3S8PA

Crystal structure of the set domain of human histone-lysine n-methyltransferase suv420h1 in complex with s-adenosyl-l-methionine
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
263
structure length
233
Chain Sequence
b'MSAKELCENDDLATSLVLDPYLGFQTHKMNTRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKEHVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEENMLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYTCERRGTGAFKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase SUV420H1
publication title Crystal structures of the human histone H4K20 methyltransferases SUV420H1 and SUV420H2.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 60
structure length 233
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1700 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3s8pA01
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s8pA02
3DALA 5TH7A 4NJ5A 3RJWA 3TG5A 3S7JA 5CCLA 3OOIA 4YPEA 4H12A 3HNAA 3F9XA 3N71A 1O9SA 3M53A 5LSXA 5AYFA 5JIYA 5EX0A 3IHXA 3S7BA 4FMUA 4YPAA 5KJNA 3OXLA 5JHNA 3OXGA 4QEOA 4JLGA 4QENA 4IJDA 4LDGA 3OXFA 3M57A 4YPUA 5EG2A 4JDSA 4YNDA 3S7FA 3RIBA 4IJ8A 2W5ZA 5KJLA 3M55A 3S8PA 3TG4A 3M56A 3RAYA 1N6CA 4BUPA 3OS5A 3VV0A 3MO5A 4NVQA 5ARGA 3RQ4A 3F9WA 3RU0A 3MO2A 3F9ZA 5F6KC 5T0MA 4AU7A 1ML9A 3FPDA 2R3AA 4J7FA 5KJKA 4J8OA 1N6AA 2JV0A 2RFIA 5T0KA 2QPWA 2W5YA 3PDNA 1MVXA 1ZKKA 4J7IA 3M5AA 1N3JA 5HQ8A 1H3IA 3K5KA 2G46A 3CBOA 4RZ0A 3M58A 4MI0A 3KMJA 2IGQA 3CBMA 4J83A 5LSZA 3BO5A 1MT6A 3F9YA 5F5EA 3QWVA 5EX3A 4YNMA 3KMTA 2F69A 1MVHA 5JINA 2O8JA 3SWCA 3EP0A 3OPEA 5ARFA 1MUFA 3S7DA 5KJMA 5CPRB 3MEKA 3QWPA 5F59A 3MO0A 5HI7A 2BQZA 5F6LA 5CCMA 3VUZA 5T5GA 4YNPA 4QEPA 3M54A 3M59A 3SW9A 4WUYA 4E47A 5JJ0A 3QWWA 4I51A 5TTFA 3CBPA 1XQHA 3KMAA 1PEGA 4Z4PA 5TEGA 4O30A 3DB5A 4O6FA 4MI5A 4C1QA
chains in the Genus database with same CATH superfamily
