3S8PA

Crystal structure of the set domain of human histone-lysine n-methyltransferase suv420h1 in complex with s-adenosyl-l-methionine
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
263
structure length
233
Chain Sequence
MSAKELCENDDLATSLVLDPYLGFQTHKMNTRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKEHVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEENMLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYTCERRGTGAFKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the human histone H4K20 methyltransferases SUV420H1 and SUV420H2.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SUV420H1
total genus 60
structure length 233
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1700 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3s8pA01
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s8pA02
3F9YA 2QPWA 1XQHA 5TH7A 4O30A 3F9XA 1O9SA 4IJ8A 3RIBA 2G46A 1N3JA 3HNAA 3RU0A 3OXGA 5LSXA 4JDSA 4C1QA 3F9ZA 4WUYA 3QWPA 4J8OA 4JLGA 4YNMA 1MVXA 5LSZA 4MI5A 3S7JA 3K5KA 3N71A 1MVHA 3IHXA 5TEGA 3QWWA 3SW9A 1H3IA 3EP0A 5ARGA 3FPDA 4J83A 3VV0A 3M53A 5KJNA 5KJKA 3M59A 4E47A 2JV0A 4J7FA 3M56A 2BQZA 4MI0A 3MO5A 5T5GA 3BO5A 2R3AA 3TG5A 5JIYA 3DB5A 4YNPA 5HI7A 1ZKKA 5F59A 3KMTA 2W5ZA 2IGQA 4FMUA 5AYFA 3M5AA 5F6LA 3CBPA 3DALA 3TG4A 1MUFA 4J7IA 5EG2A 3SWCA 1N6AA 5CCMA 3QWVA 4YNDA 3OXLA 4LDGA 3RAYA 2F69A 1MT6A 4YPAA 1PEGA 3M54A 3CBMA 3MO2A 4BUPA 5JHNA 5JINA 4H12A 2O8JA 5CPRB 3CBOA 1ML9A 3PDNA 5F5EA 5HQ8A 4QEPA 5EX0A 4NJ5A 3MO0A 4YPEA 4NVQA 2RFIA 5ARFA 4QEOA 5KJLA 3RQ4A 4RZ0A 5CCLA 3M55A 3KMJA 3VUZA 5F6KC 3OOIA 4AU7A 5EX3A 5T0KA 5KJMA 5T0MA 3S8PA 4YPUA 3S7FA 3M57A 2W5YA 3S7DA 4QENA 3S7BA 3OXFA 3OPEA 4I51A 3F9WA 5JJ0A 4IJDA 5TTFA 3M58A 4Z4PA 3MEKA 3RJWA 4O6FA 1N6CA 3OS5A 3KMAA
chains in the Genus database with same CATH superfamily
5D6EA 2EIMH 3M8JA 4BDYA 3RI4A 3GZ5A 2IS2A 1YG2A 3FMRA 4BL0B 2KZVA 1H9GA 2EA2A 3E1SA 2F5FA 3HB9A 1O3QA 2P5KA 4EM2A 4IRGA 1G3SA 4JQFA 3CESA 1X2MA 1GT0C 4RA2A 4UHTA 3EDPA 1Z9CA 3MAJA 3TL4X 1IXCA 1LFBA 3S7JA 1K6OA 4Q48A 1Z91A 4M3GA 4E7IA 4FHTA 2O8XA 3EUHA 5J8CA 3K1NA 1YS6A 2BZTA 2Y0SA 2VLAA 2LNBA 1YW7A 3A01A 3GBGA 3TDZC 4DYQA 4IHXA 3F6VA 2X1DA 1FOKA 3K70D 2BQZA 1EH6A 2DPUA 2ZXWH 5FJ8J 2YX7A 4DYCA 2V9VA 3REOA 1QU3A 1IO2A 3A01B 4XR6A 1OISA 4BY7J 1WGXA 2FD5A 4MHGA 2M7BA 3V7RA 2EZIA 2VXDA 3BDDA 3DEWA 3CF5F 3DFGA 3OIQA 3RPUA 2ID3A 2CW0F 2PG4A 3O8HA 1OYYA 1LDJA 3WU2C 2DT7B 3ZMZA 1HC8A 4FQGA 1ZG5A 5F1JA 3OYIA 5E3LA 1D0ZA 3CCQI 4KMUX 1YFHA 4XKVA 2KPMA 1BI1A 2DU9A 1E0EA 4A0ZA 5IT9K 4BU2A 2HFHA 1TBXA 1YTYA 4N4NB 2V26A 4LK0F 1TWFJ 3DKXA 4XSXF 5EEGA 4GRIA 2GZWA 1DP3A 3OL4A 3BR3A 4XORA 1IN5A 2H94A 3IH3A 2DJNA 4XN3A 1UB9A 1MMDA 2DT6A 2VN2A 4U0WA 5HOOA 5KNLA 2A68F 2XB0X 1T33A 1W5TA 1WFXA 4PJ0C 2K4BA 3HOXJ 3OYBA 2RNGA 3R6SA 4IVNA 2QSGX 1X4OA 1TP4A 1F1ZA 1OYIA 2VQCA 3HDDA 2M9HA 2ZXHA 4IF4A 1VQ9I 2FRHA 2QQ8A 2XAQA 2HYGD 1HF0A 4ENNA 3H3UA 4XLFA 3VDXA 3HKZN 4V19K 2UWMA 3BG6A 2L3DA 3CUQB 4O30A 3SZTA 4F93B 2IS6A 2XPVA 4IJ8A 5CVJA 5JI6A 4BDZA 1FY7A 1Z3XA 3I3LA 1I3AA 2EH3A 3LWFA 1ETKA 4NQWB 2A5YB 4CA0A 2GXBA 3PQJA 1ON1A 3BZKA 1GV5A 4HDUA 2YU9J 2LC2A 4JLGA 2DCEA 4AC0A 1BI2A 2I5UA 3ZQIA 2D1VA 2PJRB 1M1EB 4X0GA 4G6TB 1YJWI 3E6MA 4W1UA 2QM3A 4M6VA 1O3SA 3E0JB 2IGMA 2P8TA 3CDHA 2STWA 4NNJA 3KZIC 1JUSA 3JRFA 3DKYA 2NS0A 5F0CA 4G7ZF 1HKQA 1Z6RA 2E1OA 4KIBA 2ZFWA 4YIFA 2VJJA 4LLLA 2R93J 2R3AA 3CCMI 2DK8A 1T0FC 5FFXA 1MDMA 1PJRA 2HZDA 4AUXA 1Y0NA 1IG7A 3MKLA 3U1KA 4AIKA 3A1YA 3BR2A 3OR1C 1T8IA 1FZPB 1RIOH 3FXKA 1ZRCA 5M5XJ 1LE8A 2OD5A 3JRCA 1R6RA 2KRCA 1USTA 4XRFA 3V8JA 5BMZA 1S3JA 3D5RC 1VQNI 3OSFA 2CQ7A 1WSUA 1ZTRA 1NTCA 2CQXA 2KL4A 3D5LA 4IO9F 1UCRA 1LQ1A 2JA8J 2M45A 2L0KA 2RNJA 1BR4A 4KICA 4NC8A 5IOZA 4KYWA 3GEZA 1VQMI 2K5CA 2OBPA 1R22A 1ZG1A 4BJ6C 3CCEI 3VUZA 2M87A 1IRGA 2MH9A 2JRTA 4L18B 5E20A 4WXCA 3G73A 2HTSA 1MSEC 1T08B 2L9NA 3TQNA 4QENA 3ABUA 3K4KA 2HR3A 2JTVA 1SFOJ 1O7FA 2RREA 3HGYA 4GO1A 1J9IA 1X1CA 4Y4RA 3K2AA 1XX5A 4HQMA 4JX6A 3I55I 3JAMZ 2OZ6A 4XBFA 2K7LA 1MNDA 3QPLA 3MEKA 3HSFA 3V7CA 2JPBA 2CRGA 4P1WA 1N6CA 4N0BA 3DU6A 3CJTB 2A07F 1BIBA 2DK5A 2XRLA 3IH2A 1XQHA 3K9TA 1W7PB 4KITB 1WPKA 1I6HJ 5IYCJ 2YU3A 3QYBA 4PFPA 4E7HA 2EPFA 2ZNZA 3OS0A 1RESA 2R7TA 1XGMA 1MJAA 1G3TA 4C1QA 3JCUC 3CUOA 1PUFA 2LBFB 2ZMEC 1AHDP 1K7AA 3J7AY 2DFFA 2NOGA 2ZFUA 1KGSA 2LSOA 4E7JA 2F6CA 2PMZN 2L2OA 4ZYAA 1T6SA 3H5NA 3GFIA 2F4OB 3ABTA 1OCZH 3M1CA 4L5IA 2HQ5A 1WZ2A 1HSTA 2WAQN 4EQQA 3CMAI 3FBNB 3QU3A 2XGEA 1HKSA 2Y30A 3KP4A 4HRIA 1QQIA 1X58A 1SD7A 4UVAA 2DO7A 2L5QA 4LIUA 2HZTA 3HBLA 3S1RJ 2LBFA 1J09A 2Z16A 3B6CA 4GYIA 1AU7A 1T38A 2VODA 5JIYA 1E3OC 3NRVA 3GLXA 2IAIA 2E35A 4M3FA 3MKZA 2H1KA 2M5WA 2PLYA 2DLLA 3MVPA 5E17F 1Y0UA 5AYFA 1T95A 2M0MA 2J5PA 3AG4H 5FROA 4L9NA 1SMTA 2MLGA 2CFXA 2W84A 3CC2I 1IN7A 3CO7C 3H0GJ 4BQNA 1W7PA 1OCTC 4NHJA 3E6BA 2FMLA 3CMYA 2JSPA 5EEAA 1HQCA 3QQAA 5LFAA 2VJ4A 2R92J 2QF7A 1GVDA 2IA0A 1P7IA 2OQRA 2EINH 4XIDA 2Z1DA 1OCCH 4A3CJ 3ZR8X 3ERMA 3DF8A 1WH5A 2VJIA 3IRQA 4XN0A 3C1DA 5GTHC 2EFWA 1IN6A 3RQ4A 4RAYA 3M55A 3KMJA 3K4BA 2NVXJ 3OOIA 2VKDA 2IS4A 3PFYA 3CMEI 1ETQA 4LG3A 1D5VA 3RKYA 1FOYA 1ZRFA 2F5DA 1IV6A 4CCNA 3S7BA 1DP7P 3OPEA 2CV1A 1YIOA 2ECCA 3E5UA 1F9NA 2H8WA 3O6BB 4CICA 1XD7A 5HNFA 4EGYA 1SD5A 2ACJA 1MNMC 4UUVA 2KZGA 3F72A 2L9VA 3KE2A 4S0HB 5CQGA 4G12A 2XIGA 2EFPA 5FKNA 5ILSA 3MN2A 1YLFA 1FBUA 4BJ5C 4PUSA 1ONVA 3HIFA 1A5JA 2W7NA 3ZQQA 5J4YA 1LE8B 3AG1H 4XLHA 3OOPA 1X19A 3HRUA 1RR8C 3HOSA 1BC7C 3LFKA 5TISC 2VKHA 5FLMJ 1G59A 3KFWX 5E1XA 1DU6A 5D6FA 3OXGA 2O7OA 3LSTA 4RM2A 2D2WA 1JGSA 1W36C 4A3LJ 3FK6A 1RKTA 1FP1D 4QLCU 2E2IJ 2V1UA 1Y56A 4GYGA 2WY7Q 4XOPA 1TQPA 2WAEA 2Y48A 4RLQA 2EZKA 3R4KA 3CCJI 4PGHA 4DJAA 2M8EA 3OYLA 1PUEE 3OYGA 5GTIC 2O61A 3K1PA 4ZTJA 2BY3A 4PGGA 1U5TA 3T8TA 1R1VA 1IDZA 1UHMA 2AS5F 2VOPA 2VT2A 2DMNA 3MZHA 1ZARA 1XSVA 1TT5B 1S5LC 3TW6A 2QUFA 1JXSA 1ZRDA 2DFHA 4ESBA 3K1MA 1N78A 4HG2A 4E7KA 4M3BA 3FXMA 5CKTA 4K2EA 3FK7A 2ME6A 4W97A 4A3MJ 1A04A 2LREA 1XGNA 3TO6A 3CZ6A 2GAUA 1OCOH 3FBIB 3ERED 2HOSA 3I56I 2E7XA 4HW0A 2DA2A 3BCAA 2RVCA 3DPLC 2HQAA 2PEXA 2Y75A 2LF8A 2OU2A 2VE8A 1WJDA 3GFMA 4M9SA 4YIRX 2FUG2 1F43A 2WC2A 3CMMA 1R1UA 5EG0A 3PL8A 2D45A 3M54A 4LLNA 1Z1DA 2E1CA 2MW8A 1XGSA 3D0SA 3WODF 3L2CA 3BJOA 5KAFC 4B3XA 3EUKL 1TT0A 2ZNYA 4V2FA 2XAJA 1JJ8C 4M72A 3OYFA 3JRDA 1D8KA 1BR1A 5CJ9A 4QEOA 1JUPA 1V5FA 4HSTA 3B02A 2DYRH 2DDBA 3KZYA 3KP3A 4AU7A 3WTSC 3OYHA 2DXIA 4RGRA 5T0KA 1UHSA 4XSZF 1MW7A 2KHMA 3J7YJ 2YS9A 3WTTC 4EVIA 3OSGA 2HGCA 3LAJA 2KRHA 4UUSB 3EYYA 2H6BA 2ZMEA 1OR7A 4IEJA 3BTJA 2MH2A 1EV7A 1UZCA 3F8NA 4NUBA 2ESNA 3M58A 5TTFA 1SANA 1DGRM 2W48A 4HF2A 2CYYA 3I54A 1YI2I 2K86A 2L54A 1Y1VJ 3FMSA 1ZELA 2MBFA 1Q1VA 4NB5A 3VYRB 3SJMA 1SVMA 1F5TA 5KK1A 2PX9A 2Z2SB 1EJ9A 3G1LA 2UXXA 4G9YA 4IOCF 5EGOA 1YITI 1AOYA 3KYCB 2GXGA 1FIAA 4AVZA 5H6RA 5J4VA 4AM3A 2PI0A 1ETWA 2YUSA 4XKBA 1WJFA 5LD2C 3HOVJ 3E5XA 2E1NA 5E3OA 3WGGA 2VKEA 3F22A 4Q4ZF 3DV8A 5FKLA 2HYJA 3C2GA 2EV6A 1R4NB 2KDOA 2ZXJA 4F52A 3RKQA 4IX7A 1H3IA 2NVQJ 2PBIA 1ZLJA 2LF7A 2ECBA 3ZN0A 2G7HA 1FBQA 3H5AA 1VQ5I 3IV5A 5L3BA 3CC7I 5EZHA 1Z21A 1NHAA 4IZZA 1ZLKA 4LB5A 2JV0A 5F6FA 3O8GA 1QGPA 2KDZA 4G7HF 2R7OA 4OINF 5T5GA 3BCBA 5BPDA 4OWRB 3TOBA 3CDIA 2FOKA 4KT5C 4ENKA 3TGNA 1J75A 1HA8A 2M30A 3WHCA 3FIWA 4D7NA 4QIWN 3L00A 3OV8A 1ZN2A 3DKWA 3GWZA 3BG5A 4M6YA 3H9QA 2OJED 2JJ7A 4E7SA 3M1EA 3K70C 1MD0A 5B3SH 2DW4A 5CCMA 2CGPA 4B44A 2PQ8A 3A0HC 5EF6A 2F69A 1ACIA 4EJOA 3KP7A 4C30A 3FHZA 3MO2A 1P6RA 5DCFA 2BVLA 3HUGB 3ZMSA 5ICGA 3VOEA 2WAQA 4O3MA 4GDFA 1OCRH 1TNTA 1JHHA 4EGZA 1VQLI 2IGNA 3VYSB 3ZOBA 3LSJA 3IWFA 5IT9Z 3SEQA 1N75A 4QEPA 2K3FA 4JP0A 2R7XA 2IGKA 5LRRA 4S04A 1O3TA 1MSFC 4RZ0A 2WB1A 2JPCA 1FPQA 4EMSA 5AIQA 5KJMA 4OAZA 2FU4A 3AG2H 1BW5A 1MMNA 4I01A 2GA2A 2CU7A 4EM1A 5ICEA 1YRNB 5K7HA 3A2KA 2HDDA 2MG4A 4OIPF 2E2HJ 3GW2A 1J5YA 2FBHA 3EETA 1R23A 4PSWA 5KHDA 2YX4A 2EWNA 1P9QC 5DS9A 4RDUA 5BNGA 4ASNA 3ISPA 5HDKA 3I59A 1J0RA 2A3SA 4Z2YA 5K5QA 1KU2A 1YHQI 4A3BJ 2WB1N 5JR3A 3GMEA 2ETHA 2VBWA 4RMNA 3WTWC 2CS3A 2KIQA 1DU0A 4DIQA 4ZTFA 3PO3J 2KIMA 2R7FA 4AIJA 2VC1A 2VI6A 1B6AA 3VSLA 2IJLA 3FX3A 4GFBA 1FEXA 1FOXA 3FHNA 4BQQA 3DTKA 2M34A 1R1TA 2P7VB 4HZFA 4CCOA 2WAFA 4CO8A 4LOCA 2V9KA 1WQ2A 4BE0A 3QWPA 3LOCA 5GADJ 1YIJI 4QSHA 2KMUA 4MI5A 1H89C 3N71A 