 3IAM2 4YFNF 2GM4A 1TBXA 4A5MA 2P7CB 3MZ8A 2KZVA 3ABLH 5EGOB 5LLQA 3JR9A 1VQ6I 2Z16A 3JAMZ 4HPQA 4BQAA 2WA0A 2DT6A 3L09A 2M3AA 3IV5A 4HG2A 3BZ6A 4G8XA 3WHBA 3G2BA 3HOXJ 4HQMA 4O30A 2P7VB 5E1WA 1GV5A 2HTJA 1B4AA 3VYSB 3ZGKA 1P4AA 2GZWA 5CYVA 4CCNA 3RYRA 2CUZA 3MQ0A 4BDZA 3HKZN 2ELHA 3O6BB 1UCRA 1TL8A 1ENHA 3LSMA 1PUFA 3QAHA 3FK6A 1G6NA 3G6EI 4LLNA 3GX4X 1SD6A 3V7RA 2JMWA 5ARGA 3IWZA 2ZNZA 2HTSA 2E1MC 4PCQA 5H6RA 3D1NI 1LE8A 2XGDA 5HLIA 2DMTA 4BKXA 1QQIA 3JRFA 1FZPB 5B66C 1JKOC 3E6DA 3ZQQA 2ZJRF 3KP5A 1AHDP 4CYDA 3SFIA 3GEZA 4PDKA 3F9WA 4C3JJ 4BY7J 1HKSA 2DA6A 4RGSA 2VONA 2BVMA 1WWXA 2X1CA 2ACJA 2W5YA 4XM3A 3ZQIA 4ENNA 3CBPA 1C0WA 4GO1A 4I01A 3E5XA 1TWHJ 3DEEA 4NC7A 2JWTA 1UELB 3I58A 5IYDJ 2HYJA 1WGXA 5LHHA 2NRAC 4BE0A 5F1JA 1V54H 3M8EA 1FP1D 1UHMA 2ESNA 3V8LA 1MGTA 2ETHA 3FBNB 1BI1A 2DDAA 1OISA 3L00A 3QPSA 3LAPA 4YNPA 2RFIA 4XMYA 3ECOA 5FD6A 1YFHA 3HOUJ 5H2FC 1FOYA 4L5JA 1DQUA 1KA8A 4OMYA 2CYYA 2R7UA 1P9QC 4N0BA 3W2AA 3OYDA 1KYWA 4XONA 3WTUC 1JGGA 1HSJA 2AO9A 4CHUA 3H3VK 1QPIA 2H94A 5D5VB 4PJMA 1YE9A 4AVZA 4M73A 2OQRA 4MFDA 4YFKF 1MW7A 2ECBA 4RGXA 3HJEA 4ANJA 3WGHA 2Y9YA 3BQZA 3CCVI 1T8IA 3HRTA 1O3RA 5GTIC 4C30A 3IKVA 1SD4A 2MSYA 1IV6A 4H4KC 4BE2A 2ZC2A 2Z1DA 3EQLF 3HRSA 2K40A 1T56A 4M3FA 5ARFA 4NQWB 3R4KA 4I76A 1I39A 2LK2A 1EH6A 3CD6I 1YYVA 3I64A 1ETVA 3HGGA 4Y33A 4N4OB 4BACA 5F5EA 4NUBA 1R00A 1JJ6C 2OPTA 3BPVA 4BU2A 1ZRCA 3DFGA 4IZZA 3FXUA 2ISZA 1YW7A 2EINH 2KRFA 4OWRB 4Q48A 2GIZA 2KPMA 4DBRA 1LVAA 4XBFA 1DUXC 2O8KA 4U7DA 3LL7A 1RNLA 1FSEA 1D1BA 3W3CA 2JQ7A 4R1HA 2A61A 1YHQI 5D8KB 1D0YA 2VT3A 1SMTA 4ZH4F 1N25A 1XDUA 1XPXA 2KDZA 5F1RA 1D0ZA 4PGHA 1YOVB 5B1AH 1DP7P 1HA8A 1LEAA 4A0ZA 2IJLA 5FKNA 3DU6A 3CJRB 1MH4A 1H89C 4QLCU 2Y48A 1ONVA 4B43A 2RQPA 3L7WA 3M1EA 3VB2A 4PK4A 4ASNA 1V5GA 3M4OJ 3DKYA 3K4JA 2HQAA 1KQ9A 2L9RA 1KQ0A 1SD7A 2IEKA 2V9PA 2XF6A 3F3XA 3GFMA 5FFXA 4AIKA 4RGUA 1FOKA 1XCBA 4XKWA 4O5VA 1LDKB 4LDGA 2XC7A 2FEZA 1BL0A 5J6XA 2LREA 1KGSA 4DNCA 1BI2A 3FIWA 5ICEA 2H1LA 4J8OA 4HNTA 5K7ZA 4MI0A 1V5FA 1N78A 3PQJA 2XAJA 4UUVA 4U88A 2FF4A 4YPEA 2CUFA 1GXQA 1STZA 1WCMJ 2Y9ZA 2IT0A 3WE2A 3GMEA 2E2HJ 2IGMA 2ZSHB 1TNTA 3OL4A 3ZRGA 3KEYA 4GYIA 4G6DA 4U87A 1AKHA 3W6JB 2VXZA 2HXOA 3BZKA 1F5TA 2E1CA 3FMSA 3CUQC 4JQFA 1E3HA 1PP8F 1RR7A 2XROA 2F5FA 4B1RA 2AQFA 2DT5A 5LSZA 3ZOBA 2BGCA 1EJ9A 3HSFA 5EG0B 2DODA 4XN3A 5E20A 4IHYA 2DO7A 1O7FA 1YO5C 4ZYAA 1XX5A 5CCLA 4NDLA 3ECHA 4RB0A 1IN5A 2VE8A 5KJLA 2JV0A 3PUBA 2FQ4A 1QO0D 1T0FA 1G8XA 4IRIA 3S2WA 5T5GA 4XLPF 4ETSA 5K5QA 4G6TB 3D5RC 3M8JA 5T0MA 3IC7A 5KK1A 1MVXA 3UKGA 2VBXA 3M8FA 5EGOA 5KVRA 4XQFA 2MFZA 1D8JA 3VOEA 3BC8A 1XG1A 5C3EJ 4HV5A 1QHHD 4PGGA 2QEXI 3W6VA 1APLC 3O8HA 4RZ0A 2BQZA 1OYIA 1U3EM 3H5AA 2LSOA 4XLEA 3QPHA 5KAFC 3IUOA 3QODA 1ERDA 3LSHA 1V5EA 1IXCA 1WI9A 3FM5A 1OPCA 3CDLA 3FWEA 5IT9K 2GXGA 3CBMA 2VI6A 1ZG3A 2OZUA 4B4CA 5L3BA 1IRZA 2EPFA 4IX7A 2V4JC 2ZNYA 2XSJC 2VQGA 1IG7A 4LJZF 3JRCA 3VEPA 1OLTA 3A0BC 4F3QA 1TQIA 3DBLB 1ETXA 1SD5A 2VQHA 4AM3A 4S0HB 1BC7C 3M3YJ 3H36A 1FX7A 1P4XA 2L7ZA 4L9JA 5J3LA 5L3EA 3HOSA 1U8BA 1TP4A 4EEFG 3VYRB 3CCRI 3N97A 5JVTA 4IJ8A 2MD5A 3GVAA 3NQOA 3TG4A 4CSWA 4BGDA 1WJAA 4HX8A 4MQVA 3V4GA 1LEBA 5HS7A 1Z77A 2EIJH 2ID6A 1QVUA 3RDIA 4OIPF 5C4XJ 3K2AA 4LB6B 1CQTA 3K4CA 3K4LA 3S7BA 2ZB9A 1L3LA 4G9YA 2NS8A 2VJ4A 3PSFA 2CSOA 5M3FJ 2WV1A 3M5AA 3PO3J 3LAJA 2ZO4A 5EEAA 5K7HA 1N3JA 4G7OF 2E5ZA 1I3AA 2ZCWA 4FETA 1T95A 1PJRA 4BJ5C 3OXGA 2CQKA 2BHYA 2LLKA 2NVTJ 4QEPA 4IJDA 1FOXA 2QM3A 3SZTA 1ODDA 3OXLA 5AYFA 1RPWA 2W1OA 1XC5A 4Y13A 3M07A 5DUKA 1OCZH 3A0HC 4NB5A 4IOCF 5HDGA 1O9SA 1TW2A 4CCMA 4A6DA 3U2RA 2XKOA 3KFWX 1LB2A 2CQXA 5DEQA 3QYFA 3BJ6A 1WFXA 3D5SC 4HZFA 1P6RA 1ZGJA 2PN6A 2HOSA 1G3WA 2QA4I 1QGPA 2M0MA 3OOUA 3BG5A 3ZN1A 5BMZA 3CJNA 3CTAA 1IO2A 3TO7A 3I9V2 2QSHX 1BOAA 3QP5A 5DTDA 1O3QA 3CCSI 3M54A 4Q4ZF 4KT6A 1R36A 3JSPA 3B73A 1KZHA 4D5FA 3O2PE 4XLCA 1QHGA 1UG0A 3GTOJ 2A07F 3PM1A 2V1XA 5C44J 4MLOA 1N6CA 2YR2A 4YNDA 4NQWA 5IP7J 2O5RA 3GZNB 2EQRA 2R7VA 4JX4A 2EILH 2R92J 2RC4A 4DZJA 2F4IA 4IF4A 1TW3A 4IKFA 2X85A 1HBXG 4UVCA 2R5YB 4GFBA 2K3FA 2DDBA 1R1VA 2OD5A 3GYHX 2JA2A 1JUSA 3FF5A 4E7HA 1R4MB 4NC8A 2QBYB 2WC2A 1K79A 2HVSA 1D1AA 2HS5A 2PJRA 4IOAF 1I5ZA 1Z3XA 3K1NA 2P6TA 5H20A 4CXFA 2L7KA 3W2VA 2DFFA 3HYIA 4J7FA 4KMUX 2YX7A 1XGOA 4OIRF 1REPC 2V7FA 3F0CA 1IC8A 1X58A 2RQQA 3BR2A 4UUTA 3K69A 2Y2ZA 4LLGF 3U9GA 4A3DJ 1BW6A 1FWZA 1OCPA 5FGMA 1IRGA 4XSZF 2DXIA 3ZQHA 2DMNA 3K4KA 3DBHB 1AU7A 1A6QA 4DJAA 3JRBA 1B59A 1LFBA 3VYTB 3KIOA 1BW5A 3J81Z 4H12A 3QWWA 1K61A 2LMDA 2JVHA 3KETA 3ULQB 1IRXA 2EFNA 3BO5A 2K3PA 2ESHA 3IKTA 1JT6A 1Z05A 1BJZA 5L3GA 1MMDA 2GWRA 2JSPA 4PJNA 2EB7A 2K9LA 3M59A 2DW4A 3HRMA 5HVQC 5F27A 3SZGA 5GAHJ 2PG4A 4YELA 2IGKA 4IHSA 2BVLA 2COMA 2X4HA 2B7EA 1BOBA 4KYWA 4UB8C 3AFHA 2DT7B 4GDFA 1Z21A 1Y39A 1ZKGA 2O7OA 2G9WA 5JLWA 4UNOA 1KU9A 3VUZA 2NNYA 2XDVA 1B72B 2NOGA 3I54A 4OIQF 3MCZA 2E7WA 1HF0A 3K6GA 2FMYA 3KP7A 1LUJB 1X3WB 3M7GA 1XQHA 3U1DA 2KQRA 4RAGA 2ECCA 4BUPA 2Z2SB 3LMMA 2G0EA 3TW6A 4BH9A 1OJLA 2VT2A 1RI7A 3LOCA 5EG0A 1V4RA 5FROA 5BS6A 3DTKA 3M53A 2IA2A 4A6EA 3V42A 2XUBA 1ZH5A 1NHAA 4BL0B 5D4SA 5TH7A 2BY2A 3W6KB 3L2WA 3F23A 1Y8RB 3R0JA 2IS6A 3LSTA 3MD2A 1ETWA 3F8FA 1VF9A 2DA5A 3FXKA 1T2KA 3H92A 2M30A 2Y0SA 3MEXA 4WXCA 5ILVA 3L1PA 3GTJJ 2IRFG 2DPUA 1VQNI 2RVCA 4BXUA 3RKYA 3KZIC 3O8GA 2VODA 3CMAI 1O7LA 1QBJA 1LDDA 1J75A 2QQ9A 2MW8A 4PZJA 3PIOF 4KJZA 1QVTA 5K5OA 3EUKL 1JE8A 2OUMA 2WB1A 2XAHA 3FXQA 4PFOA 4B3XA 3E1SA 4MIMA 1SFOJ 5L3CA 2LG4A 2D45A 1JKPC 3RZDJ 1LNWA 2A6TA 4L9TA 4M3DA 3JCUC 4HRIA 2VOPA 2K7LA 3QOEA 1Z7UA 3Q0UA 1MNDA 2STWA 4XL9A 5IOZA 1ETYA 4AC0A 4EM2A 1E3PA 3PIPF 3DLLF 1H0MA 9ANTA 2VKEA 1M1EB 5M5XJ 4A3LJ 2KFDA 3K4MA 3OYLA 2UXXA 5D6EA 3H9QA 4CCLA 2BOLA 2W85A 2HDCA 2HQRA 2R7FA 2K9SA 4BEHB 4I0BA 3BTJA 2BW3B 2QLZA 4QSHA 3KLNA 3H9JA 2O6GE 3K2ZA 3CCEI 4I7HA 3FXRA 3UR3C 1X4OA 3EUHC 3FXOA 2KIUA 3ZMVA 2MA3A 1SVMA 3Q3SA 4OAYA 3WTSC 2VPRA 2F4MB 1H9TA 3KMAA 3S16J 2IA0A 2P4WA 1XS9A 4AYBA 1GHCA 5BQTA 2UWMA 1J59A 2FBHA 1W5SA 4M9SA 3RKQA 1PUEE 3DTIA 2KT0A 5FKLA 4A69C 5K5RA 2JA5J 4RB2C 4BS9A 3S15J 3LFKA 4Z6YA 3KYDB 4QIWN 4LG0B 1BIBA 4HDUA 1V3FA 3CCUI 1POGA 2VJIA 2NVUB 4BHBA 5D5UB 4IQJA 4JBAA 1FP2A 1ZR2A 4A0XA 5HDKA 5CVRA 4K2EA 2F2EA 3IRRA 2VKVA 3VSLA 3BROA 1WQ2A 2COBA 3RYPA 1UB9A 2I10A 2EV5A 5CCMA 3LNQA 3SYTA 1SFKA 2M4GA 2EFPA 2HFHA 4HOBA 4ZYEA 3S1RJ 3DBRB 2ZFUA 1MBFA 2KIMA 1HDPA 1RETA 4TV7A 1QA6A 3HOVJ 3CC2I 2MC4A 3BTIA 3C1DA 1WPKA 2XPUA 2VQCA 4HF2A 2BY0A 1OYWA 2YU9J 5CVUA 4ESBA 4F91B 2QKMB 3TEDA 1XMXA 1JHHA 4O6FA 2O3FA 1O57A 1WH7A 5GPAA 3VFZA 1VQ5I 2XAUA 2E36A 1S3JA 3EYYA 2Y75A 4HEA2 1O4XA 3K10A 3HKZA 4RM2A 4A3BJ 1B1BA 4LLLA 1S7AA 2VBZA 1DDNA 4M72A 1L0OC 2VOOA 4DZPA 3LSIA 1KONA 3FISA 2GBYA 5J8FA 1TLHB 2VL8A 4AUXA 4M6YA 2R5YA 3OPEA 5L3DA 5HLHA 2VC1A 5K1YA 4BY1J 4OIOF 2QBYA 3OYAA 1MIJA 4B3AA 2UV1A 4M6XA 3KP6A 