2CG4A 4F52A 2DI3A 4IRGA 4XLCA 1EH7A 4NJ5A 1SANA 4II2A 4M71A 2CRGA 1UMQA 2VOPA 2X0LA 5HNHA 2M30A 3MFKA 3GEZA 1K7AA 4IHTA 3QOEA 5CJ9A 5JR3A 2VUMJ 2VE8A 4BBSJ 2TDXA 2OF7A 2Z16A 3BJAA 4MTDA 1OR7C 1YHQI 2NS8A 4U87A 4RAFA 2DTRA 2HOSA 4HX7A 2DOEA 1SC7A 2HNHA 3J7YJ 2O5RA 5FLXK 3CUQB 2LC2A 2VB6A 4PZJA 4G6TB 4NC7A 3I56I 1V5EA 2Y75A 3BR3A 2H1KA 3QYEA 2QEXI 2LSOA 1A6IA 1LPQA 2L4MA 5D5UB 5EZHA 1XC5A 4KIGA 2DTZA 3M56A 1U9NA 1YFHA 3FIWA 2F4OB 2FEZA 1N6CA 3HOTA 2JTVA 2D2WA 4PFPA 3RQ4A 3W6VA 4ZYEA 1TBXA 1EA3A 2LY9A 3KETA 1F43A 3BG3A 2GOXB 5TGTA 3P9IA 3EDPA 4CZZA 4XLPF 4FISA 4BQQA 2P81A 1I50J 3BR5A 1OLTA 2GBYA 2HWVA 1X1BA 1ETXA 1IN4A 3AG1H 1R1VA 2K4BA 1FJLA 5GTIC 5C4XJ 2W5YA 3LMMA 2V9VA 3KLOA 4CCOA 3FHNA 2LMDA 3WGIA 4PJ0C 5H20A 2G0EA 4V2GA 3BTIA 3HPGA 1R49A 3MZ8A 1OCPA 4II3A 1Z7UA 4HA8A 2AXTC 3F9YA 3OV8A 1MT6A 4BXUA 5GPAA 2RAEA 3J80K 3KIOA 2O8JA 3EP0A 4BH9A 2P5LC 1V54H 1IN6A 2FOWA 3WG9A 2L3DA 3KE2A 4DJAA 1ZTRA 3CLQA 5L3GA 3M3YJ 4BL0B 2R5YA 1MKMA 2ZO4A 3MEKA 2DA4A 3O8HA 4PDKA 3PFYA 3ZCOA 4BQAA 3SZPA 2E60A 4GYIA 4OIQF 1B1BA 2YX4A 1GV2A 3HOUJ 1SFUA 3B73A 1U8BA 3CF2A 5J6XA 1K6OA 1W4MA 3GO5A 3BCBA 4C30A 4XRMA 4KMFA 3OYKA 1LDDA 2EILH 4XRSG 3QAHA 3DWLE 1O3SA 3I59A 1TW3A 3L7WA 5K7HA 4UVBA 4PJLA 3K70C 1HQCA 4E7SA 2IEKA 2NVYJ 3L1PA 4O30A 3EUKL 2OTLI 1BC7C 4F3QA 1BI3A 2ZJRF 4L9JA 1Y8QB 3OY9A 1IV8A 2E7XA 5D4SA 4CO8A 2KHMA 4I2OA 2XAHA 3MEXA 5DM7F 2M45A 5L3DA 2EV5A 1GUUA 1YX3A 3GUDA 3V8KA 3WTUC 2Z5UA 4B3AA 5D8KB 3OYBA 3GTQJ 5C3EJ 2VJ5A 4E70A 3GZ6A 1A04A 1J0RA 3OXLA 1G2HA 2WV0A 2BY2A 5JLXA 3KLNA 3OOPA 1KZHA 3VODA 5LGTA 4FX0A 4CXFA 5J1RA 2M34A 4G9YA 4BHPA 2DLLA 2H27A 2JK3A 3V4GA 2ZSHB 4HG2A 1KU9A 4QPOA 2ZMEB 5IT3A 3HOXJ 3CCQI 3MAJA 1D8KA 5EEAA 3JREA 3CMEI 2NVTJ 4ZDOA 3TGNA 1I6HJ 1AKHB 3K1PA 2DYRH 2OBPA 3K2AA 1ZYRF 3SEQA 4ZZDA 1DU0A 3K4BA 5AONA 2PI0A 2FNAA 2LY2A 3TEDA 3CUQA 1YITI 2UZKA 3WTZA 1GXPA 3ASNH 5FO5A 4YEJA 1SFEA 4V19K 4LLGF 4HNTA 5HNFA 2DQLA 1XS9A 2K9SA 1FOKA 3DEWA 3M8FA 2G7UA 2XAQA 4PGHA 4EJOA 2VOOA 5FD5A 4LB5A 2JUCA 3BG5A 4D7NA 4UUVA 1XX5A 4UNOA 2CUZA 2Y0MA 2LF8A 2OZ6A 3IHUA 4RDUA 2GM4A 2K9MA 3S15J 2KFDA 1T08B 5EG0B 3QWLA 4GCVA 3VSKA 5ILSA 2RN7A 3CBOA 1OCTC 3K5KA 1SMTA 2L02A 2JA7J 1KU7A 3VPRA 3IV5A 3EUHC 3UR3C 1IC8A 5F5EA 5ILUA 3F8CA 4WF2A 2L9VA 2XRLA 2JA8J 1FTTA 2PX9A 3WHCA 5KHDA 3I55I 4MHGA 4XN3A 1U9OA 2RDPA 5KJMA 2K9LA 3LSJA 2VXZA 2P7VB 1ZGJA 4IPAA 2E5NA 5JLWA 1J59A 3QWPA 2M7BA 4UUSB 3OYGA 2A69F 2VQLA 2A05A 2BXZA 3E6CC 1OCCH 1Z3XA 1HW1A 2M4KA 2FSWA 5LRRA 5ILVA 2JA5J 5K5QA 3FXKA 1ZELA 2DFFA 4J00A 3GTPJ 5FKMA 4E7HA 3U9GA 