1MVHA 1WH7A 1R00A 2NOJB 4LITA 1JT6A 3A03A 4A69C 5TRDA 2OZUA 3E5QA 2MD0A 5L3DA 3VPRA 3BOQA 3CCLI 4FCYA 3A02A 5DUIA 4KISA 5KJKA 2QBYA 4RLFA 5C3EJ 1MJ9A 4RAGA 2ZCWA 1FC3A 3H9JA 2Y0SN 2CG4A 3BQZA 4HNUA 4MI0A 1WKMA 3BPXA 2L4AA 1HBXG 2V9PA 4BE1A 4KT6A 2QBYB 5J6XA 3L9FA 1MH3A 1EH7A 1GUUA 1HKTA 3LSHA 2Q2EA 4MQ9F 1IW7F 5ILUA 1SEUA 3CC4I 3DLAA 1L3LA 2GOXB 3M4OJ 2CUJA 2JA6J 1OYWA 2O6GE 1W4MA 4HQEA 3IH4A 4IHVA 1FP2A 3JTHA 4NQWA 1FSHA 3BTIA 1SFXA 4BUPA 1MIJA 1SD6A 1GVJA 1X1BA 4JK1X 1BN5A 2NRAC 2MYSA 3I59B 1V4RA 1KQ0A 2A69F 4HF0A 3ECHA 3KCCA 3CUQA 4B47A 3BR5A 3FXQA 1KZHA 3F8BA 5DYMA 1XS9A 5KJLA 4L9TA 4WX9A 5EX3A 1DPUA 5T0MA 2XKOA 2CJJA 3S7FA 1OMIA 2HPIA 2J5OA 1RUNA 1IRFA 1TTYA 3L09A 3ZQ7A 1OPCA 2X85A 3Q0WA 4PFOA 3DBRB 3BPVA 2LYCA 5DD8A 1QPIA 5LBQA 4GGGA 5F04A 3V42A 2CUZA 2EV0A 4DW6A 1RRJA 3RJWA 3EPZA 4IHTA 4UB8C 1PDNC 3OS5A 3KYDB 4IRHA 3GTQJ 3I64A 3KMAA 1IXRC 1O7LA 1A6QA 2ZXIA 2DFEA 2R7DA 4ZH4F 3U2RA 2PJPA 1YO5C 3F23A 2EQRA 4CCLA 3KEQA 1G3WA 4Y52J 4X1EA 2GXAA 5DUKA 4BHPA 5M5YJ 2RQPA 2Z5UA 1GLNA 1LJ9A 1HW5A 2H6CA 3P5JA 2L7KA 4IOAF 3PNYA 2GOMA 5IY5H 4WUYA 4QPOA 2XVCA 5FB2A 1MVXA 2CUEA 1JKQC 5LSZA 1V54H 2A61A 1FYMA 1B9MA 4Y33A 2OQGA 1DQUA 3BWGA 5ICFA 4NC7A 3ZPLA 2ZKZA 3SW9A 2LMDA 5ARGA 3CP8A 3ZMUA 2DTRA 2Q0OA 4BGDA 4KN7X 4HA8A 5M3FJ 2IP2A 4D5CA 2LKXA 1FOWA 1EA3A 3FMQA 5J1YA 4IHSA 2UUZA 3E97A 4II3A 2Z9OA 4BHBA 2K02A 3CCUI 1XN7A 4DBQA 3Q9SA 1YQAA 4BNCA 4DYRA 3DB5A 3HHGA 1OR7C 2HVQA 5HNHA 1HOMA 2DOFA 1F36A 1BIAA 3BTCA 1XCBA 3ZQFA 5FD5A 2KQRA 4UUTA 1DUXC 4FISA 2W00A 3RZDJ 2QWWA 3N4MA 2QKMB 3DTEA 1MMAA 4JBAA 4LG0B 2XAFA 3IAM2 5FFZA 1T2KA 3OXLA 3QRFF 1PEGA 5DTDA 3B6AA 4RM3A 2WWYA 1VF9A 3KP2A 3HKZA 4BE2A 3OYKA 5LEJA 5ED4A 4XLAA 2XGXA 4BXXJ 2JK3A 1BA5A 1VQPI 3V8LA 1MMGA 1OCPA 4FETA 2Q8KA 1B9NA 4A3IJ 4BBSJ 2RN7A 3QWLA 2MFZA 4MIMA 2Z33A 5ILVA 1VTNC 1STZA 5JHUA 1LFUP 4RB1A 3BQYA 3E3VA 5F6KC 1HDPA 3PUBA 1U8BA 2ZJRF 1IAWA 2XB5A 5HODA 1K61A 1K78A 4IKFA 1B8IA 5L3FA 3PIPF 2JRMA 2AHQA 3F9KA 5GAGJ 3Q0VA 4UUSA 1MMSA 2DMQA 2OA4A 4RBOA 1EKEA 1ZGJA 2E5ZA 5FRNA 4CUGA 3S2HJ 3LSKA 4MTDA 1YJNI 4IJDA 1FBSA 2P5LC 2C6YA 3DWLE 3X2QH 3N05A 4ETSA 2IW5A 5LHIA 3H3VK 5K7FA 5LGNA 2NNYA 4S05A 2VT3A 1XG1A 1QZZA 4HV5A 4ZYHA 2DODA 2WTEA 5HVQC 1XMKA 3I58A 3K69A 1FLIA 2R5YB 4A3KJ 3HOWJ 4B48A 4I7HA 1ZHFA 3HSRA 5K5RA 2F4IA 2K40A 1FMWA 1I1GA 1YW8A 2G46A 4EM0B 3WTXC 3RU0A 3U9GA 2F4MB 2V4JC 3K10A 4XMYA 4A2UA 1BI3A 1HLVA 4QPQA 2V1XA 1I27A 3UR3C 3COAC 2FXAA 4FE7A 2L9RA 4CCJA 2UZKA 3PSIA 3NWSA 4HOBA 3H3ZA 1C0WA 1S6LA 4P5OA 5C44J 4DOZA 4WK8F 4ZYDA 2XDVA 2ISZA 2ZJPF 5CVIA 4R8HA 2NXNB 3CLOA 4B8XA 3PO2J 2BGCA 4J83A 4ZYGA 3M53A 1JKOC 1S7EA 1IUYA 5D5VB 3CP2A 5EGOB 3RSNA 1JTYA 3PNVA 2BVMA 2HQRA 2DA4A 1GHCA 3NEUA 2DAOA 3DQVC 3AL0C 3PM1A 3D1NI 4CDGA 3CJQB 1L0OC 4XRSA 2HDCA 1FWZA 3RPQA 5F59A 4I98B 3GVAA 3I4NJ 4A3GJ 2OCCH 2ESHA 1LUJB 5K7ZA 1HSJA 3L2WA 1MJBA 1REPC 2GQQA 3C2BA 1OFCX 4CCMA 5J1UA 5EG2A 2V1DA 5BPIA 2ME0A 3BG9A 2Z3YA 5EYRA 1MGTA 3R61A 1X1AA 1ZH5A 3KPHA 2MA3A 3RAYA 1UFMA 1B59A 3M9AA 1SFEA 1S29A 2RGVA 1QZYA 2V79A 4V2GA 2W85A 1ZAOA 2E36A 3QPHA 5FLVA 4L9VA 4AD9A 1ML9A 4G6QA 2BW3B 2PMHA 5F5EA 3LAPA 2Y69H 1BM9A 1X1PA 1G4DA 3OYCA 2R4GA 4YPEA 3SDBA 1U2WA 1W36D 1KU9A 2VQLA 5IPAA 5EG0B 4C3HJ 4U0YA 2EILH 2O9LA 3JSPA 2EK5A 2QEXI 3BJAA 2IVMA 2X9DA 1PUFB 5C4XJ 3IKVA 1BI0A 2LDUA 5GAEJ 4OIQF 4M9ZA 5C4JJ 3MKYB 3OXFA 3BZ6A 1D1AA 2MC3A 2VC0A 3PSFA 3OY9A 2X48A 2QZ8A 5M3MJ 2RKHA 2FF4A 1P2FA 5LGUA 2ZJ2A 1QZEA 3S3OA 3BZCA 2R7WA 3U21A 1TQMA 3B73A 1ZR4A 2O03A 1X3WB 4CYCB 3ZMTA 2OF7A 5HS8A 2JVGA 1FJLA 2A6TA 2DQLA 3BR1A 1CGPA 2QGUA 3F8MA 3BJ6A 3RIBA 2E2JJ 1TQIA 4X6AJ 2BOLA 4WCGA 5DV5A 1N3JA 3HNAA 2R5ZA 4EV0A 3PFIA 4XQFA 3W6VA 2DA5A 1TWCJ 5LSXA 1I3QJ 1X4PA 5B1BH 1ZGWA 1LNWA 1FTTA 1Z6TA 2CQKA 1IRXA 4XLNF 4UNOA 3DXJF 3AKZA 4OMYA 2DYSH 3ECOA 3T5XA 5CVUA 2FNAA 2L4MA 3Q0UA 2VASA 4E4HA 4BQAA 3FPDA 3VV0A 3ZQHA 4A6DA 3W6KB 3M59A 3VWBA 2NYXA 1VQ7I 2LY1A 3IKTA 2EJRA 2XSJC 3HG9A 2K85A 4GCVA 4LMYA 3KZZA 2RC4A 3G71I 1RI7A 3MO5A 3BR0A 3NQOA 2KFDA 1FX7A 3F0CA 3LA7A 4U7DA 3KMTA 3WTYC 4LIVA 2G9WA 2LP0A 2HEOA 3I53A 5CYVA 5F6LA 1TWHJ 4ZDPA 5M5WJ 3CBPA 3WTVC 1MKMA 2XRNA 3RYPA 3HM5A 4WWCA 2NVTJ 4BEHB 3HRSA 4IQJA 2WY8Q 3L2UA 1MNEA 1ZG3A 1WWXA 1BC8C 4LDGA 4QTRA 2ZC2A 2ADUA 2P7CB 5IYDJ 3GXOA 5E18F 2E5NA 2R5ZB 2H8RA 3FXJA 3P7NA 3V7SA 3SQNA 4D5FA 4MEXF 5FD6A 5IOYA 1YS7A 3KP5A 2HWVA 1LDDA 3L7WA 1P4AA 1ZKGA 4BACA 3J80Z 3LSMA 1XC5A 4IPAA 2NVYJ 2QCOA 4NVQA 2DA3A 2VQGA 1H88C 3ZGKA 2BY1A 3S14J 1XDUA 1I50J 1PVEA 5LRSA 2XKPA 4Y15A 4M3DA 2K9LA 5HDGA 5KVRA 4YG2F 1TW2A 1GXPA 2DMPA 3RKXA 3OYEA 3GTMJ 3CD6I 4UXNA 2Z99A 2NS7A 3D5SC 4AYBN 4PCQA 3WU1B 1GXQA 2W1OA 1BOAA 1ODDA 2WV0A 1EF4A 4EEFG 5DM7F 5B1AH 3JRHA 5E3NA 2QVOA 1ZREA 2BY2A 5FLXZ 4ESJA 1JUMA 3C7JA 1SMYF 3L2QA 3F3XA 1ETXA 5HLIA 2B63J 1O9SA 3BROA 1QRYA 4JOMA 4BHCA 5EEHA 3FXLA 4IHWA 2DN0A 3ESWB 3I4MJ 1YX5A 3S15J 1KU3A 5F1RA 4M9XA 3ROUA 4LD5A 3S17J 2VQHA 4E6KG 1O4XA 4KNYA 3KEOA 3IAS2 3TW7A 1YYVA 3QOPA 4CH7A 1KU7A 5TEGA 5KAIC 3OL3A 3G4SI 1I1SA 3BT9A 3L2RA 2IS1A 1MZBA 4IHYA 3VSKA 5L3EA 4H0EA 1VQOI 3AFHA 3JR9A 1WRJA 1WCMJ 1ZK8A 2FE3A 2HU9A 1WVRA 2BV6A 2XF6A 4L5EA 5FKMA 3TO9A 4RGXA 1VQ8I 5FO5A 4Y17A 3TG5A 1QPMA 4A12A 1ULYA 3HJEA 5K1YA 5GAHJ 3LL7A 2RQQA 1P92A 5DD4A 2HPMA 5FGMA 1WI3A 1RR7A 4KN4X 3IL2A 3M8EA 1P4XA 1R5ID 2VBXA 3GZNB 3M5AA 2IRFG 4A5NA 1E3HA 3FKIJ 4XRSG 3CUQC 1VQ4I 4XKWA 3LQRA 2OAZA 1TW3A 2K9MA 3WG9A 1R4MB 1A31A 4MGRA 4IL6C 4G8XA 3KYLA 1H9TA 3P9KA 4RGUA 3N97A 3GUDA 4I0BA 3RTRA 2IA1A 2VBYA 4A3JJ 5JHNA 4A3EJ 2BYVE 1Z67A 2L02A 5JINA 4AVPA 2JWTA 4O6JA 3HRTA 2CQNA 3I71A 2QLZA 3GYHX 3HL2A 4MLOA 1WJCA 1D1BA 2TCTA 5CVRA 3CCRI 5LLQA 3PDNA 1V3FA 3UNGC 3FKJA 3S93A 3ZMDA 2A6HF 2E60A 2VE9A 1Z7LA 1XCVA 3HC7A 4P96A 4RB3C 1YRNA 1FIPA 3PJRA 1U9OA 2QENA 2XSDC 3CO6C 3KEYA 5D8LB 3ZRGA 1J59A 1YE9A 3MMYB 2JUGA 3K0LA 2GA1A 4N4OB 3IUOA 2KJBA 1USSA 3QPSA 3ABLH 1R49A 5LEKA 3LSRA 3TDUC 2UV1A 3HGGA 2QQAA 3QAHA 3OYMA 1UAAA 4ENJA 1QO0D 2NVUB 2EA4A 3ZP5A 3M3YJ 1K6YA 1ENHA 1B8IB 1K78B 5LHHA 5HDNA 1P7JA 4G7OF 5FLXK 3U1DA 2FOWA 4IJAA 3SYTA 1IV8A 3S16J 1R71A 4YRVA 4MFDA 2LKSA 5LGTA 3PUFA 2LTPA 2L7ZA 2RV8A 3HYIA 4DZJA 4LLGF 3BG7A 1ITYA 2VPLA 4CXFA 5LHGA 1IN4A 4HNTA 2DQRA 3IRRA 2F5CA 4LG0A 3RJPA 5D5XB 4HBLA 2FBKA 1APLC 1D3YA 1D1CA 4E7LA 5E8GA 2X51A 3GTLJ 3S1MJ 1WHUA 2G7UA 3TEDA 1AKHB 1JHFA 1V55H 4ZC3A 2I8DA 1NG6A 4EJVA 4PSXA 1VQ6I 2JA2A 5J47A 2GWRA 4MNUA 3DTIA 1K4SA 4NDLA 1XGOA 4J7FA 1U9NA 1I39A 3M56A 2XF5A 2MC4A 2FA5A 2HKXA 3FXUA 2VIXA 1IXSB 4YNPA 3JREA 2K9QA 2QSFX 2ISYA 2V7FA 4NC6A 5D8KB 4F3QA 3OR2C 3WTUC 3ZMVA 1Z77A 2KKOA 2HS5A 2ZB9A 3QOEA 4BH9A 1MUFA 3SFZA 3SWCA 1Z0XA 4JYKA 2BBYA 5KCMA 3QWVA 3HTSB 3G1OA 4FASD 2QQ9A 3T8RA 3OIOA 1FTZA 1HW1A 4ZZDA 5JLWA 1Y1WJ 1Z3YA 4J01A 1UMQA 3GCMA 1MBGA 1T39A 2LFBA 2DJIA 2ELJA 3QODA 3G3ZA 2LKPA 4M73A 3KLOA 3HEFA 3MKWB 3SHFA 2YPRA 4ENMA 1PYVA 1RUOA 3HUGA 4YFKF 5FKKA 3BG3A 2LVSA 5EX0A 2P6TA 2X6WA 5HS7A 2VKVA 1IC8A 3S1QJ 2XGCA 2DDAA 4HX8A 3ASOH 2JMWA 5CCLA 3GTJJ 2DA6A 4OAYA 1SVLA 1I6XA 3LSGA 1LVKA 2EFNA 2YSRA 5J40A 2GLOA 1ORKA 2FX0A 2BXZA 2GM4A 2EFQA 3KP6A 1IZ1A 3LA2A 5JJ0A 3F8CA 1G6NA 2LR8A 4OMZA 1JKRC 2L01A 1W0UA 3G2BA 2JA5J 4O6FA 2HXIA 4RS8A 2FBIA 3VODA 2X6OA 4MQVA 1S72I 5A2QZ 2AXLA 3MFKA 2V6CA 3QP6A 3HPGA 4XK4A 3ASNH 3AAFA 4EJWA 3S3MA 4B43A 2VBZA 3Q5FA 1D0XA 4G94A 4DQ2A 1W0TA 4JDSA 1VFCA 4OU0A 2OTLI 1AA7A 3GTOJ 3F9ZA 4I6ZA 5DCMB 1TC3C 1QHHD 1RPWA 4P9FA 2L7FP 4LK1F 4ZYEA 4DBRA 1R5GA 3K5KA 3K2ZA 4L0ZB 3V8KA 3TMOA 3WU0A 1SFKA 5HLTA 2CV2A 2Q1ZB 1K83J 1NK3P 2A6EF 1D0YA 1TWGJ 2XC7A 1ZGAA 4JX5A 1YX3A 2KLOA 1Y8RB 3CCSI 4YIIA 2CH0A 3OYJA 2H1LA 2HDWA 2DT5A 1QNTA 4XKCA 2IGOA 2M1BA 2Y31A 3T0YA 3TBIA 2IBDA 2JSCA 2PFBA 9ANTA 1B4AA 4DNCA 3KLNA 2IT0A 5HI7A 5A2QK 2DI3A 3Q9VA 3JRAA 2IGQA 3VFZA 1WI9A 1PP7U 5HLGA 2IXSA 3RCOA 4A6EA 2CW8A 1UG2A 1JI8A 3ELKA 1QBJA 1SD4A 3QU6A 4I99C 4ITVA 4F55A 2NS8A 2VPRA 5JVTA 1XMAA 4B1RA 1MT6A 4PZJA 2AXTC 2DTZA 2K9SA 5E8IA 4B09A 2EIJH 1KQ8A 5BOXA 4BKXA 4MTEA 2W4SA 2MABA 4MO7A 2LG4A 1A6IA 1HXDA 5CPRB 1DPRA 4UV8A 4B4CA 3M8FA 3P9IA 1BL0A 2W25A 2P0WA 4C2TA 4C2UA 2NAZA 1IJWC 2M4GA 5GP9A 1LVAA 1UHWA 2RFIA 4NJ5A 2HOAA 1E3PA 2LLKA 4LB6B 1B1BA 2E1MB 2XASA 4I0AA 4RAZA 4CCKA 2EB7A 2HKOA 4A0XA 3JSOA 1IF1A 4NBQA 1G8XA 1QVTA 3JRBA 5L3CA 3SZGA 1ETOA 2XAUA 1S7OA 1T98A 4IQ4A 4A5MA 5D5WB 