1K78B 2Z9OA 1U2WA 3H1CA 5K7FA 1FBUA 5F08A 2VXDA 3DEUA 2Y0MA 4I0AA 5DM6F 2QZ8A 3E5QA 1SC7A 3S1MJ 3S1NJ 4R79A 4W97A 3SDGA 3BT9A 2E1OA 1T0FC 3CCJI 1Y56A 1EH8A 4ZDOA 2XGEA 1Z67A 2EK5A 2E1NA 2Q1ZB 4XN0A 3PFIA 4IVNA 1YQAA 5EDNA 2HNHA 3I3LA 3DEWA 5F6FA 3SZPA 2FRHA 4KT5C 1KYZA 3AL0B 2WY8Q 4LK0F 1X19A 2K5CA 2ME0A 3VSKA 3NEUA 2L7FP 2LKPA 3VPRA 2ZMEB 4A0YA 3H5NA 1TNSA 2OF7A 3DTEA 2XASA 5CJ9A 4EJOA 5JR3A 2XSDC 3HG9A 1IDYA 4KN4X 3CESA 1AWCA 5C4JJ 2DMQA 5F6LA 4KIFA 1MBJA 3G73A 3ERED 2EZLA 1ZAOA 1OCRH 2L4MA 4EATA 4XRSA 1IAWA 1GDTA 5DD8A 5LRRA 4E70A 2GAUA 1ZQ3P 3QWVA 5JVGF 1MBGA 4Z4PA 2B9SA 2KIQA 2VIXA 4BJTA 1VZ0A 3AG4H 3E6CC 3NARA 4XRMA 1R7JA 4I99C 2WWYA 1U9NA 3L9FA 3N71A 3BG7A 4NVQA 2A6EF 2EH3A 3FXJA 1MJAA 2XGXA 1Z91A 4M71A 1SEUA 5KCMA 2MLGA 2CRGA 1AOYA 3RAYA 2QGUA 2L54A 1CGPA 3AL0C 1P92A 1ZTRA 1LFPA 2W7NA 4YRVA 1YS7A 3DCFA 4XKBA 2MH9A 2ZMEC 2IAIA 1BJAA 1O3TA 3CZ6A 2G7HA 1R9TJ 4PSWA 4D9JA 2DOAA 3CCQI 1U5TB 4E7SA 2M7BA 2OV7A 1OYYA 3RKXA 2DOFA 4I02A 3FDYA 5J4VA 4U0YA 4KIGA 2HQNA 3MZYA 2OJED 1IN7A 2DU9A 2CW7A 1GVJA 1A6IA 3BG9A 4ZDLA 5EG2A 3FHNA 3GCMA 2VE9A 3KLOA 5FO5A 4E7LA 3W2WA 2O8JA 3HUGB 2HGCA 4UVAA 1F9NA 4V2FA 5B5EC 4J19A 1D8KA 3GTKJ 3EUHA 1Q1HA 3FKJA 5J1UA 3V8KA 4IJAA 4C2MJ 3E7LA 4RA2A 1I1GA 3H3ZA 3S8PA 3RPUA 2RDPA 1T33A 2LTPA 2X0LA 5JHUA 2JK3A 1H88C 2B63J 2QSFX 5EJCA 5CVIA 5EF6A 3IL2A 2ZBKA 3S1QJ 4BDYA 2E2JJ 3FKIJ 2LFBA 2TCTA 1Y1WJ 2HPMA 3I56I 1IDZA 4A3IJ 3G1OA 3HHHA 3IHUA 5F04A 2EZIA 1SAXA 5HS8A 3GLXA 3CO7C 2PBIA 4BEHA 2BW3A 2EA4A 2RN7A 1RC9A 1Z6TA 2R5ZB 3BR5A 5IT3A 4RDUA 5AONA 3QOPA 1D1CA 3PL8A 4XKVA 2F69A 1ZELA 2CWEA 3TBIA 2GA2A 1X1CA 3FM3A 1A36A 3TL4X 1UJ8A 3BDDA 2VJ5A 3C7JA 4KFCA 3WHCA 3EYIA 2IGQA 3T1BA 2DAOA 2IVMA 1HSTA 3DLAA 4KDPA 3JTHA 1N77A 3HEFA 2JPCA 3J81K 4NHJA 4EQQA 4X1EA 4LIVA 2XAFA 5DCMB 4MHGA 4LG0A 2D5VA 1Y8QB 1Q1VA 3F8BA 2N8GA 1YTYA 5FKKA 3LA7A 1HQCA 2JSCA 2VASA 3H5RA 5HNHA 4MQ9F 3MO5A 1MVHA 1SFEA 1QRYA 2O8XA 3REOA 2PX9A 2DA4A 2DMPA 1W36D 4A3EJ 3OYCA 1GXPA 1WI3A 2HQ5A 4RGRA 2CH0A 4M6VA 2K9NA 1XSDA 3GF2A 4P55A 4LMYA 4AD9A 4BAYA 4PFPA 3RKWA 4LG3A 1FBQA 1YS6A 4A3KJ 1DGWY 2BEOA 2F6CA 4EMSA 1PVEA 4OAZA 5D8LB 1DP3A 2R0QC 2TRTA 3PO2J 4ZZDA 1BI0A 3HOTA 1DPUA 4ENJA 2NVQJ 2L9NA 1G4DA 2MGQA 4JX6A 3CP8A 1BR1A 5FFZA 3G1LA 1R1TA 2LDUA 3JW4A 4XOTA 1W7PD 4Y15A 5HDNA 4AU7A 4A3GJ 2HKXA 3BPXA 3ZMUA 1RRJA 2BE5F 2CMPA 3CLQA 4WXHA 2JVGA 2KLOA 4JOMA 4NBQA 4P9FA 2BZTA 4GRIA 5H6QA 2HXIA 2Z33A 1VQPI 2PMHA 1VQOI 1BIAA 5LEJA 2VC0A 2QENA 3OS1A 2PLYA 2L2OA 4CH7A 4QENA 3RU0A 3OYMA 2BHZA 3HHGA 1WVRA 1HW2A 4BHCA 2LY2A 3FMRA 1ML9A 1UHWA 4HF1A 2KIFA 3K9TA 5FLMJ 4J00A 1YW9A 5FKMA 2EJRA 2FMLA 1WKMA 3ZMZA 2DTRA 4A12A 3BG6A 3RTRA 2W82A 4A3JJ 2MG4A 1NTCA 1TWFJ 2P5VA 2R7SA 2LKXA 3CC7I 4XNFA 4EVIA 2EIKH 3JRAA 1UZCA 3KEOA 1IRFA 4RAYA 4FHTA 2CUEA 4EJVA 5J4YA 4J7IA 1Z9CA 4MFEA 4HX7A 2DJIA 5J1YA 1I3QJ 3F8NA 3FX3A 2E2IJ 5D5WB 1FYLA 1PDNC 3CJQB 3BR0A 2CJJA 3TO6A 3VWBA 3GTLJ 4IO9F 4NNJA 3HXLA 1TQPA 1T6SA 2DYRH 4RBOA 2R7ZJ 3JSOA 1SFXA 3G71I 2EIMH 4CO8A 1YI2I 2JJ7A 3WE3A 2CQNA 4LK1F 2CV2A 2ZMEA 1I27A 5HNFA 2OCCH 2XRLA 3GTQJ 2M4KA 1X2NA 2V6EA 2OQGA 1FBSA 2EZKA 1GUUA 2V1NA 2ZXHA 5ERIA 2JA6J 4UHTA 3PFYA 2HU9A 5IOYA 3QYEA 1YJNI 3RSNA 3KEQA 3OY9A 5DV5A 3LQQA 4PJLA 4ZYHA 2JRTA 5HOOA 3TDUC 3DP7A 1QU3A 4JYKA 2R93J 1S9HA 3SQNA 3RQIA 3JREA 1J0RA 3TG5A 3GZ6A 1VQ4I 4L5EA 2X51A 1X3UA 5LRSA 1WHUA 1MNMC 3JTGA 3JRIA 3A1YA 4I6ZA 4A2UA 3OSFA 3F21A 1TT0A 2FBKA
chains in the Genus database with same CATH topology
4BDZA 3RQ4A 2WADA 3PNYA 2GOXB 2MABA 2HPIA 3LSMA 4BJ6C 5KJNA 4F55A 4KJZA 4RLFA 3EUKL 2OUMA 2WB1A 3OL3A 4B44A 5KHDA 4PFOA 4B3XA 3E1SA 5ARGA 2R7QA 2LG4A 5KJKA 2E1MC 2A5WA 4QPQA 4PJJA 2OC6A 2A6TA 4D1QA 4HRIA 5FRNA 3QOEA 3ZQQA 1MNDA 3FPDA 4XL9A 4BE1A 3F9WA 4BQQA 3SEZA 2X6YA 2W5ZA 5HLTA 3L2UA 2R3AA 2BVMA 3K4MA 3OYLA 4HSTA 4PUSA 3H9QA 2X1CA 2W5YA 4XM3A 4CCLA 2BOLA 3CBPA 4P5OA 4BEHB 3DEEA 2BW3B 4NC7A 1YX5A 3H9JA 1UELB 3KYLA 2IS1A 3UR3C 5HQ8A 2ZSIB 4IQ4A 1E0EA 1X4OA 3EUHC 4B47A 2LY1A 2KRHA 4BE0A 2R4GA 4HNUA 2V26A 4OAYA 4P1WA 3FBNB 4CZCA 3KMAA 4I51A 2XF7A 4AYBA 2LOOA 4YNPA 2UWMA 2RFIA 3HPGA 4XMYA 1LKXA 3DTIA 4PSXA 4ZTJA 1DQUA 3VYUB 4BS9A 2R7UA 3OIPA 2X6XA 1P9QC 4ZTFA 3W2AA 3OYDA 4RMNA 4XONA 2VJIA 3HPHA 4IQJA 3OS2A 1MT6A 1FMVA 3OYJA 2CV0A 5F59A 3CF2A 4PJMA 3VSLA 1YE9A 4AVZA 3OOIA 3OR1C 5LD2C 3DALA 1X4PA 5TGTA 1PEGA 4JLGA 1MW7A 1YX3A 4XLHA 4ANJA 4U7BA 4XOPA 5CCMA 1NG6A 3SYTA 1SFKA 2M4GA 4DBQA 3C2GA 3K70D 4CCJA 3S7DA 4C30A 1DGRM 4H4KC 4BE2A 1UAAA 2Z1DA 2ZFUA 1X1DA 1WJCA 3ZXSA 5ARFA 3UNGC 4NQWB 4J83A 3BCBA 2MC4A 2IS2A 5JJ0A 2VQCA 3MKWB 3DPTA 4F91B 1R6RA 2QKMB 4O6FA 3DQVC 4Y33A 4N4OB 4BACA 5F5EA 1MMGA 4NUBA 2R7RA 3VV0A 4X0GA 2XAUA 3M56A 4BU2A 1WJEA 2F5VA 4RM3A 4IZZA 4OWRB 4HEA2 3QWPA 3K10A 3HKZA 4RM2A 2KPMA 3DB5A 4DBRA 2JUGA 2R7OA 3LL7A 5F6KC 2LBFA 1WJDA 3OWTA 3M55A 3LSIA 1KONA 1Z7LA 1D1BA 3W3CA 4F93B 1X1BA 2VL8A 1D0YA 1LVKA 3OPEA 4KITB 3M57A 2X6WA 4F92B 2CV1A 3OYAA 1D0ZA 1HA8A 2UV1A 2DCEA 3DU6A 3A4CA 3CJRB 4DGWB 5CQEA 1MMAA 1Z3YA 4B43A 4ZJZA 2MD0A 3DPUA 4PK4A 1V5GA 3DKYA 3K4JA 1FMWA 3S3NA 2HQAA 2VXDA 2VLAA 3OYNA 2XF6A 4R79A 5KNLA 4XKWA 2PMZA 1LDKB 2Q2EB 4LDGA 4YNMA 1T0FC 1Y56A 4ZDOA 2XC7A 2WAQA 1AA7A 1GLNA 4CUGA 2Q1ZB 2HVRA 4LIUA 4XN0A 1Y6IA 3IHXA 2LREA 4BXFA 2HNHA 3I3LA 4RLQA 2GOMA 4CCKA 2RNGA 2KMUA 3MKZA 2VPLA 4J8OA 4HNTA 4MI0A 1V5FA 1N78A 3AL0B 2WY8Q 1X19A 2K5CA 3VSKA 4YPUA 4YPEA 4WUYA 2VJJA 4II3A 2W00A 2IGMA 2ZSHB 3H5NA 3OL4A 3ZRGA 3QYBA 3DTEA 2CUJA 3A2KA 3K5KA 3OS5A 3KEYA 3S3OA 5LSXA 4U87A 4DIQA 2VXZA 3HG9A 4JQFA 3CESA 2X1EA 2R7XA 3FBIB 5F6LA 2AQFA 3PNTA 4QPOA 4MI5A 3LSGA 4ITVA 5LSZA 1D0XA 3NWTA 3N05A 2IGNA 4XN3A 4EATA 3MEKA 1BR2A 3KMTA 3QWVA 4Z4PA 4ZYAA 2VIXA 3OYEA 4BJTA 4DOZA 5CCLA 1VZ0A 4Y3OA 2R7WA 5KJLA 2JV0A 2WAEA 3PUBA 4XLAA 3N71A 3LSKA 3SDBA 3BG7A 4NVQA 1G8XA 5T5GA 5KCMA 3U21A 4CCOA 3RAYA 4G6TB 3D5RC 3AL0C 1LFPA 3M8JA 2W7NA 4F52A 3K70C 3F9YA 5T0MA 4YRVA 5JHNA 1MVXA 3OYIA 4XKBA 3CZ6A 4XQFA 2MFZA 4PSWA 3BC8A 2DOAA 3BLYA 4D9JA 4E7SA 2LYCA 2M7BA 2OV7A 1QHHD 1G59A 1SAUA 3FDYA 3K4BA 2NOJB 1ZKKA 4RZ0A 2BQZA 4XORA 2CW7A 3AKZA 4ZDLA 3H5AA 1K6YA 5EG2A 2IGOA 1MUFA 4XLEA 4YEJA 3FHNA 2W4SA 1JI8A 3IUOA 3MMYB 3QODA 1ERDA 3LSHA 4E7LA 1V5EA 3PNVA 2WY7Q 3W2WA 2O8JA 3F9XA 5JHFA 3HUGB 3CBMA 1OR7C 4E7ZA 4IX7A 2V4JC 2XSJC 2VQGA 3FKJA 2K9MA 5EX3A 1OLTA 4F3QA 2VQHA 4NJ5A 3S8PA 3SEQA 2KP6A 3K4NA 2M7AA 3EUAA 3HOSA 4E6KG 1J09A 1X1AA 3VYRB 4IJ8A 4BDYA 2CFOA 5TTFA 4CSWA 4BGDA 3TG4A 1WJAA 4CA0A 2HPMA 4XLFA 1BR4A 3CBOA 3J7AY 3S32A 3K4CA 3K4LA 2LH9A 3DU5A 4BEHA 3S7BA 1TZLA 3H35A 2BW3A 3OS0A 3PSFA 2VJ4A 2KL4A 3M5AA 2E1MB 3MKYB 5LFAA 3H9GA 1N3JA 1D1CA 3PL8A 2E5ZA 4XKVA 4FETA 1T95A 1ZELA 1PJRA 2F69A 1NG7A 3TBIA 4BJ5C 3OXFA 3OXGA 2AQEA 3M1CA 1X1CA 3TL4X 4IJDA 4QEPA 3TMOA 2VJ5A 4FASD 3OXLA 5AYFA 2LRDA 3SWCA 2IGQA 3OMYA 1N6AA 2W1OA 4ZC3A 3CP2A 3VDXA 5KJMA 3DLAA 4J01A 3OYGA 