2Y9ZA 4IHWA 1FYLA 1EH8A 1ONVA 2CH0A 3W2VA 3BOQA 3ML6A 2F5EA 3QPHA 2AXLA 3Q9SA 1AWCA 2W84A 1O3RA 3CDIA 2CV2A 1X3UA 1TWAJ 5DD8A 4PJNA 2NNYA 2Y30A 3PQJA 3D1NI 3SFZA 4L5IA 2HOTA 4XRSA 2QVOA 3HHGA 3FK7A 5E1WA 3CD6I 1T0FA 3E5QA 1JJ8C 2CWEA 4UY8I 4YG2F 4AIJA 1UG2A 4U7BA 2HPMA 2X48A 3OXFA 3JTHA 1MJAA 3CMAI 4YFKF 5LRSA 1PYVA 3HDDA 1OQYA 1LFPA 3K10A 2E2HJ 3F9KA 5B1BH 2EIKH 1FLIA 1VNDA 5CLSA 1UG0A 4A3JJ 4UUTA 3BR6A 3ABTA 4HBLA 5GADJ 1DPUA 5LBQA 4BE0A 4CCMA 4E7LA 4DOZA 1P2FA 4FHTA 4Q47A 1FSEA 4F91B 2LH9A 2VXDA 3RU0A 1TT0A 1XMAA 5TJJA 3CC2I 1JXSA 1VZ0A 5F27A 4ABZA 1JHFA 2ZMEA 2CW7A 4AU7A 1Y1VJ 3HTSB 3JRGA 4M6YA 1QZEA 2EZKA 2LVSA 2IP2A 1TZLA 4LG0A 2ELKA 4CHUA 1HKTA 4MGRA 3ZN1A 3PUBA 2K7LA 3T0YA 1QPMA 4C2TA 1T33A 1VQNI 3M5AA 1RETA 5F6FA 1XGNA 1X3WB 3M58A 4BDZA 1W36D 5DM6F 1TT5B 1J2XA 1S72I 5DD4A 1HDDC 4QWQA 5D5VB 3HTUA 4ZDPA 3SZGA 2E2IJ 4YNMA 5JINA 3RQIA 5TRDA 1IXRC 2CFOA 1LEAA 4A93J 2R7XA 1ENHA 2X1CA 3U21A 3WGGA 2VC1A 5EG0A 2GA2A 3I4NJ 3OYEA 3ESWB 3QYFA 3ERED 4PGGA 1K83J 2JWTA 2Z9OA 1KU3A 2YPRA 2Q0OA 4LIVA 5F6LA 2EQRA 1MD0A 2IBDA 2ISYA 1NG6A 5KK1A 5GAEJ 4S05A 1GDTA 1VTNC 5FKKA 4MQ9F 4OMZA 2B7EA 4WUYA 2ZB9A 3K2ZA 4DYRA 3GWZA 1SVOA 1YE9A 2HGCA 1FMWA 4G12A 3I53A 2V9PA 4KIBA 5DCFA 1V3FA 2ETHA 2Z99A 3L9FA 4Q48A 2LOOA 4R8HA 1T6SA 4Y52J 4N9IA 1KGSA 4UUSA 3S16J 1DDNA 2MYSA 5E3NA 2EH3A 3R6SA 2UV1A 1FX7A 4LMYA 1MJBA 5F64A 4N4OB 2NNNA 3TG5A 1ZRFA 3CUQC 3H92A 1SEUA 4M3FA 2EIJH 2NRAC 1NK2P 1SFOJ 1XGMA 4HDUA 2D45A 4BY1J 4IEJA 3W3CA 5HS8A 1Y39A 1MSEC 5EX0A 1JTYA 3S32A 1W7PB 2K5CA 5F04A 2VKHA 2XGXA 1HXDA 3HRUA 4PCQA 3G71I 4FCYA 3S2WA 2L7KA 5EG2A 1VQ4I 3EYIA 4FQGA 4CGZA 1FPQA 2XHKA 1R36A 1IN8A 1EF4A 3DV8A 4BJTA 1G3WA 4ETSA 4RB1A 4OINF 2HS5A 2MBFA 3VYTB 3RAYA 1XD7A 5EGOB 1X19A 1MMNA 4I0AA 4LFUA 1FC3A 1TQMA 3ZQFA 3P5JA 4P1WA 4AIDA 2GXBA 3WE2A 1SD5A 4A69C 2X1EA 3G4SI 1XSDA 2YU9J 4JYKA 2XIGA 1ZARA 2R92J 3CMYA 4D9JA 3I4MJ 2X4HA 1UB9A 1P6RA 4NC8A 1YW7A 2HYFA 1WCMJ 1FYMA 2XB0X 4M3DA 5M3MJ 2BY1A 1K78B 1VQPI 4IHXA 5F0CA 2DW4A 2QGUA 2JVHA 3F21A 2XC7A 4XLEA 2X51A 4U0VA 2O6GE 1USSA 3CCEI 2Y69H 2W57A 2HVRA 3L00A 3PL8A 3J81Z 2EFOA 3HGYA 3K4LA 3UKGA 2QF7A 5ICGA 1LUJB 1OR7A 3TW6A 4ITVA 1CQTA 2DA5A 2OV7A 1SD6A 3E7LA 4OIPF 4RGXA 