3LSIA 2W57A 3H5RA 4BAYA 2VUMJ 1R58A 2HTJA 5GPCA 2O8KA 1XMXA 2Y9ZA 2R7SA 1OJLA 4PDKA 4ZZLA 2K27A 3EQLF 3LFUA 3MD2A 1QVUA 2OTJI 4BJTA 1CF7B 4BXUA 2QA4I 2HNHA 2HOTA 1RKWA 3S32A 3DBHB 2ZO4A 1A35A 1KYWA 4MFEA 3CDLA 4RGSA 2CUFA 3W2AA 3CQZJ 1ZYRF 4A3FJ 3I5UA 1ZQ3P 3M07A 2HQNA 1SAXA 1JT0A 3F21A 3QYEA 2OC6A 1GV2A 1IDYA 2E7WA 4PJMA 1S9HA 4TV7A 3GFJA 3NWTA 4KA4A 2D1HA 2LRDA 3OOUA 1KQ9A 3HOYJ 3K4CA 2HI3A 2QKLB 3GX4X 3HZJA 4ANJA 1F4KA 1B72B 4EATA 4FX4A 1IGNA 2DMTA 2E19A 2M4KA 2CQQA 1S8NA 1XTAA 3DPUA 2O0YA 3GTPJ 4HV6A 3OYNA 4F7ZA 2EZHA 3BO5A 1P4WA 2DPDA 4HPQA 2P81A 3LQQA 4HF1A 2BHYA 1IUFA 3K6GA 1ZKKA 2LY2A 4L5JA 3L1PA 2EV5A 2FQ3A 4CSWA 4FMUA 4H4KC 3I9V2 3GFLA 2FNPA 3DALA 3K4MA 2R7RA 3GTKJ 4O5VA 2R7QA 1XSDA 2IEKA 4AYBA 2EIKH 3HTUA 5CVVA 1CF7A 2F5VA 3WGIA 3RDIA 2JUCA 5D5UB 1T0FA 4UY8I 1U3EM 4XICA 4CYDA 2EBIA 5CQEA 3H0DA 2D5VA 4KDPA 4ABZA 3LA3A 4U0VA 5FKOA 2O8JA 5EJCA 2COMA 3G6EI 2M3AA 1U5TB 3IP4B 2DBBA 3RPUD 1BW6A 3CLQA 4YELA 3SXYA 5F0HA 4PK4A 3QPTA 3FF5A 3KETA 2DFIA 1Y39A 3L2VA 1RETA 3R60A 2BEOA 2CSOA 4WXDA 4XM3A 2XROA 2ZJQF 1JE8A 1CQTA 2HOEA 2FEZA 5TJJA 2LOOA 2MLKA 3ZXSA 2VOOA 2OV7A 1QHGA 4UVBA 1Y6IA 4A3DJ 2R7UA 2B9SA 2R7ZJ 2W5YA 3S7DA 3WE2A 2ZMEB 4XL9A 3VYTB 1ETYA 1ERDA 2ID6A 2BW3A 1MBKA 4R1HA 5DDGA 1LEBA 1X3ZB 4Y3OA 2GIZA 2MSYA 4R79A 5CLSA 4RAFA 3HOUJ 4HSRA 3OYAA 2XUBA 3H1CA 4DGWB 3H36A 2R5YA 4YFNF 1NK2P 4I09A 3JW4A 2XPWA 2QPWA 3SDGA 4UB6C 4P9UA 4A93J 5AONA 4D1QA 2F48A 3KIOA 1FYKA 2STTA 5E79C 3C3WA 4ZDLA 2FQ4A 4C3IJ 2HYFA 5F27A 2IPQX 3TP3A 2WA0A 5IP6A 2XAHA 3KX2A 3RYRA 3OYDA 3S2WA 5EZGA 3BY6A 2BE5F 3DEEA 2O5RA 3NAUA 1TWAJ 1W1WE 4QWQA 2AQFA 3J7AO 5D4SA 3BP8A 4C3JJ 2ELHA 4C9YA 3CCVI 2M0CA 5F64A 1JJ6C 3LMMA 4YNMA 3H92A 3HRMA 2WV1A 3TO7A 2K4JA 2QSHX 1T56A 1IN8A 2E71A 3T1BA 4BYYA 1FSEA 2G0EA 1WJBA 3E6DA 3FZVA 2KISA 3IHUA 3LNQA 2JZYA 3CJNA 2MGQA 3DBLB 1SC7A 1MBFA 5HS9A 3K7AJ 5J1RA 2DA7A 4CYCA 2CFOA 2QYOA 3R0JA 4EJTA 1HCRA 3S2DJ 4RB0A 5DCMA 1QA6A 4HEA2 4BEHA 2WADA 4HLXA 4XNFA 4XLPF 4J19A 3MZYA 2HVSA 3WE3A 2W5ZA 4Y7NJ 4AWXB 4LGWA 4OIRF 4U87A 3W6JB 3TKYA 3HOZJ 2XGDA 3F6OA 1WJ5A 2HXOA 4N9IA 1NH3A 1KA8A 2W82A 2ZSHB 3GZ6A 4YNDA 2PMUA 4IRIA 4CZCA 2CW7A 3GF2A 1W5SA 4YPAA 3K4JA 4KIGA 4BY1J 2KIFA 5B66C 2EZLA 3H35A 3GO5A 1VNDA 4H12A 4M3EA 2XHKA 1YOVB 1FNNA 2BY0A 2Y2ZA 2ICWG 1UG0A 2FJ1A 3WTZA 2CMPA 2R0QC 3ZQLA 1LB2A 1MH4A 1ETVA 3MZ8A 5B5EC 3ULQB 5GPAA 1S7AA 4KMFA 5HQ8A 4HX7A 1LKXA 4CGZA 5ARFA 3RIRA 4BXFA 1D5YA 1R7JA 2CWEA 3WGHA 5H2FC 5IT3A 3SEZA 3ZQCA 3C2HA 5IP9J 4CHUA 2P5VA 5BQTA 3W3CA 3H9GA 3HSEA 2LD5A 2VL8A 3J81Z 3LSPA 3DPTA 1UJ8A 1U8RA 2P4WA 1G2HA 4CZZA 2KJCA 1BR2A 3F9WA 1Q1HA 4AIHA 3ZCOA 1LDKB 4OOIA 1NG7A 2M8GX 1OQYA 4U88A 3FM3A 3TP0A 4Z4PA 3S3NA 2K9NA 4Q47A 4XOTA 1R36A 2OCEA 4JX4A 3ABKH 4F92B 2RDPA 3MEXA 1MBEA 3F9YA 5IYBJ 5TH7A 2AO9A 5IP7J 3IC7A 3JAMK 4UV9A 1YJ9I 3BC8A 2LY9A 4ESFA 1VI0A 5K5OA 2P6SA 3E6CC 3ONQA 2OPTA 3VB2A 6PAXA 2GBYA 4WF2A 2F5EA 4BQOA 1D8JA 2JN6A 4ZDOA 3VEPA 2PJRA 3QP5A 1BJAA 3HPHA 1TZLA 2VONA 4XLCA 4KIFA 4D7MA 2OUMA 1OKRA 3FXOA 1H8AC 1HDDC 2ZBKA 4HYEA 5BS6A 5FRMA 4I76A 3S1NJ 1BOBA 3CJRB 3IWZA 4F91B 2L9SA 1Z7UA 4L9JA 1K4TA 1X2NA 3DEUA 1SAUA 4EJUA 2H27A 1SFUA 3OMYA 5KJNA 1B72A 1BJZA 3SZPA 3DLLF 4Z6YA 4E47A 3MWMA 1E2XA 1RZ4A 3FXRA 1WJEA 2X4HA 3FM5A 2X6YA 1RNLA 1MBJA 4I02A 4UVCA 2CV0A 3ZQGA 3I4PA 2PMZA 2A5WA 5J3LA 4D0PA 4Y13A 3R0AA 2M2EA 3WG7H 5E3MA 4I2OA 1Z05A 1O57A 4FE4A 4G6DA 4PJNA 3ZN1A 2PN6A 2IA2A 4YFXF 3CTAA 1FYLA 4AIDA 5ICCA 2XPUA 1K79A 4J00A 1XB4A 2Y9YA 5L3GA 2K3PA 5E1ZB 3CBMA 4FX0A 1JGGA 3J7ZI 1XSXA 1E17A 2EFOA 2AQEA 5TGTA 3MQ0A 2XF7A 2KT0A 3W2VA 1U0JA 3BLYA 4XLEA 4XONA 1VZ0A 5J8FA 2X6XA 2I10A 2KP6A 3VYUB 5EDNA 1YW9A 3A0BC 1O3RA 4KFCA 3PIOF 2YR2A 1ZR2A 3JRGA 2MD5A 4YPUA 4XRMA 3HOTA 1J2XA 1V5GA 2X0LA 4L0YB 2DMUA 4M71A 3MCZA 3G1MA 4I51A 1J7KA 1FT9A 2N8GA 5HLHA 4IXAA 2ELKA 3UKGA 4M6XA 4HAMA 1U6GA 5DM6F 1KYZA 3GTGJ 2DA1A 4WXHA 5JFRA 3DP7A 4HX4A 1JKPC 2F2EA 1A36A 2QQBA 4FT8A 1ON2A 3BR6A 5H20A 1POGA 2B7EA 2DOEA 1V5EA 2LH9A 3CCYA 3O2PE 3AL0B 3F9XA 4RB2C 2TDXA 2X1EA 5JVGF 1X1DA 2RAEA 5F0FA 1JTXA 3C18A 2V1NA 1GDTA 2KRFA 2L7MP 1RC9A 2NNNA 4Q5SF 3AG3H 4B3AA 3TOAA 4J8OA 2O3FA 2KIUA 3ML6A 3GLLA 1PP8F 4HDVA 3WHBA 3J80K 3IHXA 4C2MJ 1TLHB 1DGWY 3QWWA 1R9TJ 2XAGA 3EP0A 1LPQA 5DEQA 2A05A 4GXOA 3JTGA 5JHFA 3BTLA 2XV4S 1MDMB 3A4CA 4PJJA 4U7BA 3K4NA 2UXNA 1X3UA 1Y8QB 2CO5A 3HHHA 3RZOJ 1HW2A 1FMVA 3QYFA 3V4GA 4DZPA 1W7PD 3O3KA 3M7GA 2E34A 2GIVA 2M7AA 2VXZA 3EUAA 4D9JA 2Y0MA 1AWCA 1EH8A 2HVRA 3JRIA 1BBYA 2LK2A 4N9HA 2W24A 4II2A 1XDSA 3PNTA 4E70A 2VB6A 3HXLA 3TG4A 2JQ7A 5F08A 4BBRJ 2V6EA 1DDNA 4J7IA 4LFUA 2JVHA 3DU5A 1N6AA 1SVOA 3J81K 3Q3SA 1TL8A 5AIPA 2TRTA 4A0YA 3EYIA 4ZJZA 3OWTA 3F8FA 4ON0A 2JA7J 2R7VA 1G3YA 3ABMH 3CF2A 3RQIA 3FISA 1MBHA 2E1MC 4KUMA 5ERIA 3CBOA 5D4RA 5JLXA 3E7LA 1AKHA 1XPXA 3OS2A 3FDYA 1R5HA 1N25A 2B0LA 3MO0A 3PQKA 3RKWA 1H0MA 1IRZA 2R3SA 4HNVA 1LFPA 4FTHA 1U5TC 3W2WA 1I5ZA 1WJAA 1KONA 1TNSA 2WBMA 2X1CA 3FWEA 1W5CC 3S8PA 1VQKI 3M57A 4PJLA 2FSWA 1N77A 3SFIA 3OIPA 3EUHC 2H09A 2COBA 2BXYA 2Q2EB 4LJZF 4E7ZA 4P55A 3OS1A 1LEAA 2JT1A 2VJ5A 3P9CA 4HLYA 2FMYA 3DCFA 3I0TA 1OLTA 4KJZA 4M74A 3K4LA 4OIOF 4MEYF 3NARA 2DOAA 2BHZA 2ZSIB 5H6QA 1UELB 5E1WA 4BS9A 1U78A 4YEJA
chains in the Genus database with same CATH topology
3M8JA 3LFUA 3MD2A 4BDYA 4BJTA 2JVGA 2IS2A 2HNHA 2A6TA 4AVZA 3S32A 4BL0B 3RIBA 2BOLA 2KZVA 1N3JA 3HNAA 3E1SA 3W2AA 4XQFA 5LSXA 4XKBA 1X4PA 1WJFA 4JQFA 3CESA 5LD2C 3QYEA 2OC6A 4PJMA 1S9HA 3TL4X 3NWTA 2LRDA 3S7JA 3OOUA 1IRXA 4E7IA 3C2GA 3K4CA 3AKZA 2KDOA 4F52A 2QKLB 2Y0SA 4IX7A 1H3IA 4ANJA 2VASA 4E4HA 2VLAA 3FPDA 3VV0A 3H5AA 4EATA 2M4KA 3GBGA 3VWBA 3M59A 2LY1A 1Z21A 3DPUA 2XSJC 2X1DA 3HG9A 4IZZA 2JV0A 3K70D 3OYNA 2BQZA 2R7OA 3MO5A 3BCBA 5T5GA 4OWRB 3BO5A 4HPQA 1QU3A 1HA8A 3K6GA 4XR6A 2LY2A 1ZKKA 3KMTA 4LIVA 4CSWA 4FMUA 2M7BA 4H4KC 3I9V2 2VXDA 5F6LA 4ZDPA 3CBPA 3K4MA 3H9QA 3DALA 3OIQA 2R7RA 4E7SA 3K70C 2R7QA 4AYBA 4BEHB 5CCMA 4IQJA 2DT7B 2F5VA 2WY8Q 4B44A 3L2UA 1MNEA 4LDGA 3OYIA 2F69A 1D0ZA 5CQEA 4XKVA 3H0DA 2KPMA 4C30A 3MO2A 1E0EA 2BVLA 2E5NA 3HUGB 2O8JA 4BU2A 2WAQA 2M3AA 4N4NB 3IP4B 2V26A 2IGNA 3RPUD 4YELA 3VYSB 3DKXA 4PK4A 3SEQA 1N75A 4GRIA 1DP3A 3OL4A 4BACA 4QEPA 3LSMA 2IGKA 3L2VA 2R7XA 4NVQA 2VQGA 2WB1A 4XORA 4RZ0A 4XM3A 4XN3A 2DT6A 1MMDA 3ZGKA 3ZXSA 2LOOA 5HOOA 2R7UA 4OAZA 2OV7A 1QHGA 5KNLA 1Y6IA 1MMNA 5KJMA 2W5YA 3S7DA 3A2KA 1WFXA 2K9LA 4XL9A 3VYTB 3OYBA 1ERDA 2RNGA 3OYEA 4PSWA 5KHDA 1P9QC 1X4OA 2BW3A 2VQCA 3D5SC 4Y3OA 2ZXHA 4R79A 2W1OA 4HSRA 3OYAA 4DGWB 4XLFA 3VDXA 4RMNA 2QPWA 2UWMA 2CS3A 3BG6A 4DIQA 4ZTFA 4O30A 3L2QA 4F93B 4D1QA 2IS6A 1O9SA 4IJ8A 4JOMA 4BDZA 4ZDLA 3VSLA 1Z3XA 3I3LA 3FHNA 4BQQA 1YX5A 2WA0A 3DTKA 3KX2A 4NQWB 3OYDA 4CA0A 2VQHA 4E6KG 3DEEA 2O5RA 4CCOA 2WAFA 2AQFA 2V9KA 4C9YA 4BE0A 2LC2A 3QWPA 4JLGA 2DCEA 3LMMA 4YNMA 3IAS2 2KMUA 4MI5A 4CH7A 3N71A 2PJRB 1MVHA 5TEGA 2NOJB 4LITA 4X0GA 4G6TB 3OL3A 2MD0A 3L2RA 2IS1A 3E0JB 2IGMA 1WJBA 3VSKA 4KISA 4NNJA 5KJKA 4RLFA 3AFHA 3DKYA 3H9JA 2HU9A 2XF6A 2CFOA 4HNUA 4MI0A 2VJJA 3TG5A 2R3AA 4BE1A 1T0FC 2HPMA 3LL7A 2RQQA 4HEA2 4KT6A 4BEHA 2WADA 1PJRA 2HZDA 4XNFA 2W5ZA 2HVSA 3LSHA 3A1YA 4U87A 3M5AA 3OR1C 1WJ5A 4XKWA 2W82A 2ZSHB 3DLAA 2GOXB 2K9MA 4YNDA 2CUJA 4CZCA 1R6RA 2CW7A 2KRCA 3KYLA 4YPAA 3D5RC 3K4JA 3RTRA 4BUPA 5JHNA 3H35A 5JINA 4H12A 1X1BA 2MYSA 1UG0A 3HL2A 2KL4A 2CMPA 3D5LA 4MLOA 1WJCA 1D1BA 3PDNA 3UNGC 1BR4A 3FKJA 4NC8A 4B47A 3S93A 5HQ8A 2E60A 1LKXA 1Z7LA 3HC7A 5ARFA 4BXFA 5KJLA 2K5CA 3PJRA 3SEZA 4BJ6C 3C2HA 3VUZA 3KEYA 3ZRGA 5EX3A 1YE9A 3MMYB 3W3CA 3H9GA 2JUGA 5T0MA 4N4OB 2VL8A 3IUOA 3S7FA 3DPTA 2L9NA 4QENA 2HPIA 2UV1A 3K4KA 3OYMA 1UAAA 2RREA 1BR2A 2X85A 4PFOA 3F9WA 1X1CA 2LYCA 1LDKB 4Y4RA 3ZCOA 1K6YA 1NG7A 4Z4PA 3V42A 1MNDA 3S3NA 2CUZA 3MEKA 3RJWA 3EPZA 4XOTA 4P1WA 1N6CA 4F92B 3OS5A 3DU6A 3SYTA 3KMAA 3F9YA 2ZXIA 1XQHA 5TH7A 4YRVA 4KITB 3BC8A 4CCLA 3ONQA 3QYBA 4PFPA 4E7HA 3BG7A 3OS0A 2R7TA 2VPLA 4BQOA 4ZDOA 2PJRA 1GLNA 4C1QA 3HPHA 4HNTA 1TZLA 2L7KA 3PNYA 4XLCA 2GOMA 4WUYA 2LBFB 4QPOA 2OUMA 1MVXA 5LSZA 1D1CA 5FRMA 3J7AY 4Y33A 4E7LA 2ZFUA 1DQUA 1BOBA 2X51A 3CJRB 4NC7A 4E7JA 4F91B 2L9SA 2F6CA 5ARGA 3SW9A 2L2OA 4ZYAA 4ZC3A 3CP8A 2I8DA 1NG6A 1SAUA 3H5NA 4PSXA 3OMYA 5KJNA 4BGDA 2JA2A 3M1CA 4E47A 3DTIA 1WJEA 1EA3A 4J7FA 3FBNB 2X6YA 2UUZA 3M56A 4II3A 4HRIA 2MC4A 2XF5A 