2V9KA 1O9SA 5JIYA 3OR2C 1N77A 4CCMA 1WJ5A 1H3IA 4LIVA 2HVQA 2WBMA 3QYFA 1WFXA 3D5SC 3HC7A 2VASA 3H5RA 5HNHA 2M0MA 3OOUA 3RCOA 3MO5A 2VB6A 1MVHA 5CPRB 3I9V2 4HSRA 1W36D 1MNEA 3OYCA 3M54A 2CH0A 3KX2A 4KT6A 1MMNA 4B48A 3HNAA 3D5LA 4PFPA 4E47A 3RJWA 3MO0A 3DKXA 2E60A 4LG3A 2KDOA 5T0KA 4N4NB 4XLCA 1QHGA 1DGWY 2L9SA 1UG0A 3L2QA 3L2VA 4C2UA 3KMJA 3OYHA 2F6CA 2VKHA 4MLOA 5CKTA 4E4HA 3OIQA 1N6CA 4OAZA 3L2RA 4YNDA 1DP3A 3BCAA 2LBFB 4Y4RA 3S93A 2O5RA 3HOTA 3H0DA 2R7VA 2L9NA 2CS3A 2E5NA 2QKLB 4LITA 2F4IA 3CP8A 4IKFA 5JINA 1BR1A 2X85A 4XKCA 2WAFA 3S7JA 4XOTA 4AU7A 2JA2A 3LFUA 4E7HA 4NC8A 3RIBA 2VQLA 2XF5A 3HL2A 2HVSA 1WJFA 1D1AA 2CMPA 2JVGA 2KLOA 4JOMA 2PJRA 2HZDA 1Z3XA 4GRIA 2G46A 2FUG2 2LC2A 2L7KA 3W2VA 4J7FA 4C2TA 2P0WA 2RREA 2L2OA 3OS1A 2QPWA 4CH7A 4QENA 2V7FA 3RU0A 3OYMA 4C9YA 2RQQA 3M58A 3OYKA 2KRCA 2MYSA 2LY2A 2L5QA 2UUZA 3DPLC 3F9KA 1ML9A 3E0JB 4J00A 3PSIA 2DXIA 3K4KA 3BG6A 2IXSA 2W82A 3RTRA 4DJAA 5FRMA 3SW9A 3VYTB 4FMUA 1N75A 3ONQA 2R7SA 2I8DA 4XNFA 3RPUD 4H12A 1U0JA 3QWWA 2JVHA 4KISA 4J7IA 3S7FA 1IRXA 3OYBA 3BO5A 2K3PA 2DJIA 3GBGA 4BQOA 2KHMA 3PDNA 3ZCOA 5HI7A 1MMDA 2JSPA 4E7KA 4PJNA 2K9LA 3M59A 4BQNA 3CJQB 2ZXIA 3EPZA 4ZDPA 5HVQC 3SZGA 3VWBA 3PJRA 4YPAA 4YELA 4NNJA 3HXLA 2IGKA 2BVLA 3ZR8X 3OYFA 5TEGA 3S3MA 3EP0A 1BOBA 3AFHA 2DT7B 1Z21A 4JDSA 3VUZA 2CV2A 5HNFA 2XDVA 1EA3A 2M4KA 2VKDA 2V6EA 2CW8A 3DWLE 2V1NA 2ZXHA 3K6GA 3IP4B 4II2A 3NWSA 3PFYA 2HU9A 3QYEA 1XQHA 3RSNA 2KQRA 3IAS2 5HOOA 4PJLA 2X1DA 4BUPA 3OY9A 4E7JA 2Z2SB 3LMMA 2PJRB 1QU3A 4QEOA 3IAM2 1S9HA 2KZVA 5FROA 3DTKA 1PYVA 3M53A 3V42A 2Z16A 2R7TA 2HDWA 3TG5A 4HPQA 2WA0A 2DT6A 4BL0B 5TH7A 2M3AA 3MO2A 4HG2A 3CMMA 3L2WA 2X51A 3G2BA 1W36C 1WJBA 3C2HA 5EX0A 4E7IA 2IS6A 3MD2A 2ELJA 4O30A 3F9ZA 4C1QA 2Y0SA 4XR6A 3A1YA 3VYSB 3ZGKA 4CCNA 5CQGA 1TT0A 2IS4A 2CUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZKK A;  4RZ0 A;  3M56 A;  3RQ4 A;  2BQZ A;  5EG2 A;  3QWP A;  1MUF A;  5JIN A;  3DB5 A;  3S7J A;  5KJN A;  4AU7 A;  2O8J A;  5F6K C;  3F9X A;  5ARG A;  3RIB A;  3M55 A;  3CBM A;  5KJK A;  5EX3 A;  3OPE A;  2G46 A;  3FPD A;  3M57 A;  3F9W A;  4NJ5 A;  4J7F A;  3S8P A;  2W5Z A;  2QPW A;  2R3A A;  4QEN A;  3RU0 A;  3M58 A;  2W5Y A;  1ML9 A;  3CBP A;  4IJ8 A;  5TTF A;  3TG4 A;  4LDG A;  4YNM A;  3SW9 A;  4FMU A;  3CBO A;  5HQ8 A;  4H12 A;  3QWW A;  3IHX A;  3S7B A;  4J7I A;  3S7F A;  3BO5 A;  3PDN A;  3KMA A;  4I51 A;  3M5A A;  5HI7 A;  4J8O A;  4MI0 A;  4YNP A;  1N3J A;  3M59 A;  2RFI A;  4YPU A;  2F69 A;  3OXF A;  4YPE A;  4WUY A;  4YPA A;  3OXG A;  4QEP A;  4IJD A;  3K5K A;  3OS5 A;  5LSX A;  5TEG A;  3EP0 A;  3OXL A;  5AYF A;  3SWC A;  2IGQ A;  1N6A A;  4JDS A;  5KJM A;  1O9S A;  3VUZ A;  5JIY A;  1MT6 A;  5F6L A;  4MI5 A;  1H3I A;  5LSZ A;  5F59 A;  3OOI A;  3MEK A;  3KMT A;  3QWV A;  3DAL A;  4Z4P A;  3MO5 A;  1PEG A;  4JLG A;  1XQH A;  1MVH A;  5CCL A;  4BUP A;  5CPR B;  5CCM A;  5KJL A;  4QEO A;  2JV0 A;  3S7D A;  3N71 A;  4NVQ A;  3M54 A;  3M53 A;  5T5G A;  3TG5 A;  3RAY A;  5ARF A;  5TH7 A;  3MO2 A;  4J83 A;  3HNA A;  3F9Y A;  4E47 A;  5T0M A;  5EX0 A;  3MO0 A;  5T0K A;  3RJW A;  5JHN A;  5JJ0 A;  1MVX A;  4O30 A;  3F9Z A;  3KMJ A;  4C1Q A;  1N6C A;  4O6F A;  4YND A;  5F5E A;  3VV0 A; 
#chains in the Genus database with same CATH topology
 5DD4 A;  2QQA A;  3RQ4 A;  2L9V A;  2WAD A;  3PNY A;  2QCO A;  1E3O C;  1XSX A;  2OCE A;  3QP6 A;  1VQL I;  2HPI A;  1U5T A;  2ZXJ A;  2CQQ A;  2A69 F;  4RLF A;  5FLV A;  2NS0 A;  3BZC A;  1GVD A;  5F0F A;  3DF8 A;  1XD7 A;  3WU2 C;  5M3M J;  3TOA A;  1BN5 A;  5KJK A;  1KU2 A;  4FIS A;  1S72 I;  2A5W A;  2EBI A;  3Q0W A;  4PJJ A;  2O61 A;  5LEK A;  4AIJ A;  4IHT A;  1OCC H;  4ZZL A;  1XMA A;  5E17 F;  5ICC A;  2BY1 A;  4A5N A;  3HUG A;  4BE1 A;  4EJT A;  4L0Y B;  2W5Z A;  5HLT A;  1T98 A;  2ME6 A;  2M0C A;  2R3A A;  2E19 A;  3C2B A;  4HST A;  4M3G A;  4PUS A;  4HQE A;  5B3S H;  3ELK A;  2E71 A;  2AXT C;  3X2Q H;  2KJC A;  4P5O A;  2JRM A;  1F36 A;  5E3L A;  2PMZ N;  4ENK A;  3CDH A;  5DDG A;  3K1M A;  4PJ0 C;  1YX5 A;  2WAQ N;  5E18 F;  1FC3 A;  1ZRE A;  3KYL A;  5HQ8 A;  5E8G A;  3ZMT A;  1XGN A;  1B8I B;  4FX0 A;  4B47 A;  5J40 A;  1E0E A;  2LY1 A;  2HI3 A;  3ABM H;  4HNU A;  2X48 A;  2DFH A;  2EFW A;  4L18 B;  4P1W A;  2DMU A;  4FQG A;  4I51 A;  1TTY A;  2W84 A;  2LOO A;  2DK8 A;  4BHP A;  3GTP J;  2GQQ A;  3I55 I;  1UG2 A;  3HPG A;  1HW5 A;  3QPL A;  1LKX A;  2XAQ A;  1T39 A;  1FYM A;  2M87 A;  2C6Y A;  4EJW A;  1B9M A;  2DA3 A;  3OIP A;  2M45 A;  1K7A A;  1XDS A;  4U0V A;  3FXL A;  1MH3 A;  2Z3Y A;  3Q9V A;  4HV6 A;  2CV0 A;  3A03 A;  1T08 B;  5F59 A;  1XGM A;  3OOI A;  3OR1 C;  3P9C A;  2PFB A;  5TGT A;  2GXA A;  2TDX A;  1YX3 A;  4HBL A;  5AIP A;  1FNN A;  1QPM A;  1OFC X;  1R23 A;  2LVS A;  5DCM A;  3K70 D;  3C2G A;  4RB3 C;  4BXX J;  1DGR M;  2ZJP F;  4C3I J;  3WTZ A;  1KU7 A;  3ZXS A;  4O6J A;  2H6B A;  1VTN C;  1G3Y A;  1JTY A;  4J83 A;  1ZYR F;  2IS2 A;  5JJ0 A;  5BPI A;  2ID3 A;  3MAJ A;  1ON2 A;  1RZ4 A;  1RIO H;  3DPT A;  3KZZ A;  3TP0 A;  1R6R A;  4L0Z B;  4JK1 X;  3VV0 A;  4X0G A;  2NVX J;  4MNU A;  4Q47 A;  3CCY A;  4Q5S F;  3M56 A;  2QQ8 A;  2M1B A;  4RM3 A;  3BY6 A;  3QWP A;  4A3C J;  1G2H A;  2HKO A;  1D5V A;  3CLO A;  2A3S A;  2R7O A;  1ZN2 A;  3QQA A;  4IL6 C;  3OWT A;  3M55 A;  2DOE A;  1Z7L A;  2JN6 A;  4HNV A;  3CCM I;  2J5P A;  3N4M A;  1IXS B;  2ZJ2 A;  3LSP A;  1EF4 A;  3ASO H;  1LVK A;  4DQ2 A;  3P9K A;  4GYG A;  3ZPL A;  3GWZ A;  3M57 A;  2X6W A;  4IRG A;  4M9X A;  4F92 B;  2CV1 A;  4I2O A;  3B02 A;  5LGU A;  3GFI A;  1X1P A;  3CME I;  3A4C A;  1ZK8 A;  4DGW B;  5CQE A;  1MMA A;  1Z3Y A;  4ZJZ A;  4BYY A;  1R4N B;  1P7I A;  1ZLK A;  2VLA A;  4ABZ A;  5TRD A;  2YS9 A;  2Q2E B;  5A2Q K;  5JI6 A;  2W48 A;  5IYC J;  1J2X A;  2LF7 A;  1AA7 A;  2V9V A;  2HVR A;  2RAE A;  4LIU A;  1Y6I A;  2DQR A;  1UST A;  4BXF A;  3BR3 A;  3TO9 A;  2GOM A;  2L7M P;  4OU0 A;  1RKW A;  2RNG A;  2HOE A;  4CCK A;  4EM1 A;  2RGV A;  1IGN A;  2V1U A;  2VPL A;  4KIC A;  3B6C A;  2QUF A;  4BBR J;  1BBY A;  4XRF A;  5E79 C;  5LBQ A;  4WUY A;  1UHS A;  4IPA A;  3I4P A;  2XGC A;  4II3 A;  2W00 A;  3M9A A;  3K5K A;  3QYB A;  3A2K A;  4HLX A;  1IW7 F;  3ISP A;  4QWQ A;  2M2E A;  1FOW A;  2X1E A;  3WTX C;  1B9N A;  3PNT A;  4QPO A;  3LSG A;  1IUF A;  5D4R A;  2KIS A;  2XKP A;  1D0X A;  3GLL A;  5FB2 A;  1VFC A;  2IGN A;  2P5L C;  3A01 B;  3MEK A;  3VOD A;  1R22 A;  3SHF A;  1E2X A;  4RB1 A;  4HDV A;  1J5Y A;  2R3S A;  3J7Y J;  2L4A A;  4G6Q A;  1HXD A;  2R7W A;  1YIJ I;  2WAE A;  4GGG A;  1IN6 A;  1MKM A;  2YX4 A;  3LSK A;  3SDB A;  2IA1 A;  4S05 A;  2FBI A;  1NH3 A;  2FX0 A;  4AVP A;  2M8G X;  2EV6 A;  3U21 A;  3BJA A;  3R6S A;  1IXR C;  5AIQ A;  4UUS B;  1R5I D;  2P5K A;  2XV4 S;  3E6M