1R5HA 3NRVA 5BPDA 3HSRA 2IPQX 3S1MJ 1QQIA 1ZKGA 3HUGB 2DAOA 5FJ8J 2K27A 3MO0A 1HBXG 1SAUA 1T98A 3BR2A 2FNPA 4ZTJA 3GX4X 2HYJA 2R7DA 2JT1A 2EJRA 4GXOA 1Z6RA 3DKYA 1ON1A 1B72A 1XQHA 1MSFC 3K4MA 2F48A 2R7OA 2ZNZA 3ZR8X 3DPTA 3CDHA 3L2RA 3EETA 2FF4A 4E7ZA 1KU2A 3C18A 2DMQA 1YS6A 1ZH5A 1RESA 4EV0A 1ZGAA 4XONA 4I98B 3TDUC 3C2HA 1SD4A 3QPLA 2KIMA 5D8LB 2MLGA 4MIMA 3OOIA 1P7JA 2ZMEC 3ZQGA 2F5FA 2M4GA 4UVCA 5AYFA 2F4IA 2W85A 5JIYA 1E3HA 4MO7A 2HXOA 3DQVC 4EJUA 2FJ1A 5IP6A 2ZKZA 5JHNA 1X1PA 2M2EA 2E1MB 5DDGA 4XQFA 3AL0B 2ZXHA 3Q0UA 2LY1A 2WAQA 4BJ5C 3DTIA 4RM2A 1D1AA 3H3UA 1YIJI 1FIPA 2PJRB 3S17J 2GXAA 2VASA 1W7PA 4BU2A 2V1NA 4M6XA 3S2HJ 4JBAA 3TO7A 4FE7A 2BBYA 4BBRJ 4U7DA 3DCFA 4A5MA 1PDNC 1MW7A 3ROUA 1JKOC 3OIOA 3BQZA 4ZYHA 2CQ7A 3KP7A 3G2BA 1W5TA 4BXXJ 5CKTA 4AM3A 1WJ5A 2LTPA 2LBFB 1YW8A 5JVTA 2R7SA 1SFXA 2VQGA 3RKWA 2CW8A 4AVZA 4ZZLA 3HG9A 1XTAA 2EK5A 2O0YA 1FWZA 3IC7A 4P9FA 1MBFA 5EGOA 2QSHX 2UWMA 2HKXA 5FFZA 4GDFA 4A3GJ 5HODA 1MJ9A 2F4MB 2DT7B 1ULYA 2XAFA 2ZNYA 1YJNI 1WJDA 3ZMZA 1MGTA 2BHYA 4OAZA 1I1SA 3I3LA 4YELA 1BR2A 2HTSA 3CJTB 4BHCA 2WAQN 4HW0A 4IRIA 3A03A 4G6DA 1ZG5A 3QWVA 4I0BA 5K5RA 3ZGKA 3M07A 4HX4A 3QU3A 1DP3A 3CDLA 4DBQA 2M0MA 4PSWA 1R1UA 2QM3A 3ZQQA 2KRHA 3GLXA 3DTKA 3IH3A 2P5KA 5ICEA 1ZN2A 3VSLA 2ECBA 5E17F 1ZG3A 1SVMA 1I6XA 2M1BA 2QSFX 3K69A 2I10A 3FXUA 4RM3A 4EQQA 2D1HA 4YNPA 3L2QA 4G7ZF 2K9NA 3CP2A 1LFBA 1Z6TA 6PAXA 3P9KA 5EEHA 1SFKA 3HIFA 4XIDA 4B4CA 1XDSA 1VI0A 2HFHA 2IA1A 1ORKA 2OQRA 3HUGA 3V8JA 4RLFA 2KZVA 3QYBA 1FIAA 2ME0A 2LG4A 4HZFA 3DKWA 3Q0VA 1F4KA 1TNTA 5JI6A 1U78A 5GAGJ 3RPUA 2STWA 4HOBA 1X58A 3U1KA 3JAMK 1HSJA 4N9HA 4Y17A 3FMSA 3CTAA 5CVRA 4HAMA 1BJZA 4A3BJ 1ZRDA 3AG2H 2E1OA 1IW7F 3KP5A 4P5OA 4ESFA 2CW0F 5DTDA 2KJCA 5DYMA 2EFNA 1Z67A 1YTYA 2FRHA 3FMQA 1O3QA 4YIRX 2A6HF 4JDSA 2M9HA 3DF8A 3E6DA 4HSTA 1KQ8A 4WXHA 2EA2A 3MKYB 3ZQHA 2KDZA 2LLKA 2FMLA 3OYFA 3OR2C 3R60A 3IKTA 4M9SA 5EYRA 2JUGA 3RPQA 2KPMA 4E7JA 3LSHA 2DN0A 2OA4A 5HLHA 3M8EA 5EDNA 4Q5SF 4X6AJ 2GIZA 2W7NA 5H6QA 2ZBKA 1DU6A 1ITYA 4E7KA 4W97A 3SEZA 1R1TA 4KIFA 4XR6A 2PJRA 2VC0A 2WY8Q 4S04A 5T0MA 1I3QJ 4A0ZA 3CMMA 4Y3OA 1A5JA 2F5CA 4J7FA 1BOAA 3CP8A 3KZZA 3JRDA 3ZN0A 1I3AA 1D3YA 1HCRA 2HVSA 1N6AA 2QLZA 2PMUA 