2L5QA 4LIUA 2VIXA 4DBQA 2LBFA 1J09A 2Z16A 5JIYA 2CV0A 3DB5A 4YNPA 1OR7C 2PMZA 2A5WA 2HVQA 5HNHA 3MKZA 2V7FA 4F3QA 3OR2C 5AYFA 1T95A 2M0MA 2KQRA 5FROA 3QOEA 2W00A 1MUFA 4PJNA 3SWCA 2QKMB 5KCMA 4BQNA 3QWVA 3DTEA 1MMAA 4FASD 3IAM2 4J00A 3OXLA 1Z3YA 4J01A 1PEGA 2K3PA 2JSPA 2DJIA 2ELJA 3QODA 4RM3A 3CBMA 5LFAA 3HKZA 2VJ4A 4BE2A 3OYKA 2AQEA 5TGTA 3MKWB 2XF7A 4XLAA 1PYVA 3W2VA 3BLYA 1U0JA 4XLEA 4XONA 1MMGA 2Z1DA 1VZ0A 4FETA 3ZR8X 2X6XA 2KP6A 3VYUB 2VJIA 5EX0A 4XN0A 2X6WA 2MFZA 3RQ4A 5CCLA 3M55A 3KMJA 3K4BA 4OAYA 5F6KC 3PUBA 3OOIA 2VKDA 3LSGA 1LVKA 2IS4A 3PFYA 4YPUA 4IKFA 4LG3A 3HOTA 1V5GA 4CCNA 3F9KA 3S7BA 2E5ZA 3OPEA 5FRNA 2CV1A 4I51A 4CUGA 5JJ0A 3LSKA 4IJDA 5HNFA 3DWLE 3G2BA 3N05A 5CQGA 4O6FA 5HVQC 4BJ5C 4PUSA 1V5EA 2LH9A 3ZQQA 2W7NA 4B48A 3AL0B 3HPGA 3F9XA 4XLHA 1X19A 2X1EA 2F4IA 3HOSA 1FMWA 2VKHA 1G59A 2G46A 3S3MA 4B43A 1X1DA 1D0XA 3RU0A 3OXGA 2V1NA 4JDSA 2V4JC 3K10A 4RM2A 4XMYA 1AA7A 1W36C 3F9ZA 4QPQA 3UR3C 4J8OA 1QHHD 4CCJA 1Y56A 2WY7Q 4XOPA 3PSIA 3NWSA 2WAEA 4DBRA 4RLQA 3K5KA 4DJAA 3IHXA 3TMOA 1SFKA 5HLTA 3OYLA 1DGWY 4P5OA 2CV2A 4DOZA 3OYGA 3QWWA 2Q1ZB 2XDVA 3EP0A 1D0YA 4ZTJA 5JHFA 2XC7A 4J83A 3M53A 3A4CA 3CP2A 1YX3A 4PJJA 4U7BA 2KLOA 3K4NA 3RSNA 3PNVA 2BVMA 1FMVA 2CH0A 3QYFA 3DQVC 3OYJA 3AL0C 2HDWA 4XKCA 2IGOA 3CJQB 2M7AA 2VXZA 3EUAA 4HG2A 1N78A 4D9JA 4E7KA 3TBIA 5CKTA 5HI7A 5F59A 2HVRA 2LREA 2IGQA 3CZ6A 3FBIB 4II2A 3PNTA 2IXSA 3RCOA 2VB6A 3HXLA 3L2WA 3TG4A 2CW8A 3BCAA 2V6EA 4CCMA 4J7IA 5EG2A 3DPLC 2JVHA 2HQAA 3DU5A 1JI8A 1N6AA 1WJDA 1X1AA 2FUG2 4ITVA 4F55A 3RAYA 4ZJZA 1MT6A 3CMMA 3OWTA 3M54A 3PL8A 2R7VA 2W4SA 3CF2A 2MABA 2LG4A 2E1MC 5CPRB 3CBOA 1ML9A 2BW3B 4B3XA 3EUKL 1TT0A 5F5EA 2P0WA 3OS2A 3FDYA 4C2TA 3OYFA 4C2UA 3OYCA 2R4GA 2M4GA 1BR1A 3SDBA 3MO0A 2RFIA 1W36D 4NJ5A 4YPEA 4QEOA 2VQLA 1V5FA 4HSTA 2E1MB 2DXIA 1LFPA 4AU7A 3OYHA 4CCKA 5T0KA 3W2WA 1WJAA 1MW7A 1KONA 2WBMA 2X1CA 3S8PA 2KHMA 4PJLA 3M57A 1G8XA 1N77A 3OIPA 3EUHC 2Q2EB 3SZGA 4E7ZA 3OS1A 3MKYB 2VJ5A 1D1AA 3OXFA 2KRHA 2XAUA 3PSFA 3OY9A 4IQ4A 1OLTA 4KJZA 4NUBA 3K4LA 3M58A 3LSIA 5TTFA 2DOAA 1DGRM 2ZSIB 3H5RA 1UELB 3S3OA 3VYRB 4BS9A 2R7WA 1ZELA 3U21A 2R7SA 4YEJA 2Z2SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F9Y A;  2QPW A;  1XQH A;  5TH7 A;  4O30 A;  3F9X A;  1O9S A;  4IJ8 A;  3RIB A;  2G46 A;  1N3J A;  3HNA A;  3RU0 A;  3OXG A;  5LSX A;  4JDS A;  4C1Q A;  3F9Z A;  4WUY A;  3QWP A;  4J8O A;  4JLG A;  4YNM A;  1MVX A;  5LSZ A;  4MI5 A;  3S7J A;  3K5K A;  3N71 A;  1MVH A;  3IHX A;  5TEG A;  3QWW A;  3SW9 A;  1H3I A;  3EP0 A;  5ARG A;  3FPD A;  4J83 A;  3VV0 A;  3M53 A;  5KJN A;  5KJK A;  3M59 A;  4E47 A;  2JV0 A;  4J7F A;  3M56 A;  2BQZ A;  4MI0 A;  3MO5 A;  5T5G A;  3BO5 A;  2R3A A;  3TG5 A;  5JIY A;  3DB5 A;  4YNP A;  5HI7 A;  1ZKK A;  5F59 A;  3KMT A;  2W5Z A;  2IGQ A;  4FMU A;  5AYF A;  3M5A A;  5F6L A;  3CBP A;  3DAL A;  3TG4 A;  1MUF A;  4J7I A;  5EG2 A;  3SWC A;  1N6A A;  5CCM A;  3QWV A;  4YND A;  3OXL A;  4LDG A;  3RAY A;  2F69 A;  1MT6 A;  4YPA A;  1PEG A;  3M54 A;  3CBM A;  3MO2 A;  4BUP A;  5JHN A;  5JIN A;  4H12 A;  2O8J A;  5CPR B;  3CBO A;  1ML9 A;  3PDN A;  5F5E A;  5HQ8 A;  4QEP A;  5EX0 A;  4NJ5 A;  3MO0 A;  4YPE A;  4NVQ A;  2RFI A;  5ARF A;  4QEO A;  5KJL A;  3RQ4 A;  4RZ0 A;  5CCL A;  3M55 A;  3KMJ A;  3VUZ A;  5F6K C;  3OOI A;  4AU7 A;  5EX3 A;  5T0K A;  5KJM A;  5T0M A;  3S8P A;  4YPU A;  3S7F A;  3M57 A;  2W5Y A;  3S7D A;  4QEN A;  3S7B A;  3OXF A;  3OPE A;  4I51 A;  3F9W A;  5JJ0 A;  4IJD A;  5TTF A;  3M58 A;  4Z4P A;  3MEK A;  3RJW A;  4O6F A;  1N6C A;  3OS5 A;  3KMA A; 
#chains in the Genus database with same CATH topology
 5D6E A;  2EIM H;  3M8J A;  4BDY A;  3RI4 A;  3GZ5 A;  2IS2 A;  1YG2 A;  3FMR A;  4BL0 B;  2KZV A;  1H9G A;  2EA2 A;  3E1S A;  2F5F A;  3HB9 A;  1O3Q A;  2P5K A;  4EM2 A;  4IRG A;  1G3S A;  4JQF A;  3CES A;  1X2M A;  1GT0 C;  4RA2 A;  4UHT A;  3EDP A;  1Z9C A;  3MAJ A;  3TL4 X;  1IXC A;  1LFB A;  3S7J A;  1K6O A;  4Q48 A;  1Z91 A;  4M3G A;  4E7I A;  4FHT A;  2O8X A;  3EUH A;  5J8C A;  3K1N A;  1YS6 A;  2BZT A;  2Y0S A;  2VLA A;  2LNB A;  1YW7 A;  3A01 A;  3GBG A;  3TDZ C;  4DYQ A;  4IHX A;  3F6V A;  2X1D A;  1FOK A;  3K70 D;  2BQZ A;  1EH6 A;  2DPU A;  2ZXW H;  5FJ8 J;  2YX7 A;  4DYC A;  2V9V A;  3REO A;  1QU3 A;  1IO2 A;  3A01 B;  4XR6 A;  1OIS A;  4BY7 J;  1WGX A;  2FD5 A;  4MHG A;  2M7B A;  3V7R A;  2EZI A;  2VXD A;  3BDD A;  3DEW A;  3CF5 F;  3DFG A;  3OIQ A;  3RPU A;  2ID3 A;  2CW0 F;  2PG4 A;  3O8H A;  1OYY A;  1LDJ A;  3WU2 C;  2DT7 B;  3ZMZ A;  1HC8 A;  4FQG A;  1ZG5 A;  5F1J A;  3OYI A;  5E3L A;  1D0Z A;  3CCQ I;  4KMU X;  1YFH A;  4XKV A;  2KPM A;  1BI1 A;  2DU9 A;  1E0E A;  4A0Z A;  5IT9 K;  4BU2 A;  2HFH A;  1TBX A;  1YTY A;  4N4N B;  2V26 A;  4LK0 F;  1TWF J;  3DKX A;  4XSX F;  5EEG A;  4GRI A;  2GZW A;  1DP3 A;  3OL4 A;  3BR3 A;  4XOR A;  1IN5 A;  2H94 A;  3IH3 A;  2DJN A;  4XN3 A;  1UB9 A;  1MMD A;  2DT6 A;  2VN2 A;  4U0W A;  5HOO A;  5KNL A;  2A68 F;  2XB0 X;  1T33 A;  1W5T A;  1WFX A;  4PJ0 C;  2K4B A;  3HOX J;  3OYB A;  2RNG A;  3R6S A;  4IVN A;  2QSG X;  1X4O A;  1TP4 A;  1F1Z A;  1OYI A;  2VQC A;  3HDD A;  2M9H A;  2ZXH A;  4IF4 A;  1VQ9 I;  2FRH A;  2QQ8 A;  2XAQ A;  2HYG D;  1HF0 A;  4ENN A;  3H3U A;  4XLF A;  3VDX A;  3HKZ N;  4V19 K;  2UWM A;  3BG6 A;  2L3D A;  3CUQ B;  4O30 A;  3SZT A;  4F93 B;  2IS6 A;  2XPV A;  4IJ8 A;  5CVJ A;  5JI6 A;  4BDZ A;  1FY7 A;  1Z3X A;  3I3L A;  1I3A A;  2EH3 A;  3LWF A;  1ETK A;  4NQW B;  2A5Y B;  4CA0 A;  2GXB A;  3PQJ A;  1ON1 A;  3BZK A;  1GV5 A;  4HDU A;  2YU9 J;  2LC2 A;  4JLG A;  2DCE A;  4AC0 A;  1BI2 A;  2I5U A;  3ZQI A;  2D1V A;  2PJR B;  1M1E B;  4X0G A;  4G6T B;  1YJW I;  3E6M A;  4W1U A;  2QM3 A;  4M6V A;  1O3S A;  3E0J B;  2IGM A;  2P8T A;  3CDH A;  2STW A;  4NNJ A;  3KZI C;  1JUS A;  3JRF A;  3DKY A;  2NS0 A;  5F0C A;  4G7Z F;  1HKQ A;  1Z6R A;  2E1O A;  4KIB A;  2ZFW A;  4YIF A;  2VJJ A;  4LLL A;  2R93 J;  2R3A A;  3CCM I;  2DK8 A;  1T0F C;  5FFX A;  1MDM A;  1PJR A;  2HZD A;  4AUX A;  1Y0N A;  1IG7 A;  3MKL A;  3U1K A;  4AIK A;  3A1Y A;  3BR2 A;  3OR1 C;  1T8I A;  1FZP B;  1RIO H;  3FXK A;  1ZRC A;  5M5X J;  1LE8 A;  2OD5 A;  3JRC A;  1R6R A;  2KRC A;  1UST A;  4XRF A;  3V8J A;  5BMZ A;  1S3J A;  3D5R C;  1VQN I;  3OSF A;  2CQ7 A;  1WSU A;  1ZTR A;  1NTC A;  2CQX A;  2KL4 A;  3D5L A;  4IO9 F;  1UCR A;  1LQ1 A;  2JA8 J;  2M45 A;  2L0K A;  2RNJ A;  1BR4 A;  4KIC A;  4NC8 A;  5IOZ A;  4KYW A;  3GEZ A;  1VQM I;  2K5C A;  2OBP A;  1R22 A;  1ZG1 A;  4BJ6 C;  3CCE I;  3VUZ A;  2M87 A;  1IRG A;  2MH9 A;  2JRT A;  4L18 B;  5E20 A;  4WXC A;  3G73 A;  2HTS A;  1MSE C;  1T08 B;  2L9N A;  3TQN A;  4QEN A;  3ABU A;  3K4K A;  2HR3 A;  2JTV A;  1SFO J;  1O7F A;  2RRE A;  3HGY A;  4GO1 A;  1J9I A;  1X1C A;  4Y4R A;  3K2A A;  1XX5 A;  4HQM A;  4JX6 A;  3I55 I;  3JAM Z;  2OZ6 A;  4XBF A;  2K7L A;  1MND A;  3QPL A;  3MEK A;  3HSF A;  3V7C A;  2JPB A;  2CRG A;  4P1W A;  1N6C A;  4N0B A;  3DU6 A;  3CJT B;  2A07 F;  1BIB A;  2DK5 A;  2XRL A;  3IH2 A;  1XQH A;  3K9T A;  1W7P B;  4KIT B;  1WPK A;  1I6H J;  5IYC J;  2YU3 A;  3QYB A;  4PFP A;  4E7H A;  2EPF A;  2ZNZ A;  3OS0 A;  1RES A;  2R7T A;  1XGM A;  1MJA A;  1G3T A;  4C1Q A;  3JCU C;  3CUO A;  1PUF A;  2LBF B;  2ZME C;  1AHD P;  1K7A A;  3J7A Y;  2DFF A;  2NOG A;  2ZFU A;  1KGS A;  2LSO A;  4E7J A;  2F6C A;  2PMZ N;  2L2O A;  4ZYA A;  1T6S A;  3H5N A;  3GFI A;  2F4O B;  3ABT A;  1OCZ H;  3M1C A;  4L5I A;  2HQ5 A;  1WZ2 A;  1HST A;  2WAQ N;  4EQQ A;  3CMA I;  3FBN B;  3QU3 A;  2XGE A;  1HKS A;  2Y30 A;  3KP4 A;  4HRI A;  1QQI A;  1X58 A;  1SD7 A;  4UVA A;  2DO7 A;  2L5Q A;  4LIU A;  2HZT A;  3HBL A;  3S1R J;  2LBF A;  1J09 A;  2Z16 A;  3B6C A;  4GYI A;  1AU7 A;  1T38 A;  2VOD A;  5JIY A;  1E3O C;  3NRV A;  3GLX A;  2IAI A;  2E35 A;  4M3F A;  3MKZ A;  2H1K A;  2M5W A;  2PLY A;  2DLL A;  3MVP A;  5E17 F;  1Y0U A;  5AYF A;  1T95 A;  2M0M A;  2J5P A;  3AG4 H;  5FRO A;  4L9N A;  1SMT A;  2MLG A;  2CFX A;  2W84 A;  3CC2 I;  1IN7 A;  3CO7 C;  3H0G J;  4BQN A;  1W7P A;  1OCT C;  4NHJ A;  3E6B A;  2FML A;  3CMY A;  2JSP A;  5EEA A;  1HQC A;  3QQA A;  5LFA A;  2VJ4 A;  2R92 J;  2QF7 A;  1GVD A;  2IA0 A;  1P7I A;  2OQR