A;  3F9Y A;  2VUM J;  1USS A;  5DS9 A;  5JHN A;  1RKT A;  4UV9 A;  3MZH A;  3BLY A;  5ED4 A;  2LYC A;  1Z6R A;  2PMU A;  3CDI A;  1QNT A;  3U1K A;  1ZKK A;  2BV6 A;  1HKQ A;  3AKZ A;  1MUF A;  1R58 A;  4YEJ A;  2DI3 A;  2XPV A;  3J7A O;  2W4S A;  2PEX A;  5EEG A;  1JI8 A;  3R60 A;  2WY7 Q;  5BNG A;  3F8C A;  3V8J A;  4E7Z A;  2XRN A;  1ZG5 A;  3OV8 A;  2GXB A;  3BR1 A;  5JLX A;  1FYK A;  2K9M A;  2XPW A;  2FU4 A;  4EJU A;  2A68 F;  4JX5 A;  2QQB A;  1ETK A;  2J5O A;  3P7N A;  4OMZ A;  2BXZ A;  3Q0V A;  2NVY J;  2X9D A;  5LHG A;  2LNB A;  3WU1 B;  3SEQ A;  2KP6 A;  2F4O B;  1AKH B;  3K4N A;  2M7A A;  3EUA A;  3TW7 A;  4HX4 A;  4EGY A;  3R61 A;  2XB5 A;  2M5W A;  1X1A A;  3FMQ A;  2CFO A;  5TTF A;  4CIC A;  4G94 A;  1OKR A;  5E8I A;  3WTV C;  5F64 A;  4XLF A;  2HWV A;  1RR8 C;  1DU6 A;  1JUP A;  5BPD A;  1S5L C;  4XID A;  3E5U A;  2OA4 A;  1HCR A;  1VQ7 I;  1TZL A;  3H35 A;  4YG2 F;  1WZ2 A;  1GV2 A;  3F6V A;  3GFL A;  4KMF A;  1Z1D A;  2KL4 A;  2E1M B;  1JT0 A;  1J7K A;  5FD5 A;  3H9G A;  1B8I A;  3JRH A;  1I6H J;  4XIC A;  2FXA A;  2JPB A;  1FIA A;  3I5U A;  2CGP A;  2AQE A;  3M1C A;  5EYR A;  1G3S A;  3HZJ A;  4CYC B;  1IUY A;  2W25 A;  3GZ5 A;  1OR7 A;  2LP0 A;  2VBY A;  4FAS D;  1MBE A;  5JFR A;  3G4S I;  2I5U A;  1LPQ A;  3J80 Z;  3OMY A;  2FOK A;  4ZC3 A;  3BQY A;  5E3O A;  5KJM A;  2P8T A;  4J01 A;  4Y52 J;  2V9K A;  3OR2 C;  4YIF A;  2WBM A;  1W4M A;  1O3S A;  3GO5 A;  3HDD A;  3S2D J;  3GXO A;  2LF8 A;  3RCO A;  4ZYD A;  1ZHF A;  3WGI A;  1T38 A;  5CPR B;  3FXM A;  2QYO A;  3Q5F A;  1DU0 A;  1TWG J;  3H0G J;  3V7S A;  3B6A A;  1MMN A;  3D5L A;  4W1U A;  4E47 A;  3SJM A;  3DKX A;  2E60 A;  4HF0 A;  1XCV A;  2KDO A;  1R49 A;  3KPH A;  2W57 A;  3L2Q A;  4C2U A;  4FE7 A;  3KMJ A;  3HBL A;  5CKT A;  3OIQ A;  4XLN F;  1S29 A;  6PAX A;  3I59 B;  3BCA A;  3BJO A;  1GT0 C;  3WU0 A;  2LBF B;  3Q9S A;  4Y4R A;  2HOA A;  3ASN H;  2XIG A;  2FE3 A;  4A3M J;  1LQ1 A;  2H27 A;  2CS3 A;  2E5N A;  2OTL I;  5JIN A;  1FT9 A;  1B72 A;  5FLX Z;  1YJW I;  4XKC A;  2WAF A;  3ROU A;  4YII A;  1JKQ C;  5TJJ A;  2MH2 A;  3KP2 A;  2K4B A;  3LFU A;  3IH2 A;  4M9Z A;  3OSG A;  2VQL A;  3HL2 A;  5LGT A;  1K4T A;  3G3Z A;  2ICW G;  1VQM I;  2QSG X;  1HW1 A;  3HSR A;  4WX9 A;  2MC3 A;  2BXY A;  3T5X A;  4P9U A;  5ILS A;  3HTU A;  4C2T A;  1R5G A;  1YIO A;  4KNY A;  3M58 A;  2KRC A;  1MMS A;  2L5Q A;  3F9K A;  5E1X A;  2BBY A;  3PSI A;  4AID A;  5TIS C;  5A2Q Z;  2W24 A;  4BNC A;  5FRM A;  3ZP5 A;  3SW9 A;  3RPQ A;  5DUI A;  2I8D A;  3T0Y A;  1R5H A;  1UFM A;  3RIR A;  1U0J A;  3GFJ A;  4B8X A;  4RAF A;  4G7Z F;  4KIS A;  5IY5 H;  2Q2E A;  4UY8 I;  1RES A;  3OYB A;  5LGN A;  3GBG A;  4D7M A;  5BOX A;  2NAZ A;  1YLF A;  2UZK A;  5HI7 A;  4HLY A;  5E3N A;  1R71 A;  3ABT A;  2DJN A;  2P81 A;  2P6S A;  4Y7N J;  1HLV A;  2FQ3 A;  2H1K A;  4JP0 A;  3EPZ A;  3WG7 H;  3PJR A;  4YPA A;  3MFK A;  4D5C A;  3ZR8 X;  2IPQ X;  3I4N J;  3OYF A;  1U5T C;  4FTH A;  3S3M A;  4MO7 A;  4MTD A;  1EV7 A;  3BR6 A;  3I71 A;  1U78 A;  1NK2 P;  4DYC A;  1YJ9 I;  3C18 A;  1PP7 U;  3LSJ A;  3GTM J;  4S04 A;  2VKD A;  2O9L A;  1ULY A;  3DWL E;  2QVO A;  3ZMS A;  4UXN A;  1NK3 P;  2QF7 A;  4II2 A;  1U9O A;  4UV8 A;  4L9N A;  4E7J A;  2PJR B;  4U0W A;  1W7P B;  1FLI A;  2L02 A;  1YG2 A;  2RNJ A;  1BC8 C;  3PUF A;  2Z99 A;  3EDP A;  1PYV A;  5ICF A;  3A01 A;  2R7T A;  2HDW A;  3MO2 A;  3MVP A;  3CMM A;  1YIT I;  4BBS J;  1W36 C;  1WJB A;  2D2W A;  2DA1 A;  2X6O A;  3C2H A;  4E7I A;  5EX0 A;  2ELJ A;  3F9Z A;  1X2M A;  2DTZ A;  4C1Q A;  3AG2 H;  4XR6 A;  2G7U A;  1TWA J;  3FK7 A;  3LSR A;  3CC4 I;  4UUS A;  5B1B H;  4ESF A;  5CQG A;  3RI4 A;  1XMK A;  2K02 A;  2IS4 A;  3CUQ B;  4UB6 C;  4IHX A;  2CU7 A;  1CF7 B;  1LJ9 A;  1FTZ A;  4N9H A;  1FTT A;  2GOX B;  2MAB A;  4M3E A;  1JKR C;  1EH7 A;  1BI3 A;  2LY9 A;  4BJ6 C;  4F55 A;  3GTG J;  2OU2 A;  5KJN A;  2K4J A;  3OL3 A;  3D0S A;  2FSW A;  4B44 A;  5KHD A;  1E17 A;  5CLS A;  2R7Q A;  2JA7 J;  1MZB A;  5EZH A;  3KE2 A;  4QPQ A;  2OC6 A;  1ZGA A;  4DYR A;  4D1Q A;  4EM0 B;  2OBP A;  5FRN A;  3WTY C;  1ORK A;  4AIH A;  2PI0 A;  2OZ6 A;  3FPD A;  2EFO A;  2E35 A;  4BQQ A;  3SEZ A;  2M9H A;  2X6Y A;  5HOD A;  3G1M A;  2CW0 F;  1FIP A;  3L2U A;  1YW8 A;  1XN7 A;  1RUN A;  1SFU A;  5CVV A;  1P2F A;  3LQR A;  1MBH A;  3F72 A;  1HDD C;  4HA8 A;  5F0H A;  1MSE C;  1OQY A;  1A35 A;  4N9I A;  2UXN A;  2IS1 A;  3LWF A;  4MEY F;  1YRN B;  2ZSI B;  1G3T A;  4IQ4 A;  4OOI A;  1KU3 A;  2KRH A;  2R4G A;  2V26 A;  3L2C A;  3RJP A;  1S7O A;  4Y17 A;  5M5W J;  4CZC A;  2O0Y A;  3ZQC A;  1QZE A;  2XF7 A;  4F7Z A;  4CGZ A;  3S17 J;  1DPR A;  4IHV A;  2DA7 A;  2JZY A;  3HOZ J;  5DYM A;  3TP3 A;  2Y31 A;  3EET A;  2ADU A;  4PSX A;  4ZTJ A;  4A93 J;  2BY3 A;  3H3U A;  3VYU B;  2X6X A;  2H6C A;  4ZTF A;  1K78 A;  4RMN A;  2LD5 A;  2Q8K A;  3HPH A;  2JTV A;  4HW0 A;  2D1V A;  3OS2 A;  1MT6 A;  1FMV A;  4LGW A;  5D5X B;  4CYC A;  3OYJ A;  1HC8 A;  3ZQ7 A;  5GAD J;  4UVB A;  3CF2 A;  2E7X A;  1KQ8 A;  2H09 A;  1X3Z B;  3IH3 A;  1VND A;  3E6B A;  5LD2 C;  2ZXW H;  3DAL A;  1X4P A;  2HOT A;  1PEG A;  3CO6 C;  4JLG A;  1W5C C;  4NC6 A;  4XLH A;  4WK8 F;  4LB5 A;  2RV8 A;  1ZG1 A;  4U7B A;  4WXD A;  4XOP A;  1NG6 A;  1EKE A;  1MJ9 A;  4DBQ A;  4G7H F;  3QRF F;  4CCJ A;  3S7D A;  3TDZ C;  2Y30 A;  3HB9 A;  1W0T A;  1UAA A;  3OIO A;  1X1D A;  1WJC A;  4YIR X;  1XSV A;  3WTT C;  3JRD A;  2FD5 A;  3DKW A;  3UNG C;  1IN8 A;  3BCB A;  1A5J A;  4FCY A;  3IRQ A;  1SVL A;  3MKW B;  4G12 A;  4P96 A;  1MDM B;  2OTJ I;  3HGY A;  2GLO A;  3BTC A;  2JUC A;  3DQV C;  3KYC B;  2WV0 A;  2CG4 A;  2Z5U A;  1MMG A;  1ZAR A;  2R7R A;  1RUO A;  1I6X A;  5CVJ A;  3HSE A;  1JTX A;  1IJW C;  3CUO A;  3ABK H;  1WJE A;  2F5V A;  1F1Z A;  1F4K A;  4CZZ A;  3DB5 A;  3ESW B;  1Y0U A;  2JUG A;  3MN2 A;  3NRV A;  3F22 A;  3I59 A;  5F6K C;  2LBF A;  2GIV A;  2NXN B;  1WJD A;  3K0L A;  4RAZ A;  3E97 A;  1TQM A;  5J1R A;  2L3D A;  3FHZ A;  4O3M A;  4MTE A;  4F93 B;  1ITY A;  1X1B A;  1WH5 A;  2F5D A;  5HS9 A;  3F8M A;  2HYF A;  4KIT B;  2V79 A;  2ISY A;  2EWN A;  4RS8 A;  1OCT C;  3QPT A;  2DCE A;  1K6O A;  4YFX F;  2L0K A;  2IP2 A;  2MD0 A;  3DPU A;  2YU3 A;  1FMW A;  3S3N A;  3S2H J;  1S8N A;  3OYN A;  4FE4 A;  1BA5 A;  5IP9 J;  1XB4 A;  3F6O A;  5KNL A;  2DFI A;  2PMZ A;  1LDJ A;  1TC3 C;  4YNM A;  4GCV A;  2WAQ A;  3HOW J;  3S14 J;  5FJ8 J;  1GLN A;  4CUG A;  3RZO J;  4I98 B;  4DYQ A;  5J8C A;  3IH4 A;  1B6A A;  1W0U A;  1ZRD A;  3IHX A;  4RLQ A;  1FEX A;  2KMU A;  3MKZ A;  2DYS H;  1ETO A;  2FOW A;  3ZN0 A;  2A6H F;  4CDG A;  4YPU A;  4V19 K;  5EZG A;  2VJJ A;  2DBB A;  1ON1 A;  2E34 A;  4FT8 A;  3LA2 A;  3OS5 A;  4ZYG A;  2CUJ A;  3HOY J;  5LSX A;  