3RKYA 3LAPA 2QPWA 3T8RA 1S8NA 3I4PA 1VQ9I 2QA4I 2G46A 2LBFA 5E18F 1KA8A 1IGNA 2CFXA 3A4CA 2NVUB 5TISC 1Y6IA 5IT9Z 3E3VA 4KFCA 1HDPA 5LEKA 4NHJA 2HZTA 3FBNB 2COMA 4NQWA 3DEUA 5J47A 4RAGA 2VONA 4PFOA 2X1DA 5LGUA 3JRFA 3S7DA 3P9CA 4B43A 5CPRB 1BL0A 2ZFUA 3B6AA 4B3XA 3PSIA 2R7ZJ 4E6KG 1A6QA 3K7AJ 4RMNA 3LNQA 2QQAA 1HW5A 3KP3A 4G8XA 2VPLA 3VUZA 3QOPA 3KPHA 1FBQA 3BQYA 4I51A 2GIVA 4ENJA 1B9NA 3IL2A 2DFEA 4E4HA 1RR7A 5FGMA 5TEGA 2YR2A 3C7JA 3DBHB 2BXYA 3QP5A 4F92B 1BOBA 1ZHFA 3OMYA 1JKRC 1R23A 1WGXA 5B66C 2W82A 4XL9A 3WTTC 4HV6A 3M1EA 3RJWA 2JPBA 3V42A 3DXJF 4KN7X 3VFZA 3VYSB 3N71A 4NB5A 4OU0A 3WODF 4YIFA 3W2AA 3GFJA 3MCZA 3LSRA 1V55H 4DZPA 4NBQA 1YQAA 2M5WA 5E79C 3F22A 1R7JA 1JKQC 1RKWA 3G6EI 1RPWA 4LIUA 4A6EA 3PNYA 3WTXC 4IOCF 3OYIA 1Z7LA 2X6WA 3F8FA 4IRHA 2E7WA 3MKWB 3GTMJ 1IRZA 4IJDA 1O7LA 3KP6A 5FRMA 1R5GA 3C1DA 5CVIA 4XK4A 5ICFA 1GVJA 4M3BA 4W1UA 1E3PA 1TWHJ 1A36A 4A3CJ 1W1WE 2Y9YA 1ERDA 1PP8F 2GZWA 2KISA 4DW6A 1H88C 2ZXIA 1TWCJ 1QO0D 3GW2A 4Y4RA 4JP0A 2KKOA 5JVGF 1IXSB 2KLOA 2HQ5A 2FD5A 1HSTA 2K85A 4OOIA 4ZDLA 2CUEA 4PK4A 2R7TA 4H4KC 2P6TA 3PO2J 2JRTA 1STZA 4BNCA 3ELKA 1TTYA 4AYBA 3HPHA 1H8AC 2V1XA 5JFRA 5J40A 5J1YA 3KZIC 4IKFA 4D7MA 3WTSC 2L4AA 4L18B 2JV0A 3PSFA 1LQ1A 1BIBA 2VKDA 3LSPA 5T0KA 4ON0A 2HQNA 3EYYA 4G7OF 4HF2A 1MBEA 3I9V2 2RREA 3ERMA 2MABA 4MEYF 4LLLA 1IUYA 2IGQA 2XF5A 2F2EA 2HI3A 1UELB 1LKXA 3H9JA 4FE4A 2LKSA 4N4NB 4ESBA 3ABKH 3ZOBA 1IJWC 1S3JA 3BG7A 2K3FA 2XV4S 3GBGA 2F5VA 2NVXJ 4P96A 1XMXA 5IYCJ 1LJ9A 1NTCA 3BCAA 4UXNA 4CH7A 1DGWY 4XKBA 2L7MP 1JKPC 5K5OA 3CCLI 1MNEA 3ABLH 2YU3A 1AA7A 2L2OA 2W48A 3OL3A 4OIRF 4A5NA 2I5UA 1OMIA 4WX9A 4MFDA 3K4NA 2YS9A 3M59A 2R4GA 2ID3A 3ZMSA 5HDGA 2IXSA 5JHFA 2CYYA 3H36A 4BHBA 4AYBN 4MFEA 4KJZA 3FZVA 4L9VA 1APLC 5ED4A 2BV6A 3MWMA 5ICCA 1XSXA 5IT9K 4D5CA 5HOOA 1JGSA 2DJNA 3GTGJ 5J8FA 3O2PE 4HEA2 4RB0A 2E1MC 5TH7A 1SVLA 1XB4A 2M87A 4LK1F 5M5XJ 4A3IJ 2VLAA 3AL0C 2DBBA 5D6FA 1GT0C 1IAWA 2QBYB 2JVGA 2VT2A 3O8GA 1FOWA 4ZH4F 1LVAA 3GXOA 4YPEA 2IS6A 3SXYA 4UV9A 1MBHA 5IP9J 1MMDA 1O3TA 5EF6A 1WHUA 3IH2A 1DUXC 2O3FA 5BQTA 2GQQA 3WU1B 2CUFA 2XSDC 1S7AA 2CQQA 1OKRA 1F9NA 2PN6A 2PFBA 1FT9A 3TBIA 3JRAA 3T8TA 3SQNA 2R7VA 5FRNA 2XAJA 2WA0A 3KYCB 3RZOJ 