A;  2EIN H;  4XID A;  2Z1D A;  1OCC H;  4A3C J;  3ZR8 X;  3ERM A;  3DF8 A;  1WH5 A;  2VJI A;  3IRQ A;  4XN0 A;  3C1D A;  5GTH C;  2EFW A;  1IN6 A;  3RQ4 A;  4RAY A;  3M55 A;  3KMJ A;  3K4B A;  2NVX J;  3OOI A;  2VKD A;  2IS4 A;  3PFY A;  3CME I;  1ETQ A;  4LG3 A;  1D5V A;  3RKY A;  1FOY A;  1ZRF A;  2F5D A;  1IV6 A;  4CCN A;  3S7B A;  1DP7 P;  3OPE A;  2CV1 A;  1YIO A;  2ECC A;  3E5U A;  1F9N A;  2H8W A;  3O6B B;  4CIC A;  1XD7 A;  5HNF A;  4EGY A;  1SD5 A;  2ACJ A;  1MNM C;  4UUV A;  2KZG A;  3F72 A;  2L9V A;  3KE2 A;  4S0H B;  5CQG A;  4G12 A;  2XIG A;  2EFP A;  5FKN A;  5ILS A;  3MN2 A;  1YLF A;  1FBU A;  4BJ5 C;  4PUS A;  1ONV A;  3HIF A;  1A5J A;  2W7N A;  3ZQQ A;  5J4Y A;  1LE8 B;  3AG1 H;  4XLH A;  3OOP A;  1X19 A;  3HRU A;  1RR8 C;  3HOS A;  1BC7 C;  3LFK A;  5TIS C;  2VKH A;  5FLM J;  1G59 A;  3KFW X;  5E1X A;  1DU6 A;  5D6F A;  3OXG A;  2O7O A;  3LST A;  4RM2 A;  2D2W A;  1JGS A;  1W36 C;  4A3L J;  3FK6 A;  1RKT A;  1FP1 D;  4QLC U;  2E2I J;  2V1U A;  1Y56 A;  4GYG A;  2WY7 Q;  4XOP A;  1TQP A;  2WAE A;  2Y48 A;  4RLQ A;  2EZK A;  3R4K A;  3CCJ I;  4PGH A;  4DJA A;  2M8E A;  3OYL A;  1PUE E;  3OYG A;  5GTI C;  2O61 A;  3K1P A;  4ZTJ A;  2BY3 A;  4PGG A;  1U5T A;  3T8T A;  1R1V A;  1IDZ A;  1UHM A;  2AS5 F;  2VOP A;  2VT2 A;  2DMN A;  3MZH A;  1ZAR A;  1XSV A;  1TT5 B;  1S5L C;  3TW6 A;  2QUF A;  1JXS A;  1ZRD A;  2DFH A;  4ESB A;  3K1M A;  1N78 A;  4HG2 A;  4E7K A;  4M3B A;  3FXM A;  5CKT A;  4K2E A;  3FK7 A;  2ME6 A;  4W97 A;  4A3M J;  1A04 A;  2LRE A;  1XGN A;  3TO6 A;  3CZ6 A;  2GAU A;  1OCO H;  3FBI B;  3ERE D;  2HOS A;  3I56 I;  2E7X A;  4HW0 A;  2DA2 A;  3BCA A;  2RVC A;  3DPL C;  2HQA A;  2PEX A;  2Y75 A;  2LF8 A;  2OU2 A;  2VE8 A;  1WJD A;  3GFM A;  4M9S A;  4YIR X;  2FUG 2;  1F43 A;  2WC2 A;  3CMM A;  1R1U A;  5EG0 A;  3PL8 A;  2D45 A;  3M54 A;  4LLN A;  1Z1D A;  2E1C A;  2MW8 A;  1XGS A;  3D0S A;  3WOD F;  3L2C A;  3BJO A;  5KAF C;  4B3X A;  3EUK L;  1TT0 A;  2ZNY A;  4V2F A;  2XAJ A;  1JJ8 C;  4M72 A;  3OYF A;  3JRD A;  1D8K A;  1BR1 A;  5CJ9 A;  4QEO A;  1JUP A;  1V5F A;  4HST A;  3B02 A;  2DYR H;  2DDB A;  3KZY A;  3KP3 A;  4AU7 A;  3WTS C;  3OYH A;  2DXI A;  4RGR A;  5T0K A;  1UHS A;  4XSZ F;  1MW7 A;  2KHM A;  3J7Y J;  2YS9 A;  3WTT C;  4EVI A;  3OSG A;  2HGC A;  3LAJ A;  2KRH A;  4UUS B;  3EYY A;  2H6B A;  2ZME A;  1OR7 A;  4IEJ A;  3BTJ A;  2MH2 A;  1EV7 A;  1UZC A;  3F8N A;  4NUB A;  2ESN A;  3M58 A;  5TTF A;  1SAN A;  1DGR M;  2W48 A;  4HF2 A;  2CYY A;  3I54 A;  1YI2 I;  2K86 A;  2L54 A;  1Y1V J;  3FMS A;  1ZEL A;  2MBF A;  1Q1V A;  4NB5 A;  3VYR B;  3SJM A;  1SVM A;  1F5T A;  5KK1 A;  2PX9 A;  2Z2S B;  1EJ9 A;  3G1L A;  2UXX A;  4G9Y A;  4IOC F;  5EGO A;  1YIT I;  1AOY A;  3KYC B;  2GXG A;  1FIA A;  4AVZ A;  5H6R A;  5J4V A;  4AM3 A;  2PI0 A;  1ETW A;  2YUS A;  4XKB A;  1WJF A;  5LD2 C;  3HOV J;  3E5X A;  2E1N A;  5E3O A;  3WGG A;  2VKE A;  3F22 A;  4Q4Z F;  3DV8 A;  5FKL A;  2HYJ A;  3C2G A;  2EV6 A;  1R4N B;  2KDO A;  2ZXJ A;  4F52 A;  3RKQ A;  4IX7 A;  1H3I A;  2NVQ J;  2PBI A;  1ZLJ A;  2LF7 A;  2ECB A;  3ZN0 A;  2G7H A;  1FBQ A;  3H5A A;  1VQ5 I;  3IV5 A;  5L3B A;  3CC7 I;  5EZH A;  1Z21 A;  1NHA A;  4IZZ A;  1ZLK A;  4LB5 A;  2JV0 A;  5F6F A;  3O8G A;  1QGP A;  2KDZ A;  4G7H F;  2R7O A;  4OIN F;  5T5G A;  3BCB A;  5BPD A;  4OWR B;  3TOB A;  3CDI A;  2FOK A;  4KT5 C;  4ENK A;  3TGN A;  1J75 A;  1HA8 A;  2M30 A;  3WHC A;  3FIW A;  4D7N A;  4QIW N;  3L00 A;  3OV8 A;  1ZN2 A;  3DKW A;  3GWZ A;  3BG5 A;  4M6Y A;  3H9Q A;  2OJE D;  2JJ7 A;  4E7S A;  3M1E A;  3K70 C;  1MD0 A;  5B3S H;  2DW4 A;  5CCM A;  2CGP A;  4B44 A;  2PQ8 A;  3A0H C;  5EF6 A;  2F69 A;  1ACI A;  4EJO A;  3KP7 A;  4C30 A;  3FHZ A;  3MO2 A;  1P6R A;  5DCF A;  2BVL A;  3HUG B;  3ZMS A;  5ICG A;  3VOE A;  2WAQ A;  4O3M A;  4GDF A;  1OCR H;  1TNT A;  1JHH A;  4EGZ A;  1VQL I;  2IGN A;  3VYS B;  3ZOB A;  3LSJ A;  3IWF A;  5IT9 Z;  3SEQ A;  1N75 A;  4QEP A;  2K3F A;  4JP0 A;  2R7X A;  2IGK A;  5LRR A;  4S04 A;  1O3T A;  1MSF C;  4RZ0 A;  2WB1 A;  2JPC A;  1FPQ A;  4EMS A;  5AIQ A;  5KJM A;  4OAZ A;  2FU4 A;  3AG2 H;  1BW5 A;  1MMN A;  4I01 A;  2GA2 A;  2CU7 A;  4EM1 A;  5ICE A;  1YRN B;  5K7H A;  3A2K A;  2HDD A;  2MG4 A;  4OIP F;  2E2H J;  3GW2 A;  1J5Y A;  2FBH A;  3EET A;  1R23 A;  4PSW A;  5KHD A;  2YX4 A;  2EWN A;  1P9Q C;  5DS9 A;  4RDU A;  5BNG A;  4ASN A;  3ISP A;  5HDK A;  3I59 A;  1J0R A;  2A3S A;  4Z2Y A;  5K5Q A;  1KU2 A;  1YHQ I;  4A3B J;  2WB1 N;  5JR3 A;  3GME A;  2ETH A;  2VBW A;  4RMN A;  3WTW C;  2CS3 A;  2KIQ A;  1DU0 A;  4DIQ A;  4ZTF A;  3PO3 J;  2KIM A;  2R7F A;  4AIJ A;  2VC1 A;  2VI6 A;  1B6A A;  3VSL A;  2IJL A;  3FX3 A;  4GFB A;  1FEX A;  1FOX A;  3FHN A;  4BQQ A;  3DTK A;  2M34 A;  1R1T A;  2P7V B;  4HZF A;  4CCO A;  2WAF A;  4CO8 A;  4LOC A;  2V9K A;  1WQ2 A;  4BE0 A;  3QWP A;  3LOC A;  5GAD J;  1YIJ I;  4QSH A;  2KMU A;  4MI5 A;  1H89 C;  3N71 A;  1MVH A;  1WH7 A;  1R00 A;  2NOJ B;  4LIT A;  1JT6 A;  3A03 A;  4A69 C;  5TRD A;  2OZU A;  3E5Q A;  2MD0 A;  5L3D A;  3VPR A;  3BOQ A;  3CCL I;  4FCY A;  3A02 A;  5DUI A;  4KIS A;  5KJK A;  2QBY A;  4RLF A;  5C3E J;  1MJ9 A;  4RAG A;  2ZCW A;  1FC3 A;  3H9J A;  2Y0S N;  2CG4 A;  3BQZ A;  4HNU A;  4MI0 A;  1WKM A;  3BPX A;  2L4A A;  1HBX G;  2V9P A;  4BE1 A;  4KT6 A;  2QBY B;  5J6X A;  3L9F A;  1MH3 A;  1EH7 A;  1GUU A;  1HKT A;  3LSH A;  2Q2E A;  4MQ9 F;  1IW7 F;  5ILU A;  1SEU A;  3CC4 I;  3DLA A;  1L3L A;  2GOX B;  3M4O J;  2CUJ A;  2JA6 J;  1OYW A;  2O6G E;  1W4M A;  4HQE A;  3IH4 A;  4IHV A;  1FP2 A;  3JTH A;  4NQW A;  1FSH A;  3BTI A;  1SFX A;  4BUP A;  1MIJ A;  1SD6 A;  1GVJ A;  1X1B A;  4JK1 X;  1BN5 A;  2NRA C;  2MYS A;  3I59 B;  1V4R A;  1KQ0 A;  2A69 F;  4HF0 A;  3ECH A;  3KCC A;  3CUQ A;  4B47 A;  3BR5 A;  3FXQ A;  1KZH A;  3F8B A;  5DYM A;  1XS9 A;  5KJL A;  4L9T A;  4WX9 A;  5EX3 A;  1DPU A;  5T0M A;  2XKO A;  2CJJ A;  3S7F A;  1OMI A;  2HPI A;  2J5O A;  1RUN A;  1IRF A;  1TTY A;  3L09 A;  3ZQ7 A;  1OPC A;  2X85 A;  3Q0W A;  4PFO A;  3DBR B;  3BPV A;  2LYC A;  5DD8 A;  1QPI A;  5LBQ A;  4GGG A;  5F04 A;  3V42 A;  2CUZ A;  2EV0 A;  4DW6 A;  1RRJ A;  3RJW A;  3EPZ A;  4IHT A;  4UB8 C;  1PDN C;  3OS5 A;  3KYD B;  4IRH A;  3GTQ J;  3I64 A;  3KMA A;  1IXR C;  1O7L A;  1A6Q A;  2ZXI A;  2DFE A;  2R7D A;  4ZH4 F;  3U2R A;  2PJP A;  1YO5 C;  3F23 A;  2EQR A;  4CCL A;  3KEQ A;  1G3W A;  4Y52 J;  4X1E A;  2GXA A;  5DUK A;  4BHP A;  5M5Y J;  2RQP A;  2Z5U A;  1GLN A;  1LJ9 A;  1HW5 A;  2H6C A;  3P5J A;  2L7K A;  4IOA F;  3PNY A;  2GOM A;  5IY5 H;  4WUY A;  4QPO A;  2XVC A;  5FB2 A;  1MVX A;  2CUE A;  1JKQ C;  5LSZ A;  1V54 H;  2A61 A;  1FYM A;  1B9M A;  4Y33 A;  2OQG A;  1DQU A;  3BWG A;  5ICF A;  4NC7 A;  3ZPL A;  2ZKZ A;  3SW9 A;  2LMD A;  5ARG A;  3CP8 A;  3ZMU A;  2DTR A;  2Q0O A;  4BGD A;  4KN7 X;  4HA8 A;  5M3F J;  2IP2 A;  4D5C A;  2LKX A;  1FOW A;  1EA3 A;  3FMQ A;  5J1Y A;  4IHS A;  2UUZ A;  3E97 A;  4II3 A;  2Z9O A;  4BHB A;  2K02 A;  3CCU I;  1XN7 A;  4DBQ A;  3Q9S A;  1YQA A;  4BNC A;  4DYR A;  3DB5 A;  3HHG A;  1OR7 C;  2HVQ A;  5HNH A;  1HOM A;  2DOF A;  1F36 A;  1BIA A;  3BTC A;  1XCB A;  3ZQF A;  5FD5 A;  2KQR A;  4UUT A;  1DUX C;  4FIS A;  2W00 A;  3RZD J;  2QWW A;  3N4M A;  2QKM B;  3DTE A;  1MMA A;  4JBA A;  4LG0 B;  2XAF A;  3IAM 2;  5FFZ A;  1T2K A;  3OXL A;  3QRF F;  1PEG A;  5DTD A;  3B6A A;  4RM3 A;  2WWY A;  1VF9 A;  3KP2 A;  3HKZ A;  4BE2 A;  3OYK A;  5LEJ A;  5ED4 A;  4XLA A;  2XGX A;  4BXX J;  2JK3 A;  1BA5 A;  1VQP I;  3V8L A;  1MMG A;  1OCP A;  4FET A;  2Q8K A;  1B9N A;  4A3I J;  4BBS J;  2RN7 A;  3QWL A;  2MFZ A;  4MIM A;  2Z33 A;  5ILV A;  1VTN C;  1STZ A;  5JHU A;  1LFU P;  4RB1 A;  3BQY A;  3E3V A;  5F6K C;  1HDP A;  3PUB A;  1U8B A;  2ZJR F;  1IAW A;  2XB5 A;  5HOD A;  1K61 A;  1K78 A;  4IKF A;  1B8I A;  5L3F A;  3PIP F;  2JRM A;  2AHQ A;  3F9K A;  5GAG J;  3Q0V A;  4UUS A;  1MMS A;  2DMQ A;  2OA4 A;  4RBO A;  1EKE A;  1ZGJ A;  2E5Z A;  5FRN A;  4CUG A;  3S2H J;  3LSK A;  4MTD A;  1YJN I;  4IJD A;  1FBS A;  2P5L C;  2C6Y A;  3DWL E;  3X2Q H;  3N05 A;  4ETS A;  2IW5 A;  5LHI A;  3H3V K;  5K7F A;  5LGN A;  2NNY A;  4S05 