3S3O A;  3CCL I;  2DLL A;  4DIQ A;  5GP9 A;  3ZQL A;  2YUS A;  3IWF A;  2R7X A;  1MD0 A;  5L3F A;  2HR3 A;  3FBI B;  4MI5 A;  5IYB J;  1W5T A;  4I09 A;  4ITV A;  3NWT A;  2CFX A;  2EV0 A;  4KUM A;  3HIF A;  1VQ9 I;  3N05 A;  5KAI C;  4H0E A;  2XAG A;  1R1U A;  1BR2 A;  3KMT A;  1IZ1 A;  3OYE A;  2JT1 A;  4DOZ A;  1I50 J;  4Y3O A;  2YPR A;  1XGS A;  3GUD A;  4XLA A;  4KN7 X;  2R5Z A;  1VQK I;  3AG1 H;  2XB0 X;  2EFQ A;  4CCO A;  3JAM K;  2EA2 A;  2H8R A;  3J80 K;  4IEJ A;  3K70 C;  5DCF A;  1W7P A;  4F52 A;  1JXS A;  5IP6 A;  2DPD A;  3OYI A;  4X6A J;  2V1D A;  1ZR4 A;  2DFE A;  2VN2 A;  3T8T A;  1WSU A;  1PUF B;  4XK4 A;  4OIN F;  1G59 A;  3J7Z I;  1SAU A;  2FJ1 A;  3K4B A;  1SMY F;  2NOJ B;  4ENM A;  2RKH A;  1HOM A;  2F5C A;  2F48 A;  3BG3 A;  4XOR A;  2O03 A;  3ABU A;  1LE8 B;  3I4M J;  1K6Y A;  2KKO A;  5GPC A;  2IGO A;  1J9I A;  3QWL A;  1WRJ A;  4WCG A;  5E1Z B;  3MMY B;  1QZZ A;  3K1P A;  3PNV A;  4DW6 A;  3F9X A;  3CUQ A;  5JHF A;  4V2G A;  1Y0N A;  1Z0X A;  1P4W A;  1OR7 C;  1CF7 A;  2LR8 A;  5HLG A;  3P9I A;  2ZFW A;  4B09 A;  5EX3 A;  1OCO H;  3CMY A;  1D5Y A;  3SXY A;  2VBW A;  4WF2 A;  1ZLJ A;  3KP4 A;  4NJ5 A;  2PQ8 A;  4KA4 A;  2HEO A;  1HKT A;  4QTR A;  2A5Y B;  4E6K G;  2PJP A;  3ERM A;  1FPQ A;  1J09 A;  1UMQ A;  3ZQF A;  5FLX K;  4CA0 A;  2H8W A;  2AS5 F;  2K85 A;  3LA3 A;  1BR4 A;  2HDD A;  3CBO A;  3J7A Y;  1IF1 A;  3E3V A;  3S32 A;  3GW2 A;  3I0T A;  2BYV E;  2LH9 A;  3DU5 A;  4ESJ A;  3R0A A;  3TKY A;  3OS0 A;  2EZH A;  4D7N A;  5LFA A;  3WOD F;  3MKY B;  1MSF C;  1YRN A;  3MWM A;  3FZV A;  1TWC J;  3T8R A;  3KZY A;  3OXF A;  1NG7 A;  2DA2 A;  1H8A C;  3TMO A;  2LKS A;  4L5I A;  2LRD A;  3SWC A;  2KJB A;  1N6A A;  1H9G A;  3CP2 A;  3C3W A;  3VDX A;  4IHW A;  3OYG A;  5JIY A;  3DV8 A;  4AWX B;  1WJ5 A;  3OOP A;  1H3I A;  2CO5 A;  2HVQ A;  2V6C A;  3HC7 A;  1F43 A;  1Y1V J;  1FY7 A;  5ILU A;  2JA8 J;  2VB6 A;  3CQZ J;  1D3Y A;  2MLK A;  2M34 A;  4M3B A;  2FNP A;  4HSR A;  3WGG A;  2HYG D;  3NAU A;  1MNE A;  4HAM A;  5IT9 Z;  3KX2 A;  1JUM A;  3ZMD A;  3COA C;  1U8R A;  2ELK A;  5LHI A;  2DQL A;  4B48 A;  4C3H J;  1I1S A;  3HNA A;  2KZG A;  2OAZ A;  3BP8 A;  3MO0 A;  5T0K A;  3RJW A;  3BOQ A;  1SVO A;  2IW5 A;  4N4N B;  1ACI A;  2Y0S N;  2L9S A;  3L2V A;  3OYH A;  2VKH A;  4E4H A;  3L2R A;  3WG9 A;  5IPA A;  3DXJ F;  3QU6 A;  3TQN A;  2FNA A;  4XRS G;  3AG3 H;  3S93 A;  3I53 A;  3H0D A;  3A02 A;  1VI0 A;  1ZGW A;  2ZJQ F;  2QKL B;  4LIT A;  4WWC A;  1MDM A;  1JHF A;  1K83 J;  2WB1 N;  3CJT B;  4IRH A;  3S7J A;  1JJ8 C;  1JGS A;  3P5J A;  3RIB A;  2IBD A;  2XF5 A;  1WJF A;  2GA1 A;  4MGR A;  3PQK A;  2HZD A;  1MBK A;  5GTH C;  2MBF A;  1BM9 A;  3O3K A;  2HZT A;  2G46 A;  1K4S A;  2WTE A;  1P7J A;  2CQ7 A;  2FUG 2;  1IN4 A;  2FA5 A;  2LC2 A;  5EEH A;  2A05 A;  4ON0 A;  3V7C A;  4D0P A;  2L01 A;  2NYX A;  1QZY A;  3KP3 A;  3QU3 A;  2P0W A;  2RRE A;  5GAE J;  2QPW A;  2F5E A;  2K27 A;  2XHK A;  4C9Y A;  3AAF A;  1A04 A;  5E3M A;  3OYK A;  5FKO A;  2MYS A;  2UUZ A;  2ZKZ A;  3DPL C;  3E0J B;  5J47 A;  3KCC A;  4HYE A;  5DM7 F;  1SAN A;  1XTA A;  2K86 A;  3TGN A;  2IXS A;  2AXL A;  3BTL A;  4IXA A;  1TT5 B;  2K9Q A;  4L9V A;  4LD5 A;  4LOC A;  4FMU A;  1N75 A;  3ONQ A;  3RPU D;  4A3F J;  3HRU A;  2Y69 H;  3HTS B;  4LFU A;  5M5Y J;  3S7F A;  4AYB N;  3PDN A;  4BQO A;  2KHM A;  1FJL A;  1U6G A;  3ZCO A;  1S6L A;  1A31 A;  4E7K A;  2XVC A;  4XSX F;  2M8E A;  4BQN A;  3WTW C;  1W1W E;  2ZXI A;  3TOB A;  4ZDP A;  1V55 H;  3HM5 A;  4GXO A;  2B0L A;  3MKL A;  2QWW A;  3JRG A;  5TEG A;  2AHQ A;  2YSR A;  5D6F A;  3EP0 A;  1ETQ A;  2Q0O A;  1MJB A;  4R8H A;  3BWG A;  4M74 A;  5ICG A;  4JDS A;  2NNN A;  2DK5 A;  4EGZ A;  1S7E A;  1LFU P;  3K7A J;  1VQ8 I;  3CF5 F;  1EA3 A;  2DN0 A;  5F0C A;  4Z2Y A;  1FSH A;  2CW8 A;  4EV0 A;  4KIB A;  4MEX F;  3SFZ A;  2D1H A;  5GAG J;  3IP4 B;  2R7D A;  2STT A;  3NWS A;  3ML6 A;  3ZQG A;  1OMI A;  2NS7 A;  1IV8 A;  3IAS 2;  4FX4 A;  2X1D A;  1ZRF A;  4QEO A;  3IAM 2;  4YFN F;  2GM4 A;  1TBX A;  4A5M A;  2P7C B;  3MZ8 A;  2KZV A;  3ABL H;  5EGO B;  5LLQ A;  3JR9 A;  1VQ6 I;  2Z16 A;  3JAM Z;  4HPQ A;  4BQA A;  2WA0 A;  2DT6 A;  3L09 A;  2M3A A;  3IV5 A;  4HG2 A;  3BZ6 A;  4G8X A;  3WHB A;  3G2B A;  3HOX J;  4HQM A;  4O30 A;  2P7V B;  5E1W A;  1GV5 A;  2HTJ A;  1B4A A;  3VYS B;  3ZGK A;  1P4A A;  2GZW A;  5CYV A;  4CCN A;  3RYR A;  2CUZ A;  3MQ0 A;  4BDZ A;  3HKZ N;  2ELH A;  3O6B B;  1UCR A;  1TL8 A;  1ENH A;  3LSM A;  1PUF A;  3QAH A;  3FK6 A;  1G6N A;  3G6E I;  4LLN A;  3GX4 X;  1SD6 A;  3V7R A;  2JMW A;  5ARG A;  3IWZ A;  2ZNZ A;  2HTS A;  2E1M C;  4PCQ A;  5H6R A;  3D1N I;  1LE8 A;  2XGD A;  5HLI A;  2DMT A;  4BKX A;  1QQI A;  3JRF A;  1FZP B;  5B66 C;  1JKO C;  3E6D A;  3ZQQ A;  2ZJR F;  3KP5 A;  1AHD P;  4CYD A;  3SFI A;  3GEZ A;  4PDK A;  3F9W A;  4C3J J;  4BY7 J;  1HKS A;  2DA6 A;  4RGS A;  2VON A;  2BVM A;  1WWX A;  2X1C A;  2ACJ A;  2W5Y A;  4XM3 A;  3ZQI A;  4ENN A;  3CBP A;  1C0W A;  4GO1 A;  4I01 A;  3E5X A;  1TWH J;  3DEE A;  4NC7 A;  2JWT A;  1UEL B;  3I58 A;  5IYD J;  2HYJ A;  1WGX A;  5LHH A;  2NRA C;  4BE0 A;  5F1J A;  1V54 H;  3M8E A;  1FP1 D;  1UHM A;  2ESN A;  3V8L A;  1MGT A;  2ETH A;  3FBN B;  1BI1 A;  2DDA A;  1OIS A;  3L00 A;  3QPS A;  3LAP A;  4YNP A;  2RFI A;  4XMY A;  3ECO A;  5FD6 A;  1YFH A;  3HOU J;  5H2F C;  1FOY A;  4L5J A;  1DQU A;  1KA8 A;  4OMY A;  2CYY A;  2R7U A;  1P9Q C;  4N0B A;  3W2A A;  3OYD A;  1KYW A;  4XON A;  3WTU C;  1JGG A;  1HSJ A;  2AO9 A;  4CHU A;  3H3V K;  1QPI A;  2H94 A;  5D5V B;  4PJM A;  1YE9 A;  4AVZ A;  4M73 A;  2OQR A;  4MFD A;  4YFK F;  1MW7 A;  2ECB A;  4RGX A;  3HJE A;  4ANJ A;  3WGH A;  2Y9Y A;  3BQZ A;  3CCV I;  1T8I A;  3HRT A;  1O3R A;  5GTI C;  4C30 A;  3IKV A;  1SD4 A;  2MSY A;  1IV6 A;  4H4K C;  4BE2 A;  2ZC2 A;  2Z1D A;  3EQL F;  3HRS A;  2K40 A;  1T56 A;  4M3F A;  5ARF A;  4NQW B;  3R4K A;  4I76 A;  1I39 A;  2LK2 A;  1EH6 A;  3CD6 I;  1YYV A;  3I64 A;  1ETV A;  3HGG A;  4Y33 A;  4N4O B;  4BAC A;  5F5E A;  4NUB A;  1R00 A;  1JJ6 C;  2OPT A;  3BPV A;  4BU2 A;  1ZRC A;  3DFG A;  4IZZ A;  3FXU A;  2ISZ A;  1YW7 A;  2EIN H;  2KRF A;  4OWR B;  4Q48 A;  2GIZ A;  2KPM A;  4DBR A;  1LVA A;  4XBF A;  1DUX C;  2O8K A;  4U7D A;  3LL7 A;  1RNL A;  1FSE A;  1D1B A;  3W3C A;  2JQ7 A;  4R1H A;  2A61 A;  1YHQ I;  5D8K B;  1D0Y A;  2VT3 A;  1SMT A;  4ZH4 F;  1N25 A;  1XDU A;  1XPX A;  2KDZ A;  5F1R A;  1D0Z A;  4PGH A;  1YOV B;  5B1A H;  1DP7 P;  1HA8 A;  1LEA A;  4A0Z A;  2IJL A;  5FKN A;  3DU6 A;  3CJR B;  1MH4 A;  1H89 C;  4QLC U;  2Y48 A;  1ONV A;  4B43 A;  2RQP A;  3L7W A;  3M1E A;  3VB2 A;  4PK4 A;  4ASN A;  1V5G A;  3M4O J;  3DKY A;  3K4J A;  2HQA A;  1KQ9 A;  2L9R A;  1KQ0 A;  