4IJ8A 4XKVA 1DPRA 2E2JJ 3CCSI 5HLIA 2V1UA 2CQKA 5BOXA 3LQRA 5IP7J 3CJQB 3OS5A 3M9AA 2M7AA 4I7HA 2W4SA 2V26A 5K7FA 2LRDA 1ZQ3P 2R3SA 1AOYA 3OR1C 5LEJA 2ZJPF 2NXNB 3RKQA 1RNLA 2MW8A 4OIOF 1ML9A 1U5TB 4QPQA 3FF5A 4LK0F 1B6AA 2W24A 1XMKA 2FU4A 2BEOA 3GLLA 4HQEA 3REOA 1CGPA 1MMGA 2V79A 3WE3A 2LYCA 1OISA 5HVQC 1E17A 3SYTA 4J7IA 5DS9A 4C9YA 3HZJA 1Z9CA 1OPCA 3JSPA 3G73A 4MI0A 4HLXA 4M9XA 3CBMA 2STTA 3TO6A 3FKIJ 3FX3A 2L01A 2RVCA 3RTRA 5BMZA 2BOLA 4BEHB 2VQCA 1RKTA 1E3OC 3QPSA 1MVHA 4IVNA 4X0GA 3TDZC 1OYYA 2H09A 3TP0A 1VQKI 5D5XB 2FQ4A 4O5VA 4QIWN 1W0TA 3H35A 1X3ZB 3BPVA 4XSXF 3E97A 2EFWA 3IAS2 1WJAA 2D5VA 1WJBA 1AKHA 1WI3A 2R0QC 4M3EA 2VT3A 3V7CA 4MQVA 1S5LC 2IRFG 2P0WA 1EV7A 2EWNA 2JPCA 3EUAA 1N75A 4XORA 3DTEA 4UV8A 4C2MJ 4EGYA 2RNGA 2OZUA 2O7OA 3KMAA 2LR8A 3G1LA 2XF7A 2GOMA 3NARA 3CLOA 2ZXWH 2R7WA 3HOWJ 5LD2C 4ASNA 2QQ9A 5IOZA 1GV5A 2JQ7A 3Q9VA 5LHHA 4A12A 2M8GX 1ZG1A 4HNUA 4GYGA 1P7IA 2MD5A 1JUMA 5CCLA 3GTKJ 3F9XA 1S6LA 1D0YA 1B9MA 5LSXA 2KIUA 2DXIA 2HOAA 5F0HA 4G94A 3KYLA 3CZ6A 2HTJA 3G1MA 3GTJJ 3IHXA 3ISPA 4XLFA 3S7BA 1XGSA 2YUSA 2TCTA 1BW5A 4I6ZA 3BTLA 1AU7A 1TC3C 1FY7A 1ZRCA 2F6CA 4JLGA 1QU3A 1B8IB 1WJEA 3ZQ7A 4EVIA 3KFWX 2IGNA 3K4JA 2CSOA 3F8NA 2D1VA 1LVKA 4A0XA 1B4AA 4LJZF 2Q8KA 5KAFC 5FKNA 1JE8A 4RBOA 4DYQA 4ANJA 2KRFA 4GFBA 1M1EB 3FXOA 3GYHX 2Z3YA 3L2VA 2FBHA 3NAUA 2ADUA 4B09A 4Q4ZF 3S1NJ 3C2BA 4ZC3A 4M73A 1YRNB 1P9QC 4XM3A 1IF1A 1VF9A 3FXRA 1RZ4A 2WY7Q 1J7KA 1O57A 4F7ZA 3CO6C 2HOEA 3BLYA 3LAJA 1YW9A 1GXQA 3HOSA 4EGZA 2ZC2A 4RB3C 5F0FA 2XB5A 4EJTA 2Z2SB 5HDKA 3IP4B 2Y31A 2PJPA 3HRMA 1U3EM 4RZ0A 3GFLA 4XN0A 3MQ0A 5KCMA 1W36C 4J83A 5LSZA 4N0BA 5EX3A 1D0ZA 2HVQA 2DMTA 1TW2A 1K6YA 3FMRA 4IHYA 3I5UA 2ZFWA 5J4YA 1YOVB 3M1CA 3HSEA 1WPKA 4CCKA 2M3AA 4IQ4A 1X4PA 3S2DJ 2EZIA 1FSHA 3WTYC 1D1BA 2ICWG 3K1NA 2ZSIB 3R0JA 1HOMA 3CO7C 1QNTA 1JI8A 2HU9A 4BEHA 2DA1A 2COBA 3SFIA 4O6JA 1A35A 3E5UA 4L9TA 4LITA 5TTFA 5DEQA 5LLQA 3CBPA 5D6EA 3F0CA 2DOFA 4HRIA 2AO9A 3DB5A 1TP4A 1JGGA 2ID6A 2VQHA 4EM2A 2IAIA 2W00A 3R4KA 1MBKA 4R79A 4AWXB 2X9DA 5HS7A 4A3LJ 1BBYA 3K4KA 3JAMZ 3ZXSA 1GVDA 5DUKA 4H12A 3S1RJ 3I0TA 1B59A 3CCYA 4IJAA 1YJ9I 2R7FA 2JJ7A 4ENKA 4KA4A 3LWFA 4V2FA 3N97A 5CVUA 5KJNA 5E1ZB 3AKZA 1RI7A 5J4VA 