A;  2VT3 A;  1XG1 A;  1QZZ A;  4HV5 A;  4ZYH A;  2DOD A;  2WTE A;  5HVQ C;  1XMK A;  3I58 A;  3K69 A;  1FLI A;  2R5Y B;  4A3K J;  3HOW J;  4B48 A;  4I7H A;  1ZHF A;  3HSR A;  5K5R A;  2F4I A;  2K40 A;  1FMW A;  1I1G A;  1YW8 A;  2G46 A;  4EM0 B;  3WTX C;  3RU0 A;  3U9G A;  2F4M B;  2V4J C;  3K10 A;  4XMY A;  4A2U A;  1BI3 A;  1HLV A;  4QPQ A;  2V1X A;  1I27 A;  3UR3 C;  3COA C;  2FXA A;  4FE7 A;  2L9R A;  4CCJ A;  2UZK A;  3PSI A;  3NWS A;  4HOB A;  3H3Z A;  1C0W A;  1S6L A;  4P5O A;  5C44 J;  4DOZ A;  4WK8 F;  4ZYD A;  2XDV A;  2ISZ A;  2ZJP F;  5CVI A;  4R8H A;  2NXN B;  3CLO A;  4B8X A;  3PO2 J;  2BGC A;  4J83 A;  4ZYG A;  3M53 A;  1JKO C;  1S7E A;  1IUY A;  5D5V B;  3CP2 A;  5EGO B;  3RSN A;  1JTY A;  3PNV A;  2BVM A;  2HQR A;  2DA4 A;  1GHC A;  3NEU A;  2DAO A;  3DQV C;  3AL0 C;  3PM1 A;  3D1N I;  4CDG A;  3CJQ B;  1L0O C;  4XRS A;  2HDC A;  1FWZ A;  3RPQ A;  5F59 A;  4I98 B;  3GVA A;  3I4N J;  4A3G J;  2OCC H;  2ESH A;  1LUJ B;  5K7Z A;  1HSJ A;  3L2W A;  1MJB A;  1REP C;  2GQQ A;  3C2B A;  1OFC X;  4CCM A;  5J1U A;  5EG2 A;  2V1D A;  5BPI A;  2ME0 A;  3BG9 A;  2Z3Y A;  5EYR A;  1MGT A;  3R61 A;  1X1A A;  1ZH5 A;  3KPH A;  2MA3 A;  3RAY A;  1UFM A;  1B59 A;  3M9A A;  1SFE A;  1S29 A;  2RGV A;  1QZY A;  2V79 A;  4V2G A;  2W85 A;  1ZAO A;  2E36 A;  3QPH A;  5FLV A;  4L9V A;  4AD9 A;  1ML9 A;  4G6Q A;  2BW3 B;  2PMH A;  5F5E A;  3LAP A;  2Y69 H;  1BM9 A;  1X1P A;  1G4D A;  3OYC A;  2R4G A;  4YPE A;  3SDB A;  1U2W A;  1W36 D;  1KU9 A;  2VQL A;  5IPA A;  5EG0 B;  4C3H J;  4U0Y A;  2EIL H;  2O9L A;  3JSP A;  2EK5 A;  2QEX I;  3BJA A;  2IVM A;  2X9D A;  1PUF B;  5C4X J;  3IKV A;  1BI0 A;  2LDU A;  5GAE J;  4OIQ F;  4M9Z A;  5C4J J;  3MKY B;  3OXF A;  3BZ6 A;  1D1A A;  2MC3 A;  2VC0 A;  3PSF A;  3OY9 A;  2X48 A;  2QZ8 A;  5M3M J;  2RKH A;  2FF4 A;  1P2F A;  5LGU A;  2ZJ2 A;  1QZE A;  3S3O A;  3BZC A;  2R7W A;  3U21 A;  1TQM A;  3B73 A;  1ZR4 A;  2O03 A;  1X3W B;  4CYC B;  3ZMT A;  2OF7 A;  5HS8 A;  2JVG A;  1FJL A;  2A6T A;  2DQL A;  3BR1 A;  1CGP A;  2QGU A;  3F8M A;  3BJ6 A;  3RIB A;  2E2J J;  1TQI A;  4X6A J;  2BOL A;  4WCG A;  5DV5 A;  1N3J A;  3HNA A;  2R5Z A;  4EV0 A;  3PFI A;  4XQF A;  3W6V A;  2DA5 A;  1TWC J;  5LSX A;  1I3Q J;  1X4P A;  5B1B H;  1ZGW A;  1LNW A;  1FTT A;  1Z6T A;  2CQK A;  1IRX A;  4XLN F;  4UNO A;  3DXJ F;  3AKZ A;  4OMY A;  2DYS H;  3ECO A;  3T5X A;  5CVU A;  2FNA A;  2L4M A;  3Q0U A;  2VAS A;  4E4H A;  4BQA A;  3FPD A;  3VV0 A;  3ZQH A;  4A6D A;  3W6K B;  3M59 A;  3VWB A;  2NYX A;  1VQ7 I;  2LY1 A;  3IKT A;  2EJR A;  2XSJ C;  3HG9 A;  2K85 A;  4GCV A;  4LMY A;  3KZZ A;  2RC4 A;  3G71 I;  1RI7 A;  3MO5 A;  3BR0 A;  3NQO A;  2KFD A;  1FX7 A;  3F0C A;  3LA7 A;  4U7D A;  3KMT A;  3WTY C;  4LIV A;  2G9W A;  2LP0 A;  2HEO A;  3I53 A;  5CYV A;  5F6L A;  1TWH J;  4ZDP A;  5M5W J;  3CBP A;  3WTV C;  1MKM A;  2XRN A;  3RYP A;  3HM5 A;  4WWC A;  2NVT J;  4BEH B;  3HRS A;  4IQJ A;  2WY8 Q;  3L2U A;  1MNE A;  1ZG3 A;  1WWX A;  1BC8 C;  4LDG A;  4QTR A;  2ZC2 A;  2ADU A;  2P7C B;  5IYD J;  3GXO A;  5E18 F;  2E5N A;  2R5Z B;  2H8R A;  3FXJ A;  3P7N A;  3V7S A;  3SQN A;  4D5F A;  4MEX F;  5FD6 A;  5IOY A;  1YS7 A;  3KP5 A;  2HWV A;  1LDD A;  3L7W A;  1P4A A;  1ZKG A;  4BAC A;  3J80 Z;  3LSM A;  1XC5 A;  4IPA A;  2NVY J;  2QCO A;  4NVQ A;  2DA3 A;  2VQG A;  1H88 C;  3ZGK A;  2BY1 A;  3S14 J;  1XDU A;  1I50 J;  1PVE A;  5LRS A;  2XKP A;  4Y15 A;  4M3D A;  2K9L A;  5HDG A;  5KVR A;  4YG2 F;  1TW2 A;  1GXP A;  2DMP A;  3RKX A;  3OYE A;  3GTM J;  3CD6 I;  4UXN A;  2Z99 A;  2NS7 A;  3D5S C;  4AYB N;  4PCQ A;  3WU1 B;  1GXQ A;  2W1O A;  1BOA A;  1ODD A;  2WV0 A;  1EF4 A;  4EEF G;  5DM7 F;  5B1A H;  3JRH A;  5E3N A;  2QVO A;  1ZRE A;  2BY2 A;  5FLX Z;  4ESJ A;  1JUM A;  3C7J A;  1SMY F;  3L2Q A;  3F3X A;  1ETX A;  5HLI A;  2B63 J;  1O9S A;  3BRO A;  1QRY A;  4JOM A;  4BHC A;  5EEH A;  3FXL A;  4IHW A;  2DN0 A;  3ESW B;  3I4M J;  1YX5 A;  3S15 J;  1KU3 A;  5F1R A;  4M9X A;  3ROU A;  4LD5 A;  3S17 J;  2VQH A;  4E6K G;  1O4X A;  4KNY A;  3KEO A;  3IAS 2;  3TW7 A;  1YYV A;  3QOP A;  4CH7 A;  1KU7 A;  5TEG A;  5KAI C;  3OL3 A;  3G4S I;  1I1S A;  3BT9 A;  3L2R A;  2IS1 A;  1MZB A;  4IHY A;  3VSK A;  5L3E A;  4H0E A;  1VQO I;  3AFH A;  3JR9 A;  1WRJ A;  1WCM J;  1ZK8 A;  2FE3 A;  2HU9 A;  1WVR A;  2BV6 A;  2XF6 A;  4L5E A;  5FKM A;  3TO9 A;  4RGX A;  1VQ8 I;  5FO5 A;  4Y17 A;  3TG5 A;  1QPM A;  4A12 A;  1ULY A;  3HJE A;  5K1Y A;  5GAH J;  3LL7 A;  2RQQ A;  1P92 A;  5DD4 A;  2HPM A;  5FGM A;  1WI3 A;  1RR7 A;  4KN4 X;  3IL2 A;  3M8E A;  1P4X A;  1R5I D;  2VBX A;  3GZN B;  3M5A A;  2IRF G;  4A5N A;  1E3H A;  3FKI J;  4XRS G;  3CUQ C;  1VQ4 I;  4XKW A;  3LQR A;  2OAZ A;  1TW3 A;  2K9M A;  3WG9 A;  1R4M B;  1A31 A;  4MGR A;  4IL6 C;  4G8X A;  3KYL A;  1H9T A;  3P9K A;  4RGU A;  3N97 A;  3GUD A;  4I0B A;  3RTR A;  2IA1 A;  2VBY A;  4A3J J;  5JHN A;  4A3E J;  2BYV E;  1Z67 A;  2L02 A;  5JIN A;  4AVP A;  2JWT A;  4O6J A;  3HRT A;  2CQN A;  3I71 A;  2QLZ A;  3GYH X;  3HL2 A;  4MLO A;  1WJC A;  1D1B A;  2TCT A;  5CVR A;  3CCR I;  5LLQ A;  3PDN A;  1V3F A;  3UNG C;  3FKJ A;  3S93 A;  3ZMD A;  2A6H F;  2E60 A;  2VE9 A;  1Z7L A;  1XCV A;  3HC7 A;  4P96 A;  4RB3 C;  1YRN A;  1FIP A;  3PJR A;  1U9O A;  2QEN A;  2XSD C;  3CO6 C;  3KEY A;  5D8L B;  3ZRG A;  1J59 A;  1YE9 A;  3MMY B;  2JUG A;  3K0L A;  2GA1 A;  4N4O B;  3IUO A;  2KJB A;  1USS A;  3QPS A;  3ABL H;  1R49 A;  5LEK A;  3LSR A;  3TDU C;  2UV1 A;  3HGG A;  2QQA A;  3QAH A;  3OYM A;  1UAA A;  4ENJ A;  1QO0 D;  2NVU B;  2EA4 A;  3ZP5 A;  3M3Y J;  1K6Y A;  1ENH A;  1B8I B;  1K78 B;  5LHH A;  5HDN A;  1P7J A;  4G7O F;  5FLX K;  3U1D A;  2FOW A;  4IJA A;  3SYT A;  1IV8 A;  3S16 J;  1R71 A;  4YRV A;  4MFD A;  2LKS A;  5LGT A;  3PUF A;  2LTP A;  2L7Z A;  2RV8 A;  3HYI A;  4DZJ A;  4LLG F;  3BG7 A;  1ITY A;  2VPL A;  4CXF A;  5LHG A;  1IN4 A;  4HNT A;  2DQR A;  3IRR A;  2F5C A;  4LG0 A;  3RJP A;  5D5X B;  4HBL A;  2FBK A;  1APL C;  1D3Y A;  1D1C A;  4E7L A;  5E8G A;  2X51 A;  3GTL J;  3S1M J;  1WHU A;  2G7U A;  3TED A;  1AKH B;  1JHF A;  1V55 H;  4ZC3 A;  2I8D A;  1NG6 A;  4EJV A;  4PSX A;  1VQ6 I;  2JA2 A;  5J47 A;  2GWR A;  4MNU A;  3DTI A;  1K4S A;  4NDL A;  1XGO A;  4J7F A;  1U9N A;  1I39 A;  3M56 A;  2XF5 A;  2MC4 A;  2FA5 A;  2HKX A;  3FXU A;  2VIX A;  1IXS B;  4YNP A;  3JRE A;  2K9Q A;  2QSF X;  2ISY A;  2V7F A;  4NC6 A;  5D8K B;  4F3Q A;  3OR2 C;  3WTU C;  3ZMV A;  1Z77 A;  2KKO A;  2HS5 A;  2ZB9 A;  3QOE A;  4BH9 A;  1MUF A;  3SFZ A;  3SWC A;  1Z0X A;  4JYK A;  2BBY A;  5KCM A;  3QWV A;  3HTS B;  3G1O A;  4FAS D;  2QQ9 A;  3T8R A;  3OIO A;  1FTZ A;  1HW1 A;  4ZZD A;  5JLW A;  1Y1W J;  1Z3Y A;  4J01 A;  1UMQ A;  3GCM A;  1MBG A;  1T39 A;  2LFB A;  2DJI A;  2ELJ A;  3QOD A;  3G3Z A;  2LKP A;  4M73 A;  3KLO A;  3HEF A;  3MKW B;  3SHF A;  2YPR A;  4ENM A;  1PYV A;  1RUO A;  3HUG A;  4YFK F;  5FKK A;  3BG3 A;  2LVS A;  5EX0 A;  2P6T A;  2X6W A;  5HS7 A;  2VKV A;  1IC8 A;  3S1Q J;  2XGC A;  2DDA A;  4HX8 A;  3ASO H;  2JMW A;  5CCL A;  3GTJ J;  2DA6 A;  4OAY A;  1SVL A;  1I6X A;  3LSG A;  1LVK A;  2EFN A;  2YSR A;  5J40 A;  2GLO A;  1ORK A;  2FX0 A;  2BXZ A;  2GM4 A;  2EFQ A;  3KP6 A;  1IZ1 A;  3LA2 A;  5JJ0 A;  3F8C A;  1G6N A;  2LR8 A;  4OMZ A;  1JKR C;  2L01 A;  1W0U A;  3G2B A;  2JA5 J;  4O6F A;  2HXI A;  4RS8 A;  2FBI A;  3VOD A;  2X6O A;  4MQV A;  1S72 I;  5A2Q Z;  2AXL A;  3MFK A;  2V6C A;  3QP6 A;  3HPG A;  4XK4 A;  3ASN H;  3AAF A;  4EJW A;  3S3M A;  4B43 A;  2VBZ A;  3Q5F A;  1D0X A;  4G94 A;  4DQ2 A;  1W0T A;  4JDS A;  1VFC A;  4OU0 A;  2OTL I;  1AA7 A;  3GTO J;  3F9Z A;  4I6Z A;  5DCM B;  1TC3 C;  1QHH D;  1RPW A;  4P9F A;  2L7F P;  4LK1 F;  4ZYE A;  4DBR A;  1R5G A;  3K5K A;  3K2Z A;  4L0Z B;  3V8K A;  3TMO A;  3WU0 A;  1SFK A;  5HLT A;  2CV2 A;  2Q1Z B;  1K83 J;  1NK3 P;  2A6E F;  1D0Y A;  1TWG J;  2XC7 A;  1ZGA A;  4JX5 A;  1YX3 A;  2KLO A;  1Y8R B;  3CCS I;  4YII A;  2CH0 A;  3OYJ A;  2H1L A;  2HDW A;  2DT5 A;  1QNT A;  4XKC A;  2IGO A;  2M1B A;  2Y31 A;  3T0Y A;  3TBI A;  2IBD A;  2JSC A;  2PFB A;  9ANT A;  1B4A A;  4DNC A;  3KLN A;  2IT0 A;  5HI7 A;  5A2Q K;  