1SD7 A;  2IEK A;  2V9P A;  2XF6 A;  3F3X A;  3GFM A;  5FFX A;  4AIK A;  4RGU A;  1FOK A;  1XCB A;  4XKW A;  4O5V A;  1LDK B;  4LDG A;  2XC7 A;  2FEZ A;  1BL0 A;  5J6X A;  2LRE A;  1KGS A;  4DNC A;  1BI2 A;  3FIW A;  5ICE A;  2H1L A;  4J8O A;  4HNT A;  5K7Z A;  4MI0 A;  1V5F A;  1N78 A;  3PQJ A;  2XAJ A;  4UUV A;  4U88 A;  2FF4 A;  4YPE A;  2CUF A;  1GXQ A;  1STZ A;  1WCM J;  2Y9Z A;  2IT0 A;  3WE2 A;  3GME A;  2E2H J;  2IGM A;  2ZSH B;  1TNT A;  3OL4 A;  3ZRG A;  3KEY A;  4GYI A;  4G6D A;  4U87 A;  1AKH A;  3W6J B;  2VXZ A;  2HXO A;  3BZK A;  1F5T A;  2E1C A;  3FMS A;  3CUQ C;  4JQF A;  1E3H A;  1PP8 F;  1RR7 A;  2XRO A;  2F5F A;  4B1R A;  2AQF A;  2DT5 A;  5LSZ A;  3ZOB A;  2BGC A;  1EJ9 A;  3HSF A;  5EG0 B;  2DOD A;  4XN3 A;  5E20 A;  4IHY A;  2DO7 A;  1O7F A;  1YO5 C;  4ZYA A;  1XX5 A;  5CCL A;  4NDL A;  3ECH A;  4RB0 A;  1IN5 A;  2VE8 A;  5KJL A;  2JV0 A;  3PUB A;  2FQ4 A;  1QO0 D;  1T0F A;  1G8X A;  4IRI A;  3S2W A;  5T5G A;  4XLP F;  4ETS A;  5K5Q A;  4G6T B;  3D5R C;  3M8J A;  5T0M A;  3IC7 A;  5KK1 A;  1MVX A;  3UKG A;  2VBX A;  3M8F A;  5EGO A;  5KVR A;  4XQF A;  2MFZ A;  1D8J A;  3VOE A;  3BC8 A;  1XG1 A;  5C3E J;  4HV5 A;  1QHH D;  4PGG A;  2QEX I;  3W6V A;  1APL C;  3O8H A;  4RZ0 A;  2BQZ A;  1OYI A;  1U3E M;  3H5A A;  2LSO A;  4XLE A;  3QPH A;  5KAF C;  3IUO A;  3QOD A;  1ERD A;  3LSH A;  1V5E A;  1IXC A;  1WI9 A;  3FM5 A;  1OPC A;  3CDL A;  3FWE A;  5IT9 K;  2GXG A;  3CBM A;  2VI6 A;  1ZG3 A;  2OZU A;  4B4C A;  5L3B A;  1IRZ A;  2EPF A;  4IX7 A;  2V4J C;  2ZNY A;  2XSJ C;  2VQG A;  1IG7 A;  4LJZ F;  3JRC A;  3VEP A;  1OLT A;  3A0B C;  4F3Q A;  1TQI A;  3DBL B;  1ETX A;  1SD5 A;  2VQH A;  4AM3 A;  4S0H B;  1BC7 C;  3M3Y J;  3H36 A;  1FX7 A;  1P4X A;  2L7Z A;  4L9J A;  5J3L A;  5L3E A;  3HOS A;  1U8B A;  1TP4 A;  4EEF G;  3VYR B;  3CCR I;  3N97 A;  5JVT A;  4IJ8 A;  2MD5 A;  3GVA A;  3NQO A;  3TG4 A;  4CSW A;  4BGD A;  1WJA A;  4HX8 A;  4MQV A;  3V4G A;  1LEB A;  5HS7 A;  1Z77 A;  2EIJ H;  2ID6 A;  1QVU A;  3RDI A;  4OIP F;  5C4X J;  3K2A A;  4LB6 B;  1CQT A;  3K4C A;  3K4L A;  3S7B A;  2ZB9 A;  1L3L A;  4G9Y A;  2NS8 A;  2VJ4 A;  3PSF A;  2CSO A;  5M3F J;  2WV1 A;  3M5A A;  3PO3 J;  3LAJ A;  2ZO4 A;  5EEA A;  5K7H A;  1N3J A;  4G7O F;  2E5Z A;  1I3A A;  2ZCW A;  4FET A;  1T95 A;  1PJR A;  4BJ5 C;  3OXG A;  2CQK A;  2BHY A;  2LLK A;  2NVT J;  4QEP A;  4IJD A;  1FOX A;  2QM3 A;  3SZT A;  1ODD A;  3OXL A;  5AYF A;  1RPW A;  2W1O A;  1XC5 A;  4Y13 A;  3M07 A;  5DUK A;  1OCZ H;  3A0H C;  4NB5 A;  4IOC F;  5HDG A;  1O9S A;  1TW2 A;  4CCM A;  4A6D A;  3U2R A;  2XKO A;  3KFW X;  1LB2 A;  2CQX A;  5DEQ A;  3QYF A;  3BJ6 A;  1WFX A;  3D5S C;  4HZF A;  1P6R A;  1ZGJ A;  2PN6 A;  2HOS A;  1G3W A;  2QA4 I;  1QGP A;  2M0M A;  3OOU A;  3BG5 A;  3ZN1 A;  5BMZ A;  3CJN A;  3CTA A;  1IO2 A;  3TO7 A;  3I9V 2;  2QSH X;  1BOA A;  3QP5 A;  5DTD A;  1O3Q A;  3CCS I;  3M54 A;  4Q4Z F;  4KT6 A;  1R36 A;  3JSP A;  3B73 A;  1KZH A;  4D5F A;  3O2P E;  4XLC A;  1QHG A;  1UG0 A;  3GTO J;  2A07 F;  3PM1 A;  2V1X A;  5C44 J;  4MLO A;  1N6C A;  2YR2 A;  4YND A;  4NQW A;  5IP7 J;  2O5R A;  3GZN B;  2EQR A;  2R7V A;  4JX4 A;  2EIL H;  2R92 J;  2RC4 A;  4DZJ A;  2F4I A;  4IF4 A;  1TW3 A;  4IKF A;  2X85 A;  1HBX G;  4UVC A;  2R5Y B;  4GFB A;  2K3F A;  2DDB A;  1R1V A;  2OD5 A;  3GYH X;  2JA2 A;  1JUS A;  3FF5 A;  4E7H A;  1R4M B;  4NC8 A;  2QBY B;  2WC2 A;  1K79 A;  2HVS A;  1D1A A;  2HS5 A;  2PJR A;  4IOA F;  1I5Z A;  1Z3X A;  3K1N A;  2P6T A;  5H20 A;  4CXF A;  2L7K A;  3W2V A;  2DFF A;  3HYI A;  4J7F A;  4KMU X;  2YX7 A;  1XGO A;  4OIR F;  1REP C;  2V7F A;  3F0C A;  1IC8 A;  1X58 A;  2RQQ A;  3BR2 A;  4UUT A;  3K69 A;  2Y2Z A;  4LLG F;  3U9G A;  4A3D J;  1BW6 A;  1FWZ A;  1OCP A;  5FGM A;  1IRG A;  4XSZ F;  2DXI A;  3ZQH A;  2DMN A;  3K4K A;  3DBH B;  1AU7 A;  1A6Q A;  4DJA A;  3JRB A;  1B59 A;  1LFB A;  3VYT B;  3KIO A;  1BW5 A;  3J81 Z;  4H12 A;  3QWW A;  1K61 A;  2LMD A;  2JVH A;  3KET A;  3ULQ B;  1IRX A;  2EFN A;  3BO5 A;  2K3P A;  2ESH A;  3IKT A;  1JT6 A;  1Z05 A;  1BJZ A;  5L3G A;  1MMD A;  2GWR A;  2JSP A;  4PJN A;  2EB7 A;  2K9L A;  3M59 A;  2DW4 A;  3HRM A;  5HVQ C;  5F27 A;  3SZG A;  5GAH J;  2PG4 A;  4YEL A;  2IGK A;  4IHS A;  2BVL A;  2COM A;  2X4H A;  2B7E A;  1BOB A;  4KYW A;  4UB8 C;  3AFH A;  2DT7 B;  4GDF A;  1Z21 A;  1Y39 A;  1ZKG A;  2O7O A;  2G9W A;  5JLW A;  4UNO A;  1KU9 A;  3VUZ A;  2NNY A;  2XDV A;  1B72 B;  2NOG A;  3I54 A;  4OIQ F;  3MCZ A;  2E7W A;  1HF0 A;  3K6G A;  2FMY A;  3KP7 A;  1LUJ B;  1X3W B;  3M7G A;  1XQH A;  3U1D A;  2KQR A;  4RAG A;  2ECC A;  4BUP A;  2Z2S B;  3LMM A;  2G0E A;  3TW6 A;  4BH9 A;  1OJL A;  2VT2 A;  1RI7 A;  3LOC A;  5EG0 A;  1V4R A;  5FRO A;  5BS6 A;  3DTK A;  3M53 A;  2IA2 A;  4A6E A;  3V42 A;  2XUB A;  1ZH5 A;  1NHA A;  4BL0 B;  5D4S A;  5TH7 A;  2BY2 A;  3W6K B;  3L2W A;  3F23 A;  1Y8R B;  3R0J A;  2IS6 A;  3LST A;  3MD2 A;  1ETW A;  3F8F A;  1VF9 A;  2DA5 A;  3FXK A;  1T2K A;  3H92 A;  2M30 A;  2Y0S A;  3MEX A;  4WXC A;  5ILV A;  3L1P A;  3GTJ J;  2IRF G;  2DPU A;  1VQN I;  2RVC A;  4BXU A;  3RKY A;  3KZI C;  3O8G A;  2VOD A;  3CMA I;  1O7L A;  1QBJ A;  1LDD A;  1J75 A;  2QQ9 A;  2MW8 A;  4PZJ A;  3PIO F;  4KJZ A;  1QVT A;  5K5O A;  3EUK L;  1JE8 A;  2OUM A;  2WB1 A;  2XAH A;  3FXQ A;  4PFO A;  4B3X A;  3E1S A;  4MIM A;  1SFO J;  5L3C A;  2LG4 A;  2D45 A;  1JKP C;  3RZD J;  1LNW A;  2A6T A;  4L9T A;  4M3D A;  3JCU C;  4HRI A;  2VOP A;  2K7L A;  3QOE A;  1Z7U A;  3Q0U A;  1MND A;  2STW A;  4XL9 A;  5IOZ A;  1ETY A;  4AC0 A;  4EM2 A;  1E3P A;  3PIP F;  3DLL F;  1H0M A;  9ANT A;  2VKE A;  1M1E B;  5M5X J;  4A3L J;  2KFD A;  3K4M A;  3OYL A;  2UXX A;  5D6E A;  3H9Q A;  4CCL A;  2BOL A;  2W85 A;  2HDC A;  2HQR A;  2R7F A;  2K9S A;  4BEH B;  4I0B A;  3BTJ A;  2BW3 B;  2QLZ A;  4QSH A;  3KLN A;  3H9J A;  2O6G E;  3K2Z A;  3CCE I;  4I7H A;  3FXR A;  3UR3 C;  1X4O A;  3EUH C;  3FXO A;  2KIU A;  3ZMV A;  2MA3 A;  1SVM A;  3Q3S A;  4OAY A;  3WTS C;  2VPR A;  2F4M B;  1H9T A;  3KMA A;  3S16 J;  2IA0 A;  2P4W A;  1XS9 A;  4AYB A;  1GHC A;  5BQT A;  2UWM A;  1J59 A;  2FBH A;  1W5S A;  4M9S A;  3RKQ A;  1PUE E;  3DTI A;  2KT0 A;  5FKL A;  4A69 C;  5K5R A;  2JA5 J;  4RB2 C;  4BS9 A;  3S15 J;  3LFK A;  4Z6Y A;  3KYD B;  4QIW N;  4LG0 B;  1BIB A;  4HDU A;  1V3F A;  3CCU I;  1POG A;  2VJI A;  2NVU B;  4BHB A;  5D5U B;  4IQJ A;  4JBA A;  1FP2 A;  1ZR2 A;  4A0X A;  5HDK A;  5CVR A;  4K2E A;  2F2E A;  3IRR A;  2VKV A;  3VSL A;  3BRO A;  1WQ2 A;  2COB A;  3RYP A;  1UB9 A;  2I10 A;  2EV5 A;  5CCM A;  3LNQ A;  3SYT A;  1SFK A;  2M4G A;  2EFP A;  2HFH A;  4HOB A;  4ZYE A;  3S1R J;  3DBR B;  2ZFU A;  1MBF A;  2KIM A;  1HDP A;  1RET A;  4TV7 A;  1QA6 A;  3HOV J;  