1FTZA 2HXIA 2KZGA 3PM1A 1UHWA 3JR9A 1VQ6I 4QSHA 4EM0B 1I39A 2VL8A 1JT6A 2A5YB 4Y13A 1MH4A 3H5NA 2MH2A 4Z2YA 4YNDA 4BS9A 4HDVA 2QYOA 1WSUA 2ZCWA 3QU6A 3VEPA 4YFXF 3M55A 3BDDA 3LQQA 4I09A 3OYJA 4X1EA 5C4JJ 4RLQA 4FASD 4CUGA 1E0EA 1N25A 5E1XA 3U1DA 4M3GA 3BT9A 1TLHB 3X2QH 5D5WB 1B8IA 1ETQA 4BQNA 2DFIA 5E3OA 1YO5C 4KISA 5F6KC 4CYDA 3KP4A 4U88A 2K02A 1LE8B 4O3MA 2ACJA 2E1CA 1I1GA 2O8KA 5F1JA 3O3KA 2FBKA 4EATA 2PMHA 4J8OA 2XGEA 4A3EJ 2KMUA 2NOGA 4KT5C 5E3LA 1PUFB 4HPQA 4G6QA 4YRVA 1BJAA 2MG4A 2EV6A 2JN6A 3BR1A 3GZ5A 3OWTA 1Y56A 1DP7P 1YRNA 2EA4A 3D5RC 1BM9A 2JA2A 2FA5A 4JQFA 2VODA 1Q1VA 1QVUA 3S1QJ 2F69A 3CCJI 2DPUA 2XDVA 4DNCA 3OPEA 1LEBA 1MNDA 2WC2A 2VBZA 1RUNA 1BI0A 2KJBA 3V8LA 1IN7A 1WH5A 3MD2A 3WU0A 1MMAA 1PJRA 4LLNA 1BN5A 2XRNA 4RB2C 1GLNA 1RC9A 3EQLF 4B47A 2HPIA 3DU5A 5HI7A 4Z6YA 2Y48A 3OIPA 1IG7A 3CC4I 5FLVA 4AIKA 1G6NA 2LNBA 3QPTA 1I5ZA 4KDPA 4WXCA 2PMZA 3TOBA 4U0YA 1G3SA 4WCGA 4J19A 3MKZA 5GP9A 4XLNF 2WTEA 3FXJA 3AAFA 1R4NB 1KQ9A 4MI5A 5H2FC 1Q1HA 1K78A 3BR0A 1Y0NA 2F5DA 1YYVA 1MDMB 3I54A 3ASOH 5FB2A 4KYWA 2DA7A 1T8IA 3TP3A 2HQRA 2MH9A 4FX4A 2B63J 3KEQA 4EMSA 5FD6A 3NEUA 3MMYB 4HLYA 2XKPA 3PNVA 3GTOJ 3LSMA 1V5FA 1G4DA 9ANTA 3H3VK 3ULQB 5K7ZA 4QENA 4LB6B 5KAIC 3M57A 3VWBA 2ESNA 3BPXA 4HF1A 2IGOA 4H0EA 1POGA 2E35A 1QA6A 3TKYA 1FEXA 1OYWA 2BZTA 3HC7A 1TQPA 1U5TC 3OSFA 3V7SA 1A31A 3RIBA 1R00A 2PMZN 3T1BA 4AVPA 1G3YA 2B0LA 2HZDA 3DP7A 3COAC 1CF7B 1RRJA 2MGQA 1H89C 2IGMA 1PUEE 1HA8A 3B02A 1QHGA 2DDBA 1X1DA 3MO5A 3A01B 3GFIA 4K2EA 1QBJA 5FKOA 1VQ7I 4OAYA 4I99C 2KIFA 3CJNA 2L9SA 4M9ZA 2LKPA 1HW2A 2BVLA 2QKMB 2LF7A 2MSYA 4A0YA 2ISZA 3CCMI 3FPDA 1T2KA 1TWGJ 2XUBA 3GZNB 4BDYA 2CS3A 1TNSA 1FBUA 2Q2EB 2VJ4A 1IZ1A 5E8GA 4G7HF 2XPUA 2DJIA 3E5XA 3WGHA 3SZTA 1ETVA 1REPC 3A2KA 2FBIA 5HQ8A 2K40A 1H3IA 1S7EA 2IS4A 3BZKA 2DT5A 4ZYAA 1LE8A 5AIPA 3HOVJ 4EEFG 3IKVA 5B3SH 2WBMA 1OYIA 5FKLA 1W7PD 3H5AA 2RC4A 3D5SC 1HF0A 2PBIA 2VN2A 2G9WA 3LOCA 3I64A 5LHIA 1XCBA 1T95A 3BY6A 1G8XA 3E6MA 1KYZA 1XCVA 1XSVA 3RSNA 2O61A 2KQRA 1XPXA 1X2NA 2DDAA 2ELJA 2ELHA 4HYEA 4AUXA 1RR8C 1D5VA 3PQKA 3BG6A 3QODA 2XROA 5CCMA 2CO5A 2DA2A 3BZCA 4L9NA 1X1CA 3J7AO 3BWGA 2Y0SA 3SW9A 4IF4A 4CICA 1SD7A 5D4RA 3OS2A 2MA3A 3K70D 2EBIA 3Q5FA 