2DI3 A;  3Q9V A;  3JRA A;  2IGQ A;  3VFZ A;  1WI9 A;  1PP7 U;  5HLG A;  2IXS A;  3RCO A;  4A6E A;  2CW8 A;  1UG2 A;  1JI8 A;  3ELK A;  1QBJ A;  1SD4 A;  3QU6 A;  4I99 C;  4ITV A;  4F55 A;  2NS8 A;  2VPR A;  5JVT A;  1XMA A;  4B1R A;  1MT6 A;  4PZJ A;  2AXT C;  2DTZ A;  2K9S A;  5E8I A;  4B09 A;  2EIJ H;  1KQ8 A;  5BOX A;  4BKX A;  4MTE A;  2W4S A;  2MAB A;  4MO7 A;  2LG4 A;  1A6I A;  1HXD A;  5CPR B;  1DPR A;  4UV8 A;  4B4C A;  3M8F A;  3P9I A;  1BL0 A;  2W25 A;  2P0W A;  4C2T A;  4C2U A;  2NAZ A;  1IJW C;  2M4G A;  5GP9 A;  1LVA A;  1UHW A;  2RFI A;  4NJ5 A;  2HOA A;  1E3P A;  2LLK A;  4LB6 B;  1B1B A;  2E1M B;  2XAS A;  4I0A A;  4RAZ A;  4CCK A;  2EB7 A;  2HKO A;  4A0X A;  3JSO A;  1IF1 A;  4NBQ A;  1G8X A;  1QVT A;  3JRB A;  5L3C A;  3SZG A;  1ETO A;  2XAU A;  1S7O A;  1T98 A;  4IQ4 A;  4A5M A;  5D5W B;  3LSI A;  2W57 A;  3H5R A;  4BAY A;  2VUM J;  1R58 A;  2HTJ A;  5GPC A;  2O8K A;  1XMX A;  2Y9Z A;  2R7S A;  1OJL A;  4PDK A;  4ZZL A;  2K27 A;  3EQL F;  3LFU A;  3MD2 A;  1QVU A;  2OTJ I;  4BJT A;  1CF7 B;  4BXU A;  2QA4 I;  2HNH A;  2HOT A;  1RKW A;  3S32 A;  3DBH B;  2ZO4 A;  1A35 A;  1KYW A;  4MFE A;  3CDL A;  4RGS A;  2CUF A;  3W2A A;  3CQZ J;  1ZYR F;  4A3F J;  3I5U A;  1ZQ3 P;  3M07 A;  2HQN A;  1SAX A;  1JT0 A;  3F21 A;  3QYE A;  2OC6 A;  1GV2 A;  1IDY A;  2E7W A;  4PJM A;  1S9H A;  4TV7 A;  3GFJ A;  3NWT A;  4KA4 A;  2D1H A;  2LRD A;  3OOU A;  1KQ9 A;  3HOY J;  3K4C A;  2HI3 A;  2QKL B;  3GX4 X;  3HZJ A;  4ANJ A;  1F4K A;  1B72 B;  4EAT A;  4FX4 A;  1IGN A;  2DMT A;  2E19 A;  2M4K A;  2CQQ A;  1S8N A;  1XTA A;  3DPU A;  2O0Y A;  3GTP J;  4HV6 A;  3OYN A;  4F7Z A;  2EZH A;  3BO5 A;  1P4W A;  2DPD A;  4HPQ A;  2P81 A;  3LQQ A;  4HF1 A;  2BHY A;  1IUF A;  3K6G A;  1ZKK A;  2LY2 A;  4L5J A;  3L1P A;  2EV5 A;  2FQ3 A;  4CSW A;  4FMU A;  4H4K C;  3I9V 2;  3GFL A;  2FNP A;  3DAL A;  3K4M A;  2R7R A;  3GTK J;  4O5V A;  2R7Q A;  1XSD A;  2IEK A;  4AYB A;  2EIK H;  3HTU A;  5CVV A;  1CF7 A;  2F5V A;  3WGI A;  3RDI A;  2JUC A;  5D5U B;  1T0F A;  4UY8 I;  1U3E M;  4XIC A;  4CYD A;  2EBI A;  5CQE A;  3H0D A;  2D5V A;  4KDP A;  4ABZ A;  3LA3 A;  4U0V A;  5FKO A;  2O8J A;  5EJC A;  2COM A;  3G6E I;  2M3A A;  1U5T B;  3IP4 B;  2DBB A;  3RPU D;  1BW6 A;  3CLQ A;  4YEL A;  3SXY A;  5F0H A;  4PK4 A;  3QPT A;  3FF5 A;  3KET A;  2DFI A;  1Y39 A;  3L2V A;  1RET A;  3R60 A;  2BEO A;  2CSO A;  4WXD A;  4XM3 A;  2XRO A;  2ZJQ F;  1JE8 A;  1CQT A;  2HOE A;  2FEZ A;  5TJJ A;  2LOO A;  2MLK A;  3ZXS A;  2VOO A;  2OV7 A;  1QHG A;  4UVB A;  1Y6I A;  4A3D J;  2R7U A;  2B9S A;  2R7Z J;  2W5Y A;  3S7D A;  3WE2 A;  2ZME B;  4XL9 A;  3VYT B;  1ETY A;  1ERD A;  2ID6 A;  2BW3 A;  1MBK A;  4R1H A;  5DDG A;  1LEB A;  1X3Z B;  4Y3O A;  2GIZ A;  2MSY A;  4R79 A;  5CLS A;  4RAF A;  3HOU J;  4HSR A;  3OYA A;  2XUB A;  3H1C A;  4DGW B;  3H36 A;  2R5Y A;  4YFN F;  1NK2 P;  4I09 A;  3JW4 A;  2XPW A;  2QPW A;  3SDG A;  4UB6 C;  4P9U A;  4A93 J;  5AON A;  4D1Q A;  2F48 A;  3KIO A;  1FYK A;  2STT A;  5E79 C;  3C3W A;  4ZDL A;  2FQ4 A;  4C3I J;  2HYF A;  5F27 A;  2IPQ X;  3TP3 A;  2WA0 A;  5IP6 A;  2XAH A;  3KX2 A;  3RYR A;  3OYD A;  3S2W A;  5EZG A;  3BY6 A;  2BE5 F;  3DEE A;  2O5R A;  3NAU A;  1TWA J;  1W1W E;  4QWQ A;  2AQF A;  3J7A O;  5D4S A;  3BP8 A;  4C3J J;  2ELH A;  4C9Y A;  3CCV I;  2M0C A;  5F64 A;  1JJ6 C;  3LMM A;  4YNM A;  3H92 A;  3HRM A;  2WV1 A;  3TO7 A;  2K4J A;  2QSH X;  1T56 A;  1IN8 A;  2E71 A;  3T1B A;  4BYY A;  1FSE A;  2G0E A;  1WJB A;  3E6D A;  3FZV A;  2KIS A;  3IHU A;  3LNQ A;  2JZY A;  3CJN A;  2MGQ A;  3DBL B;  1SC7 A;  1MBF A;  5HS9 A;  3K7A J;  5J1R A;  2DA7 A;  4CYC A;  2CFO A;  2QYO A;  3R0J A;  4EJT A;  1HCR A;  3S2D J;  4RB0 A;  5DCM A;  1QA6 A;  4HEA 2;  4BEH A;  2WAD A;  4HLX A;  4XNF A;  4XLP F;  4J19 A;  3MZY A;  2HVS A;  3WE3 A;  2W5Z A;  4Y7N J;  4AWX B;  4LGW A;  4OIR F;  4U87 A;  3W6J B;  3TKY A;  3HOZ J;  2XGD A;  3F6O A;  1WJ5 A;  2HXO A;  4N9I A;  1NH3 A;  1KA8 A;  2W82 A;  2ZSH B;  3GZ6 A;  4YND A;  2PMU A;  4IRI A;  4CZC A;  2CW7 A;  3GF2 A;  1W5S A;  4YPA A;  3K4J A;  4KIG A;  4BY1 J;  2KIF A;  5B66 C;  2EZL A;  3H35 A;  3GO5 A;  1VND A;  4H12 A;  4M3E A;  2XHK A;  1YOV B;  1FNN A;  2BY0 A;  2Y2Z A;  2ICW G;  1UG0 A;  2FJ1 A;  3WTZ A;  2CMP A;  2R0Q C;  3ZQL A;  1LB2 A;  1MH4 A;  1ETV A;  3MZ8 A;  5B5E C;  3ULQ B;  5GPA A;  1S7A A;  4KMF A;  5HQ8 A;  4HX7 A;  1LKX A;  4CGZ A;  5ARF A;  3RIR A;  4BXF A;  1D5Y A;  1R7J A;  2CWE A;  3WGH A;  5H2F C;  5IT3 A;  3SEZ A;  3ZQC A;  3C2H A;  5IP9 J;  4CHU A;  2P5V A;  5BQT A;  3W3C A;  3H9G A;  3HSE A;  2LD5 A;  2VL8 A;  3J81 Z;  3LSP A;  3DPT A;  1UJ8 A;  1U8R A;  2P4W A;  1G2H A;  4CZZ A;  2KJC A;  1BR2 A;  3F9W A;  1Q1H A;  4AIH A;  3ZCO A;  1LDK B;  4OOI A;  1NG7 A;  2M8G X;  1OQY A;  4U88 A;  3FM3 A;  3TP0 A;  4Z4P A;  3S3N A;  2K9N A;  4Q47 A;  4XOT A;  1R36 A;  2OCE A;  4JX4 A;  3ABK H;  4F92 B;  2RDP A;  3MEX A;  1MBE A;  3F9Y A;  5IYB J;  5TH7 A;  2AO9 A;  5IP7 J;  3IC7 A;  3JAM K;  4UV9 A;  1YJ9 I;  3BC8 A;  2LY9 A;  4ESF A;  1VI0 A;  5K5O A;  2P6S A;  3E6C C;  3ONQ A;  2OPT A;  3VB2 A;  6PAX A;  2GBY A;  4WF2 A;  2F5E A;  4BQO A;  1D8J A;  2JN6 A;  4ZDO A;  3VEP A;  2PJR A;  3QP5 A;  1BJA A;  3HPH A;  1TZL A;  2VON A;  4XLC A;  4KIF A;  4D7M A;  2OUM A;  1OKR A;  3FXO A;  1H8A C;  1HDD C;  2ZBK A;  4HYE A;  5BS6 A;  5FRM A;  4I76 A;  3S1N J;  1BOB A;  3CJR B;  3IWZ A;  4F91 B;  2L9S A;  1Z7U A;  4L9J A;  1K4T A;  1X2N A;  3DEU A;  1SAU A;  4EJU A;  2H27 A;  1SFU A;  3OMY A;  5KJN A;  1B72 A;  1BJZ A;  3SZP A;  3DLL F;  4Z6Y A;  4E47 A;  3MWM A;  1E2X A;  1RZ4 A;  3FXR A;  1WJE A;  2X4H A;  3FM5 A;  2X6Y A;  1RNL A;  1MBJ A;  4I02 A;  4UVC A;  2CV0 A;  3ZQG A;  3I4P A;  2PMZ A;  2A5W A;  5J3L A;  4D0P A;  4Y13 A;  3R0A A;  2M2E A;  3WG7 H;  5E3M A;  4I2O A;  1Z05 A;  1O57 A;  4FE4 A;  4G6D A;  4PJN A;  3ZN1 A;  2PN6 A;  2IA2 A;  4YFX F;  3CTA A;  1FYL A;  4AID A;  5ICC A;  2XPU A;  1K79 A;  4J00 A;  1XB4 A;  2Y9Y A;  5L3G A;  2K3P A;  5E1Z B;  3CBM A;  4FX0 A;  1JGG A;  3J7Z I;  1XSX A;  1E17 A;  2EFO A;  2AQE A;  5TGT A;  3MQ0 A;  2XF7 A;  2KT0 A;  3W2V A;  1U0J A;  3BLY A;  4XLE A;  4XON A;  1VZ0 A;  5J8F A;  2X6X A;  2I10 A;  2KP6 A;  3VYU B;  5EDN A;  1YW9 A;  3A0B C;  1O3R A;  4KFC A;  3PIO F;  2YR2 A;  1ZR2 A;  3JRG A;  2MD5 A;  4YPU A;  4XRM A;  3HOT A;  1J2X A;  1V5G A;  2X0L A;  4L0Y B;  2DMU A;  4M71 A;  3MCZ A;  3G1M A;  4I51 A;  1J7K A;  1FT9 A;  2N8G A;  5HLH A;  4IXA A;  2ELK A;  3UKG A;  4M6X A;  4HAM A;  1U6G A;  5DM6 F;  1KYZ A;  3GTG J;  2DA1 A;  4WXH A;  5JFR A;  3DP7 A;  4HX4 A;  1JKP C;  2F2E A;  1A36 A;  2QQB A;  4FT8 A;  1ON2 A;  3BR6 A;  5H20 A;  1POG A;  2B7E A;  2DOE A;  1V5E A;  2LH9 A;  3CCY A;  3O2P E;  3AL0 B;  3F9X A;  4RB2 C;  2TDX A;  2X1E A;  5JVG F;  1X1D A;  2RAE A;  5F0F A;  1JTX A;  3C18 A;  2V1N A;  1GDT A;  2KRF A;  2L7M P;  1RC9 A;  2NNN A;  4Q5S F;  3AG3 H;  4B3A A;  3TOA A;  4J8O A;  2O3F A;  2KIU A;  3ML6 A;  3GLL A;  1PP8 F;  4HDV A;  3WHB A;  3J80 K;  3IHX A;  4C2M J;  1TLH B;  1DGW Y;  3QWW A;  1R9T J;  2XAG A;  3EP0 A;  1LPQ A;  5DEQ A;  2A05 A;  4GXO A;  3JTG A;  5JHF A;  3BTL A;  2XV4 S;  1MDM B;  3A4C A;  4PJJ A;  4U7B A;  3K4N A;  2UXN A;  1X3U A;  1Y8Q B;  2CO5 A;  3HHH A;  3RZO J;  1HW2 A;  1FMV A;  3QYF A;  3V4G A;  4DZP A;  1W7P D;  3O3K A;  3M7G A;  2E34 A;  2GIV A;  2M7A A;  2VXZ A;  3EUA A;  4D9J A;  2Y0M A;  1AWC A;  1EH8 A;  2HVR A;  3JRI A;  1BBY A;  2LK2 A;  4N9H A;  2W24 A;  4II2 A;  1XDS A;  3PNT A;  4E70 A;  2VB6 A;  3HXL A;  3TG4 A;  2JQ7 A;  5F08 A;  4BBR J;  2V6E A;  1DDN A;  4J7I A;  4LFU A;  2JVH A;  3DU5 A;  1N6A A;  1SVO A;  3J81 K;  3Q3S A;  1TL8 A;  5AIP A;  2TRT A;  4A0Y A;  3EYI A;  4ZJZ A;  3OWT A;  3F8F A;  4ON0 A;  2JA7 J;  2R7V A;  1G3Y A;  3ABM H;  3CF2 A;  3RQI A;  3FIS A;  1MBH A;  2E1M C;  4KUM A;  5ERI A;  3CBO A;  5D4R A;  5JLX A;  3E7L A;  1AKH A;  1XPX A;  3OS2 A;  3FDY A;  1R5H A;  1N25 A;  2B0L A;  3MO0 A;  3PQK A;  3RKW A;  1H0M A;  1IRZ A;  2R3S A;  4HNV A;  1LFP A;  4FTH A;  1U5T C;  3W2W A;  1I5Z A;  1WJA A;  1KON A;  1TNS A;  2WBM A;  2X1C A;  3FWE A;  1W5C C;  3S8P A;  1VQK I;  3M57 A;  4PJL A;  2FSW A;  1N77 A;  3SFI A;  3OIP A;  3EUH C;  2H09 A;  2COB A;  2BXY A;  2Q2E B;  4LJZ F;  4E7Z A;  4P55 A;  3OS1 A;  1LEA A;  2JT1 A;  2VJ5 A;  3P9C A;  4HLY A;  2FMY A;  3DCF A;  3I0T A;  1OLT A;  4KJZ A;  4M74 A;  3K4L A;  4OIO F;  4MEY F;  3NAR A;  2DOA A;  2BHZ A;  2ZSI B;  5H6Q A;  1UEL B;  5E1W A;  4BS9 A;  1U78 A;  4YEJ A; 