3CC2 I;  2MC4 A;  3BTI A;  3C1D A;  1WPK A;  2XPU A;  2VQC A;  4HF2 A;  2BY0 A;  1OYW A;  2YU9 J;  5CVU A;  4ESB A;  4F91 B;  2QKM B;  3TED A;  1XMX A;  1JHH A;  4O6F A;  2O3F A;  1O57 A;  1WH7 A;  5GPA A;  3VFZ A;  1VQ5 I;  2XAU A;  2E36 A;  1S3J A;  3EYY A;  2Y75 A;  4HEA 2;  1O4X A;  3K10 A;  3HKZ A;  4RM2 A;  4A3B J;  1B1B A;  4LLL A;  1S7A A;  2VBZ A;  1DDN A;  4M72 A;  1L0O C;  2VOO A;  4DZP A;  3LSI A;  1KON A;  3FIS A;  2GBY A;  5J8F A;  1TLH B;  2VL8 A;  4AUX A;  4M6Y A;  2R5Y A;  3OPE A;  5L3D A;  5HLH A;  2VC1 A;  5K1Y A;  4BY1 J;  4OIO F;  2QBY A;  3OYA A;  1MIJ A;  4B3A A;  2UV1 A;  4M6X A;  3KP6 A;  1K78 B;  2Z9O A;  1U2W A;  3H1C A;  5K7F A;  1FBU A;  5F08 A;  2VXD A;  3DEU A;  2Y0M A;  4I0A A;  5DM6 F;  2QZ8 A;  3E5Q A;  1SC7 A;  3S1M J;  3S1N J;  4R79 A;  4W97 A;  3SDG A;  3BT9 A;  2E1O A;  1T0F C;  3CCJ I;  1Y56 A;  1EH8 A;  4ZDO A;  2XGE A;  1Z67 A;  2EK5 A;  2E1N A;  2Q1Z B;  4XN0 A;  3PFI A;  4IVN A;  1YQA A;  5EDN A;  2HNH A;  3I3L A;  3DEW A;  5F6F A;  3SZP A;  2FRH A;  4KT5 C;  1KYZ A;  3AL0 B;  2WY8 Q;  4LK0 F;  1X19 A;  2K5C A;  2ME0 A;  3VSK A;  3NEU A;  2L7F P;  2LKP A;  3VPR A;  2ZME B;  4A0Y A;  3H5N A;  1TNS A;  2OF7 A;  3DTE A;  2XAS A;  5CJ9 A;  4EJO A;  5JR3 A;  2XSD C;  3HG9 A;  1IDY A;  4KN4 X;  3CES A;  1AWC A;  5C4J J;  2DMQ A;  5F6L A;  4KIF A;  1MBJ A;  3G73 A;  3ERE D;  2EZL A;  1ZAO A;  1OCR H;  2L4M A;  4EAT A;  4XRS A;  1IAW A;  1GDT A;  5DD8 A;  5LRR A;  4E70 A;  2GAU A;  1ZQ3 P;  3QWV A;  5JVG F;  1MBG A;  4Z4P A;  2B9S A;  2KIQ A;  2VIX A;  4BJT A;  1VZ0 A;  3AG4 H;  3E6C C;  3NAR A;  4XRM A;  1R7J A;  4I99 C;  2WWY A;  1U9N A;  3L9F A;  3N71 A;  3BG7 A;  4NVQ A;  2A6E F;  2EH3 A;  3FXJ A;  1MJA A;  2XGX A;  1Z91 A;  4M71 A;  1SEU A;  5KCM A;  2MLG A;  2CRG A;  1AOY A;  3RAY A;  2QGU A;  2L54 A;  1CGP A;  3AL0 C;  1P92 A;  1ZTR A;  1LFP A;  2W7N A;  4YRV A;  1YS7 A;  3DCF A;  4XKB A;  2MH9 A;  2ZME C;  2IAI A;  1BJA A;  1O3T A;  3CZ6 A;  2G7H A;  1R9T J;  4PSW A;  4D9J A;  2DOA A;  3CCQ I;  1U5T B;  4E7S A;  2M7B A;  2OV7 A;  1OYY A;  3RKX A;  2DOF A;  4I02 A;  3FDY A;  5J4V A;  4U0Y A;  4KIG A;  2HQN A;  3MZY A;  2OJE D;  1IN7 A;  2DU9 A;  2CW7 A;  1GVJ A;  1A6I A;  3BG9 A;  4ZDL A;  5EG2 A;  3FHN A;  3GCM A;  2VE9 A;  3KLO A;  5FO5 A;  4E7L A;  3W2W A;  2O8J A;  3HUG B;  2HGC A;  4UVA A;  1F9N A;  4V2F A;  5B5E C;  4J19 A;  1D8K A;  3GTK J;  3EUH A;  1Q1H A;  3FKJ A;  5J1U A;  3V8K A;  4IJA A;  4C2M J;  3E7L A;  4RA2 A;  1I1G A;  3H3Z A;  3S8P A;  3RPU A;  2RDP A;  1T33 A;  2LTP A;  2X0L A;  5JHU A;  2JK3 A;  1H88 C;  2B63 J;  2QSF X;  5EJC A;  5CVI A;  5EF6 A;  3IL2 A;  2ZBK A;  3S1Q J;  4BDY A;  2E2J J;  3FKI J;  2LFB A;  2TCT A;  1Y1W J;  2HPM A;  3I56 I;  1IDZ A;  4A3I J;  3G1O A;  3HHH A;  3IHU A;  5F04 A;  2EZI A;  1SAX A;  5HS8 A;  3GLX A;  3CO7 C;  2PBI A;  4BEH A;  2BW3 A;  2EA4 A;  2RN7 A;  1RC9 A;  1Z6T A;  2R5Z B;  3BR5 A;  5IT3 A;  4RDU A;  5AON A;  3QOP A;  1D1C A;  3PL8 A;  4XKV A;  2F69 A;  1ZEL A;  2CWE A;  3TBI A;  2GA2 A;  1X1C A;  3FM3 A;  1A36 A;  3TL4 X;  1UJ8 A;  3BDD A;  2VJ5 A;  3C7J A;  4KFC A;  3WHC A;  3EYI A;  2IGQ A;  3T1B A;  2DAO A;  2IVM A;  1HST A;  3DLA A;  4KDP A;  3JTH A;  1N77 A;  3HEF A;  2JPC A;  3J81 K;  4NHJ A;  4EQQ A;  4X1E A;  4LIV A;  2XAF A;  5DCM B;  4MHG A;  4LG0 A;  2D5V A;  1Y8Q B;  1Q1V A;  3F8B A;  2N8G A;  1YTY A;  5FKK A;  3LA7 A;  1HQC A;  2JSC A;  2VAS A;  3H5R A;  5HNH A;  4MQ9 F;  3MO5 A;  1MVH A;  1SFE A;  1QRY A;  2O8X A;  3REO A;  2PX9 A;  2DA4 A;  2DMP A;  1W36 D;  4A3E J;  3OYC A;  1GXP A;  1WI3 A;  2HQ5 A;  4RGR A;  2CH0 A;  4M6V A;  2K9N A;  1XSD A;  3GF2 A;  4P55 A;  4LMY A;  4AD9 A;  4BAY A;  4PFP A;  3RKW A;  4LG3 A;  1FBQ A;  1YS6 A;  4A3K J;  1DGW Y;  2BEO A;  2F6C A;  4EMS A;  1PVE A;  4OAZ A;  5D8L B;  1DP3 A;  2R0Q C;  2TRT A;  3PO2 J;  4ZZD A;  1BI0 A;  3HOT A;  1DPU A;  4ENJ A;  2NVQ J;  2L9N A;  1G4D A;  2MGQ A;  4JX6 A;  3CP8 A;  1BR1 A;  5FFZ A;  3G1L A;  1R1T A;  2LDU A;  3JW4 A;  4XOT A;  1W7P D;  4Y15 A;  5HDN A;  4AU7 A;  4A3G J;  2HKX A;  3BPX A;  3ZMU A;  1RRJ A;  2BE5 F;  2CMP A;  3CLQ A;  4WXH A;  2JVG A;  2KLO A;  4JOM A;  4NBQ A;  4P9F A;  2BZT A;  4GRI A;  5H6Q A;  2HXI A;  2Z33 A;  1VQP I;  2PMH A;  1VQO I;  1BIA A;  5LEJ A;  2VC0 A;  2QEN A;  3OS1 A;  2PLY A;  2L2O A;  4CH7 A;  4QEN A;  3RU0 A;  3OYM A;  2BHZ A;  3HHG A;  1WVR A;  1HW2 A;  4BHC A;  2LY2 A;  3FMR A;  1ML9 A;  1UHW A;  4HF1 A;  2KIF A;  3K9T A;  5FLM J;  4J00 A;  1YW9 A;  5FKM A;  2EJR A;  2FML A;  1WKM A;  3ZMZ A;  2DTR A;  4A12 A;  3BG6 A;  3RTR A;  2W82 A;  4A3J J;  2MG4 A;  1NTC A;  1TWF J;  2P5V A;  2R7S A;  2LKX A;  3CC7 I;  4XNF A;  4EVI A;  2EIK H;  3JRA A;  1UZC A;  3KEO A;  1IRF A;  4RAY A;  4FHT A;  2CUE A;  4EJV A;  5J4Y A;  4J7I A;  1Z9C A;  4MFE A;  4HX7 A;  2DJI A;  5J1Y A;  1I3Q J;  3F8N A;  3FX3 A;  2E2I J;  5D5W B;  1FYL A;  1PDN C;  3CJQ B;  3BR0 A;  2CJJ A;  3TO6 A;  3VWB A;  3GTL J;  4IO9 F;  4NNJ A;  3HXL A;  1TQP A;  1T6S A;  2DYR H;  4RBO A;  2R7Z J;  3JSO A;  1SFX A;  3G71 I;  2EIM H;  4CO8 A;  1YI2 I;  2JJ7 A;  3WE3 A;  2CQN A;  4LK1 F;  2CV2 A;  2ZME A;  1I27 A;  5HNF A;  2OCC H;  2XRL A;  3GTQ J;  2M4K A;  1X2N A;  2V6E A;  2OQG A;  1FBS A;  2EZK A;  1GUU A;  2V1N A;  2ZXH A;  5ERI A;  2JA6 J;  4UHT A;  3PFY A;  2HU9 A;  5IOY A;  3QYE A;  1YJN I;  3RSN A;  3KEQ A;  3OY9 A;  5DV5 A;  3LQQ A;  4PJL A;  4ZYH A;  2JRT A;  5HOO A;  3TDU C;  3DP7 A;  1QU3 A;  4JYK A;  2R93 J;  1S9H A;  3SQN A;  3RQI A;  3JRE A;  1J0R A;  3TG5 A;  3GZ6 A;  1VQ4 I;  4L5E A;  2X51 A;  1X3U A;  5LRS A;  1WHU A;  1MNM C;  3JTG A;  3JRI A;  3A1Y A;  4I6Z A;  4A2U A;  3OSF A;  3F21 A;  1TT0 A;  2FBK A; 
#chains in the Genus database with same CATH homology