#chains in the Genus database with same CATH homology
 3M8J A;  3LFU A;  3MD2 A;  4BDY A;  4BJT A;  2JVG A;  2IS2 A;  2HNH A;  2A6T A;  4AVZ A;  3S32 A;  4BL0 B;  3RIB A;  2BOL A;  2KZV A;  1N3J A;  3HNA A;  3E1S A;  3W2A A;  4XQF A;  5LSX A;  4XKB A;  1X4P A;  1WJF A;  4JQF A;  3CES A;  5LD2 C;  3QYE A;  2OC6 A;  4PJM A;  1S9H A;  3TL4 X;  3NWT A;  2LRD A;  3S7J A;  3OOU A;  1IRX A;  4E7I A;  3C2G A;  3K4C A;  3AKZ A;  2KDO A;  4F52 A;  2QKL B;  2Y0S A;  4IX7 A;  1H3I A;  4ANJ A;  2VAS A;  4E4H A;  2VLA A;  3FPD A;  3VV0 A;  3H5A A;  4EAT A;  2M4K A;  3GBG A;  3VWB A;  3M59 A;  2LY1 A;  1Z21 A;  3DPU A;  2XSJ C;  2X1D A;  3HG9 A;  4IZZ A;  2JV0 A;  3K70 D;  3OYN A;  2BQZ A;  2R7O A;  3MO5 A;  3BCB A;  5T5G A;  4OWR B;  3BO5 A;  4HPQ A;  1QU3 A;  1HA8 A;  3K6G A;  4XR6 A;  2LY2 A;  1ZKK A;  3KMT A;  4LIV A;  4CSW A;  4FMU A;  2M7B A;  4H4K C;  3I9V 2;  2VXD A;  5F6L A;  4ZDP A;  3CBP A;  3K4M A;  3H9Q A;  3DAL A;  3OIQ A;  2R7R A;  4E7S A;  3K70 C;  2R7Q A;  4AYB A;  4BEH B;  5CCM A;  4IQJ A;  2DT7 B;  2F5V A;  2WY8 Q;  4B44 A;  3L2U A;  1MNE A;  4LDG A;  3OYI A;  2F69 A;  1D0Z A;  5CQE A;  4XKV A;  3H0D A;  2KPM A;  4C30 A;  3MO2 A;  1E0E A;  2BVL A;  2E5N A;  3HUG B;  2O8J A;  4BU2 A;  2WAQ A;  2M3A A;  4N4N B;  3IP4 B;  2V26 A;  2IGN A;  3RPU D;  4YEL A;  3VYS B;  3DKX A;  4PK4 A;  3SEQ A;  1N75 A;  4GRI A;  1DP3 A;  3OL4 A;  4BAC A;  4QEP A;  3LSM A;  2IGK A;  3L2V A;  2R7X A;  4NVQ A;  2VQG A;  2WB1 A;  4XOR A;  4RZ0 A;  4XM3 A;  4XN3 A;  2DT6 A;  1MMD A;  3ZGK A;  3ZXS A;  2LOO A;  5HOO A;  2R7U A;  4OAZ A;  2OV7 A;  1QHG A;  5KNL A;  1Y6I A;  1MMN A;  5KJM A;  2W5Y A;  3S7D A;  3A2K A;  1WFX A;  2K9L A;  4XL9 A;  3VYT B;  3OYB A;  1ERD A;  2RNG A;  3OYE A;  4PSW A;  5KHD A;  1P9Q C;  1X4O A;  2BW3 A;  2VQC A;  3D5S C;  4Y3O A;  2ZXH A;  4R79 A;  2W1O A;  4HSR A;  3OYA A;  4DGW B;  4XLF A;  3VDX A;  4RMN A;  2QPW A;  2UWM A;  2CS3 A;  3BG6 A;  4DIQ A;  4ZTF A;  4O30 A;  3L2Q A;  4F93 B;  4D1Q A;  2IS6 A;  1O9S A;  4IJ8 A;  4JOM A;  4BDZ A;  4ZDL A;  3VSL A;  1Z3X A;  3I3L A;  3FHN A;  4BQQ A;  1YX5 A;  2WA0 A;  3DTK A;  3KX2 A;  4NQW B;  3OYD A;  4CA0 A;  2VQH A;  4E6K G;  3DEE A;  2O5R A;  4CCO A;  2WAF A;  2AQF A;  2V9K A;  4C9Y A;  4BE0 A;  2LC2 A;  3QWP A;  4JLG A;  2DCE A;  3LMM A;  4YNM A;  3IAS 2;  2KMU A;  4MI5 A;  4CH7 A;  3N71 A;  2PJR B;  1MVH A;  5TEG A;  2NOJ B;  4LIT A;  4X0G A;  4G6T B;  3OL3 A;  2MD0 A;  3L2R A;  2IS1 A;  3E0J B;  2IGM A;  1WJB A;  3VSK A;  4KIS A;  4NNJ A;  5KJK A;  4RLF A;  3AFH A;  3DKY A;  3H9J A;  2HU9 A;  2XF6 A;  2CFO A;  4HNU A;  4MI0 A;  2VJJ A;  3TG5 A;  2R3A A;  4BE1 A;  1T0F C;  2HPM A;  3LL7 A;  2RQQ A;  4HEA 2;  4KT6 A;  4BEH A;  2WAD A;  1PJR A;  2HZD A;  4XNF A;  2W5Z A;  2HVS A;  3LSH A;  3A1Y A;  4U87 A;  3M5A A;  3OR1 C;  1WJ5 A;  4XKW A;  2W82 A;  2ZSH B;  3DLA A;  2GOX B;  2K9M A;  4YND A;  2CUJ A;  4CZC A;  1R6R A;  2CW7 A;  2KRC A;  3KYL A;  4YPA A;  3D5R C;  3K4J A;  3RTR A;  4BUP A;  5JHN A;  3H35 A;  5JIN A;  4H12 A;  1X1B A;  2MYS A;  1UG0 A;  3HL2 A;  2KL4 A;  2CMP A;  3D5L A;  4MLO A;  1WJC A;  1D1B A;  3PDN A;  3UNG C;  1BR4 A;  3FKJ A;  4NC8 A;  4B47 A;  3S93 A;  5HQ8 A;  2E60 A;  1LKX A;  1Z7L A;  3HC7 A;  5ARF A;  4BXF A;  5KJL A;  2K5C A;  3PJR A;  3SEZ A;  4BJ6 C;  3C2H A;  3VUZ A;  3KEY A;  3ZRG A;  5EX3 A;  1YE9 A;  3MMY B;  3W3C A;  3H9G A;  2JUG A;  5T0M A;  4N4O B;  2VL8 A;  3IUO A;  3S7F A;  3DPT A;  2L9N A;  4QEN A;  2HPI A;  2UV1 A;  3K4K A;  3OYM A;  1UAA A;  2RRE A;  1BR2 A;  2X85 A;  4PFO A;  3F9W A;  1X1C A;  2LYC A;  1LDK B;  4Y4R A;  3ZCO A;  1K6Y A;  1NG7 A;  4Z4P A;  3V42 A;  1MND A;  3S3N A;  2CUZ A;  3MEK A;  3RJW A;  3EPZ A;  4XOT A;  4P1W A;  1N6C A;  4F92 B;  3OS5 A;  3DU6 A;  3SYT A;  3KMA A;  3F9Y A;  2ZXI A;  1XQH A;  5TH7 A;  4YRV A;  4KIT B;  3BC8 A;  4CCL A;  3ONQ A;  3QYB A;  4PFP A;  4E7H A;  3BG7 A;  3OS0 A;  2R7T A;  2VPL A;  4BQO A;  4ZDO A;  2PJR A;  1GLN A;  4C1Q A;  3HPH A;  4HNT A;  1TZL A;  2L7K A;  3PNY A;  4XLC A;  2GOM A;  4WUY A;  2LBF B;  4QPO A;  2OUM A;  1MVX A;  5LSZ A;  1D1C A;  5FRM A;  3J7A Y;  4Y33 A;  4E7L A;  2ZFU A;  1DQU A;  1BOB A;  2X51 A;  3CJR B;  4NC7 A;  4E7J A;  4F91 B;  2L9S A;  2F6C A;  5ARG A;  3SW9 A;  2L2O A;  4ZYA A;  4ZC3 A;  3CP8 A;  2I8D A;  1NG6 A;  1SAU A;  3H5N A;  4PSX A;  3OMY A;  5KJN A;  4BGD A;  2JA2 A;  3M1C A;  4E47 A;  3DTI A;  1WJE A;  1EA3 A;  4J7F A;  3FBN B;  2X6Y A;  2UUZ A;  3M56 A;  4II3 A;  4HRI A;  2MC4 A;  2XF5 A;  2L5Q A;  4LIU A;  2VIX A;  4DBQ A;  2LBF A;  1J09 A;  2Z16 A;  5JIY A;  2CV0 A;  3DB5 A;  4YNP A;  1OR7 C;  2PMZ A;  2A5W A;  2HVQ A;  5HNH A;  3MKZ A;  2V7F A;  4F3Q A;  3OR2 C;  5AYF A;  1T95 A;  2M0M A;  2KQR A;  5FRO A;  3QOE A;  2W00 A;  1MUF A;  4PJN A;  3SWC A;  2QKM B;  5KCM A;  4BQN A;  3QWV A;  3DTE A;  1MMA A;  4FAS D;  3IAM 2;  4J00 A;  3OXL A;  1Z3Y A;  4J01 A;  1PEG A;  2K3P A;  2JSP A;  2DJI A;  2ELJ A;  3QOD A;  4RM3 A;  3CBM A;  5LFA A;  3HKZ A;  2VJ4 A;  4BE2 A;  3OYK A;  2AQE A;  5TGT A;  3MKW B;  2XF7 A;  4XLA A;  1PYV A;  3W2V A;  3BLY A;  1U0J A;  4XLE A;  4XON A;  1MMG A;  2Z1D A;  1VZ0 A;  4FET A;  3ZR8 X;  2X6X A;  2KP6 A;  3VYU B;  2VJI A;  5EX0 A;  4XN0 A;  2X6W A;  2MFZ A;  3RQ4 A;  5CCL A;  3M55 A;  3KMJ A;  3K4B A;  4OAY A;  5F6K C;  3PUB A;  3OOI A;  2VKD A;  3LSG A;  1LVK A;  2IS4 A;  3PFY A;  4YPU A;  4IKF A;  4LG3 A;  3HOT A;  1V5G A;  4CCN A;  3F9K A;  3S7B A;  2E5Z A;  3OPE A;  5FRN A;  2CV1 A;  4I51 A;  4CUG A;  5JJ0 A;  3LSK A;  4IJD A;  5HNF A;  3DWL E;  3G2B A;  3N05 A;  5CQG A;  4O6F A;  5HVQ C;  4BJ5 C;  4PUS A;  1V5E A;  2LH9 A;  3ZQQ A;  2W7N A;  4B48 A;  3AL0 B;  3HPG A;  3F9X A;  4XLH A;  1X19 A;  2X1E A;  2F4I A;  3HOS A;  1FMW A;  2VKH A;  1G59 A;  2G46 A;  3S3M A;  4B43 A;  1X1D A;  1D0X A;  3RU0 A;  3OXG A;  2V1N A;  4JDS A;  2V4J C;  3K10 A;  4RM2 A;  4XMY A;  1AA7 A;  1W36 C;  3F9Z A;  4QPQ A;  3UR3 C;  4J8O A;  1QHH D;  4CCJ A;  1Y56 A;  2WY7 Q;  4XOP A;  3PSI A;  3NWS A;  2WAE A;  4DBR A;  4RLQ A;  3K5K A;  4DJA A;  3IHX A;  3TMO A;  1SFK A;  5HLT A;  3OYL A;  1DGW Y;  4P5O A;  2CV2 A;  4DOZ A;  3OYG A;  3QWW A;  2Q1Z B;  2XDV A;  3EP0 A;  1D0Y A;  4ZTJ A;  5JHF A;  2XC7 A;  4J83 A;  3M53 A;  3A4C A;  3CP2 A;  1YX3 A;  4PJJ A;  4U7B A;  2KLO A;  3K4N A;  3RSN A;  3PNV A;  2BVM A;  1FMV A;  2CH0 A;  3QYF A;  3DQV C;  3OYJ A;  3AL0 C;  2HDW A;  4XKC A;  2IGO A;  3CJQ B;  2M7A A;  2VXZ A;  3EUA A;  4HG2 A;  1N78 A;  4D9J A;  4E7K A;  3TBI A;  5CKT A;  5HI7 A;  5F59 A;  2HVR A;  2LRE A;  2IGQ A;  3CZ6 A;  3FBI B;  4II2 A;  3PNT A;  2IXS A;  3RCO A;  2VB6 A;  3HXL A;  3L2W A;  3TG4 A;  2CW8 A;  3BCA A;  2V6E A;  4CCM A;  4J7I A;  5EG2 A;  3DPL C;  2JVH A;  2HQA A;  3DU5 A;  1JI8 A;  1N6A A;  1WJD A;  1X1A A;  2FUG 2;  4ITV A;  4F55 A;  3RAY A;  4ZJZ A;  1MT6 A;  3CMM A;  3OWT A;  3M54 A;  3PL8 A;  2R7V A;  2W4S A;  3CF2 A;  2MAB A;  2LG4 A;  2E1M C;  5CPR B;  3CBO A;  1ML9 A;  2BW3 B;  4B3X A;  3EUK L;  1TT0 A;  5F5E A;  2P0W A;  3OS2 A;  3FDY A;  4C2T A;  3OYF A;  4C2U A;  3OYC A;  2R4G A;  2M4G A;  1BR1 A;  3SDB A;  3MO0 A;  2RFI A;  1W36 D;  4NJ5 A;  4YPE A;  4QEO A;  2VQL A;  1V5F A;  4HST A;  2E1M B;  2DXI A;  1LFP A;  4AU7 A;  3OYH A;  4CCK A;  5T0K A;  3W2W A;  1WJA A;  1MW7 A;  1KON A;  2WBM A;  2X1C A;  3S8P A;  2KHM A;  4PJL A;  3M57 A;  1G8X A;  1N77 A;  3OIP A;  3EUH C;  2Q2E B;  3SZG A;  4E7Z A;  3OS1 A;  3MKY B;  2VJ5 A;  1D1A A;  3OXF A;  2KRH A;  2XAU A;  3PSF A;  3OY9 A;  4IQ4 A;  1OLT A;  4KJZ A;  4NUB A;  3K4L A;  3M58 A;  3LSI A;  5TTF A;  2DOA A;  1DGR M;  2ZSI B;  3H5R A;  1UEL B;  3S3O A;  3VYR B;  4BS9 A;  2R7W A;  1ZEL A;  3U21 A;  2R7S A;  4YEJ A;  2Z2S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...