 4BDZ A;  3RQ4 A;  2WAD A;  3PNY A;  2GOX B;  2MAB A;  2HPI A;  3LSM A;  4BJ6 C;  5KJN A;  4F55 A;  4KJZ A;  4RLF A;  3EUK L;  2OUM A;  2WB1 A;  3OL3 A;  4B44 A;  5KHD A;  4PFO A;  4B3X A;  3E1S A;  5ARG A;  2R7Q A;  2LG4 A;  5KJK A;  2E1M C;  2A5W A;  4QPQ A;  4PJJ A;  2OC6 A;  2A6T A;  4D1Q A;  4HRI A;  5FRN A;  3QOE A;  3ZQQ A;  1MND A;  3FPD A;  4XL9 A;  4BE1 A;  3F9W A;  4BQQ A;  3SEZ A;  2X6Y A;  2W5Z A;  5HLT A;  3L2U A;  2R3A A;  2BVM A;  3K4M A;  3OYL A;  4HST A;  4PUS A;  3H9Q A;  2X1C A;  2W5Y A;  4XM3 A;  4CCL A;  2BOL A;  3CBP A;  4P5O A;  4BEH B;  3DEE A;  2BW3 B;  4NC7 A;  1YX5 A;  3H9J A;  1UEL B;  3KYL A;  2IS1 A;  3UR3 C;  5HQ8 A;  2ZSI B;  4IQ4 A;  1E0E A;  1X4O A;  3EUH C;  4B47 A;  2LY1 A;  2KRH A;  4BE0 A;  2R4G A;  4HNU A;  2V26 A;  4OAY A;  4P1W A;  3FBN B;  4CZC A;  3KMA A;  4I51 A;  2XF7 A;  4AYB A;  2LOO A;  4YNP A;  2UWM A;  2RFI A;  3HPG A;  4XMY A;  1LKX A;  3DTI A;  4PSX A;  4ZTJ A;  1DQU A;  3VYU B;  4BS9 A;  2R7U A;  3OIP A;  2X6X A;  1P9Q C;  4ZTF A;  3W2A A;  3OYD A;  4RMN A;  4XON A;  2VJI A;  3HPH A;  4IQJ A;  3OS2 A;  1MT6 A;  1FMV A;  3OYJ A;  2CV0 A;  5F59 A;  3CF2 A;  4PJM A;  3VSL A;  1YE9 A;  4AVZ A;  3OOI A;  3OR1 C;  5LD2 C;  3DAL A;  1X4P A;  5TGT A;  1PEG A;  4JLG A;  1MW7 A;  1YX3 A;  4XLH A;  4ANJ A;  4U7B A;  4XOP A;  5CCM A;  1NG6 A;  3SYT A;  1SFK A;  2M4G A;  4DBQ A;  3C2G A;  3K70 D;  4CCJ A;  3S7D A;  4C30 A;  1DGR M;  4H4K C;  4BE2 A;  1UAA A;  2Z1D A;  2ZFU A;  1X1D A;  1WJC A;  3ZXS A;  5ARF A;  3UNG C;  4NQW B;  4J83 A;  3BCB A;  2MC4 A;  2IS2 A;  5JJ0 A;  2VQC A;  3MKW B;  3DPT A;  4F91 B;  1R6R A;  2QKM B;  4O6F A;  3DQV C;  4Y33 A;  4N4O B;  4BAC A;  5F5E A;  1MMG A;  4NUB A;  2R7R A;  3VV0 A;  4X0G A;  2XAU A;  3M56 A;  4BU2 A;  1WJE A;  2F5V A;  4RM3 A;  4IZZ A;  4OWR B;  4HEA 2;  3QWP A;  3K10 A;  3HKZ A;  4RM2 A;  2KPM A;  3DB5 A;  4DBR A;  2JUG A;  2R7O A;  3LL7 A;  5F6K C;  2LBF A;  1WJD A;  3OWT A;  3M55 A;  3LSI A;  1KON A;  1Z7L A;  1D1B A;  3W3C A;  4F93 B;  1X1B A;  2VL8 A;  1D0Y A;  1LVK A;  3OPE A;  4KIT B;  3M57 A;  2X6W A;  4F92 B;  2CV1 A;  3OYA A;  1D0Z A;  1HA8 A;  2UV1 A;  2DCE A;  3DU6 A;  3A4C A;  3CJR B;  4DGW B;  5CQE A;  1MMA A;  1Z3Y A;  4B43 A;  4ZJZ A;  2MD0 A;  3DPU A;  4PK4 A;  1V5G A;  3DKY A;  3K4J A;  1FMW A;  3S3N A;  2HQA A;  2VXD A;  2VLA A;  3OYN A;  2XF6 A;  4R79 A;  5KNL A;  4XKW A;  2PMZ A;  1LDK B;  2Q2E B;  4LDG A;  4YNM A;  1T0F C;  1Y56 A;  4ZDO A;  2XC7 A;  2WAQ A;  1AA7 A;  1GLN A;  4CUG A;  2Q1Z B;  2HVR A;  4LIU A;  4XN0 A;  1Y6I A;  3IHX A;  2LRE A;  4BXF A;  2HNH A;  3I3L A;  4RLQ A;  2GOM A;  4CCK A;  2RNG A;  2KMU A;  3MKZ A;  2VPL A;  4J8O A;  4HNT A;  4MI0 A;  1V5F A;  1N78 A;  3AL0 B;  2WY8 Q;  1X19 A;  2K5C A;  3VSK A;  4YPU A;  4YPE A;  4WUY A;  2VJJ A;  4II3 A;  2W00 A;  2IGM A;  2ZSH B;  3H5N A;  3OL4 A;  3ZRG A;  3QYB A;  3DTE A;  2CUJ A;  3A2K A;  3K5K A;  3OS5 A;  3KEY A;  3S3O A;  5LSX A;  4U87 A;  4DIQ A;  2VXZ A;  3HG9 A;  4JQF A;  3CES A;  2X1E A;  2R7X A;  3FBI B;  5F6L A;  2AQF A;  3PNT A;  4QPO A;  4MI5 A;  3LSG A;  4ITV A;  5LSZ A;  1D0X A;  3NWT A;  3N05 A;  2IGN A;  4XN3 A;  4EAT A;  3MEK A;  1BR2 A;  3KMT A;  3QWV A;  4Z4P A;  4ZYA A;  2VIX A;  3OYE A;  4BJT A;  4DOZ A;  5CCL A;  1VZ0 A;  4Y3O A;  2R7W A;  5KJL A;  2JV0 A;  2WAE A;  3PUB A;  4XLA A;  3N71 A;  3LSK A;  3SDB A;  3BG7 A;  4NVQ A;  1G8X A;  5T5G A;  5KCM A;  3U21 A;  4CCO A;  3RAY A;  4G6T B;  3D5R C;  3AL0 C;  1LFP A;  3M8J A;  2W7N A;  4F52 A;  3K70 C;  3F9Y A;  5T0M A;  4YRV A;  5JHN A;  1MVX A;  3OYI A;  4XKB A;  3CZ6 A;  4XQF A;  2MFZ A;  4PSW A;  3BC8 A;  2DOA A;  3BLY A;  4D9J A;  4E7S A;  2LYC A;  2M7B A;  2OV7 A;  1QHH D;  1G59 A;  1SAU A;  3FDY A;  3K4B A;  2NOJ B;  1ZKK A;  4RZ0 A;  2BQZ A;  4XOR A;  2CW7 A;  3AKZ A;  4ZDL A;  3H5A A;  1K6Y A;  5EG2 A;  2IGO A;  1MUF A;  4XLE A;  4YEJ A;  3FHN A;  2W4S A;  1JI8 A;  3IUO A;  3MMY B;  3QOD A;  1ERD A;  3LSH A;  4E7L A;  1V5E A;  3PNV A;  2WY7 Q;  3W2W A;  2O8J A;  3F9X A;  5JHF A;  3HUG B;  3CBM A;  1OR7 C;  4E7Z A;  4IX7 A;  2V4J C;  2XSJ C;  2VQG A;  3FKJ A;  2K9M A;  5EX3 A;  1OLT A;  4F3Q A;  2VQH A;  4NJ5 A;  3S8P A;  3SEQ A;  2KP6 A;  3K4N A;  2M7A A;  3EUA A;  3HOS A;  4E6K G;  1J09 A;  1X1A A;  3VYR B;  4IJ8 A;  4BDY A;  2CFO A;  5TTF A;  4CSW A;  4BGD A;  3TG4 A;  1WJA A;  4CA0 A;  2HPM A;  4XLF A;  1BR4 A;  3CBO A;  3J7A Y;  3S32 A;  3K4C A;  3K4L A;  2LH9 A;  3DU5 A;  4BEH A;  3S7B A;  1TZL A;  3H35 A;  2BW3 A;  3OS0 A;  3PSF A;  2VJ4 A;  2KL4 A;  3M5A A;  2E1M B;  3MKY B;  5LFA A;  3H9G A;  1N3J A;  1D1C A;  3PL8 A;  2E5Z A;  4XKV A;  4FET A;  1T95 A;  1ZEL A;  1PJR A;  2F69 A;  1NG7 A;  3TBI A;  4BJ5 C;  3OXF A;  3OXG A;  2AQE A;  3M1C A;  1X1C A;  3TL4 X;  4IJD A;  4QEP A;  3TMO A;  2VJ5 A;  4FAS D;  3OXL A;  5AYF A;  2LRD A;  3SWC A;  2IGQ A;  3OMY A;  1N6A A;  2W1O A;  4ZC3 A;  3CP2 A;  3VDX A;  5KJM A;  3DLA A;  4J01 A;  3OYG A;  2V9K A;  1O9S A;  5JIY A;  3OR2 C;  1N77 A;  4CCM A;  1WJ5 A;  1H3I A;  4LIV A;  2HVQ A;  2WBM A;  3QYF A;  1WFX A;  3D5S C;  3HC7 A;  2VAS A;  3H5R A;  5HNH A;  2M0M A;  3OOU A;  3RCO A;  3MO5 A;  2VB6 A;  1MVH A;  5CPR B;  3I9V 2;  4HSR A;  1W36 D;  1MNE A;  3OYC A;  3M54 A;  2CH0 A;  3KX2 A;  4KT6 A;  1MMN A;  4B48 A;  3HNA A;  3D5L A;  4PFP A;  4E47 A;  3RJW A;  3MO0 A;  3DKX A;  2E60 A;  4LG3 A;  2KDO A;  5T0K A;  4N4N B;  4XLC A;  1QHG A;  1DGW Y;  2L9S A;  1UG0 A;  3L2Q A;  3L2V A;  4C2U A;  3KMJ A;  3OYH A;  2F6C A;  2VKH A;  4MLO A;  5CKT A;  4E4H A;  3OIQ A;  1N6C A;  4OAZ A;  3L2R A;  4YND A;  1DP3 A;  3BCA A;  2LBF B;  4Y4R A;  3S93 A;  2O5R A;  3HOT A;  3H0D A;  2R7V A;  2L9N A;  2CS3 A;  2E5N A;  2QKL B;  4LIT A;  2F4I A;  3CP8 A;  4IKF A;  5JIN A;  1BR1 A;  2X85 A;  4XKC A;  2WAF A;  3S7J A;  4XOT A;  4AU7 A;  2JA2 A;  3LFU A;  4E7H A;  4NC8 A;  3RIB A;  2VQL A;  2XF5 A;  3HL2 A;  2HVS A;  1WJF A;  1D1A A;  2CMP A;  2JVG A;  2KLO A;  4JOM A;  2PJR A;  2HZD A;  1Z3X A;  4GRI A;  2G46 A;  2FUG 2;  2LC2 A;  2L7K A;  3W2V A;  4J7F A;  4C2T A;  2P0W A;  2RRE A;  2L2O A;  3OS1 A;  2QPW A;  4CH7 A;  4QEN A;  2V7F A;  3RU0 A;  3OYM A;  4C9Y A;  2RQQ A;  3M58 A;  3OYK A;  2KRC A;  2MYS A;  2LY2 A;  2L5Q A;  2UUZ A;  3DPL C;  3F9K A;  1ML9 A;  3E0J B;  4J00 A;  3PSI A;  2DXI A;  3K4K A;  3BG6 A;  2IXS A;  2W82 A;  3RTR A;  4DJA A;  5FRM A;  3SW9 A;  3VYT B;  4FMU A;  1N75 A;  3ONQ A;  2R7S A;  2I8D A;  4XNF A;  3RPU D;  4H12 A;  1U0J A;  3QWW A;  2JVH A;  4KIS A;  4J7I A;  3S7F A;  1IRX A;  3OYB A;  3BO5 A;  2K3P A;  2DJI A;  3GBG A;  4BQO A;  2KHM A;  3PDN A;  3ZCO A;  5HI7 A;  1MMD A;  2JSP A;  4E7K A;  4PJN A;  2K9L A;  3M59 A;  4BQN A;  3CJQ B;  2ZXI A;  3EPZ A;  4ZDP A;  5HVQ C;  3SZG A;  3VWB A;  3PJR A;  4YPA A;  4YEL A;  4NNJ A;  3HXL A;  2IGK A;  2BVL A;  3ZR8 X;  3OYF A;  5TEG A;  3S3M A;  3EP0 A;  1BOB A;  3AFH A;  2DT7 B;  1Z21 A;  4JDS A;  3VUZ A;  2CV2 A;  5HNF A;  2XDV A;  1EA3 A;  2M4K A;  2VKD A;  2V6E A;  2CW8 A;  3DWL E;  2V1N A;  2ZXH A;  3K6G A;  3IP4 B;  4II2 A;  3NWS A;  3PFY A;  2HU9 A;  3QYE A;  1XQH A;  3RSN A;  2KQR A;  3IAS 2;  5HOO A;  4PJL A;  2X1D A;  4BUP A;  3OY9 A;  4E7J A;  2Z2S B;  3LMM A;  2PJR B;  1QU3 A;  4QEO A;  3IAM 2;  1S9H A;  2KZV A;  5FRO A;  3DTK A;  1PYV A;  3M53 A;  3V42 A;  2Z16 A;  2R7T A;  2HDW A;  3TG5 A;  4HPQ A;  2WA0 A;  2DT6 A;  4BL0 B;  5TH7 A;  2M3A A;  3MO2 A;  4HG2 A;  3CMM A;  3L2W A;  2X51 A;  3G2B A;  1W36 C;  1WJB A;  3C2H A;  5EX0 A;  4E7I A;  2IS6 A;  3MD2 A;  2ELJ A;  4O30 A;  3F9Z A;  4C1Q A;  2Y0S A;  4XR6 A;  3A1Y A;  3VYS B;  3ZGK A;  4CCN A;  5CQG A;  1TT0 A;  2IS4 A;  2CUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...