1JUPA 2DFHA 3ONQA 4QTRA 1KYWA 4HV5A 3WHBA 5DV5A 3EPZA 3IUOA 4DZJA 1EJ9A 4CDGA 1LNWA 2EFQA 4A3MJ 3CQZJ 1UHMA 4OMYA 1Z05A 2OJED 3N05A 3CJRB 4XMYA 3BJOA 3FM5A 3GF2A 3HHHA 5AIQA 4XKWA 1VQ5I 2X85A 4WK8F 1ZLKA 4C3HJ 2LKXA 4RA2A 2BYVE 1MDMA 3IAM2 3JSOA 2J5OA 2HKOA 2A6TA 3GCMA 4HX8A 5K1YA 1R22A 2CGPA 2WB1A 3GMEA 4YFNF 1UHSA 2RGVA 3PO3J 2W1OA 3ECHA 1WJCA 3PFIA 4XLAA 2E19A 5M5WJ 3HB9A 4NC6A 5LHGA 3S7FA 1IXCA 4F93B 2I8DA 1Z21A 2AHQA 2Y0SN 3U2RA 1LB2A 2W5ZA 5KJLA 1SMYF 5CVVA 1IRXA 1ON2A 4JK1X 4HQMA 3S8PA 4BQOA 2MFZA 3K4CA 4BE2A 1FYKA 1YX5A 4XNFA 3OYMA 3OL4A 2O03A 4A2UA 5JHUA 2V6CA 1KQ0A 1L0OC 2YSRA 1DQUA 2GAUA 3G1OA 2OCCH 4OWRB 3RPUD 1BI2A 3KZYA 4Y7NJ 3OS1A 1JUSA 3HSFA 5FROA 1XDUA 1O4XA 2MLKA 1Z1DA 1IDYA 2LK2A 1CF7A 5KJKA 2IS1A 4A3FJ 3D0SA 2A68F 3A01A 2KIQA 2CV1A 1T38A 2L7ZA 3HL2A 4CCNA 1JTXA 2XASA 3HJEA 2DA3A 2JA6J 3JW4A 3TL4X 3W6JB 2W25A 2XGDA 2NS0A 4XBFA 5CVJA 1EKEA 3KMJA 2Y2ZA 2WB1N 1BR4A 2NAZA 2A3SA 5GPCA 1ETYA 3ZQIA 3BO5A 4CCJA 4A3KJ 2BY0A 2DYSH 2Q2EA 3KMTA 2UXNA 3MZHA 4UB6C 3SWCA 3HYIA 5ARFA 2BE5F 1MUFA 4RGRA 3HOYJ 2XF6A 5M5YJ 2P6SA 1T56A 3KCCA 2BY3A 3HEFA 1FMVA 1U0JA 3VOEA 3BP8A 4BJ6C 5T5GA 2L0KA 1IRGA 3H5RA 3MN2A 3M54A 5M3FJ 1HKSA 3FKJA 3OYNA 5JJ0A 4JOMA 2A5WA 2BVMA 2X6XA 3H0DA 1HC8A 1HLVA 1Z77A 1X4OA 2DMNA 4B1RA 4IOAF 4F55A 3S3NA 3ECOA 4Y33A 1RIOH 1IRFA 2TRTA 3A0HC 1QVTA 4XKCA 3K1MA 4P55A 1JHHA 3ZMVA 1QHHD 1NH3A 3S7JA 2NYXA 2DU9A 4LG0B 2H1LA 2IA2A 1WZ2A 2H6CA 2XPWA 1J09A 3E0JB 1BIAA 5DCMB 2K4JA 4YPAA 3M7GA 3ZRGA 4DBRA 5J8CA 1WI9A 1IN5A 1VQMI 1TL8A 2LP0A 1WH7A 5CYVA 3BC8A 4DQ2A 2PG4A 2BHZA 2XAGA 4L0YB 1IO2A 4D1QA 1WKMA 2LFBA 4LGWA 2AS5F 2BW3B 3PIPF 1E2XA 1R58A 1X2MA 2KT0A 2OUMA 3D5LA 3CCUI 2L7FP 3HRSA 3N4MA 2KL4A 2LDUA 2VBWA 5IOYA 4BKXA 2ZJ2A 3G3ZA 4WXDA 1VFCA 3LSIA 2H6BA 1W0UA 1ZK8A 2QQ8A 2DMPA 4MEXF 2CQXA 2VPRA 4BXFA 4NVQA 4XOTA 4HNVA 2UUZA 3LFKA 5IY5H 3F9WA 2MC4A 3HKZA 3MZYA 3PUFA 1QPIA 1UCRA 4RGUA 2OQGA 3TW7A 1JJ6C 2LD5A 2OPTA 2FUG2 3DBLB 2CMPA 3FISA 4XSZF 4QLCU 2QZ8A 3DEEA 4KNYA 2UXXA 1FP1D 1USTA 1LDJA 3IH4A 3RYPA 5HDNA 4LD5A 4A3DJ 1MVXA 3F72A 1ZKKA 2HEOA 4GRIA 3JRHA 3WTWC 4I01A 3ZMTA 5A2QZ 4I76A 3RI4A 4IO9F 3ABUA 1WWXA 3V7RA 1ZGWA 1IV6A 3A0BC 4IQJA 1W5SA 3F8MA 2WV1A 2XVCA 2HDWA 3VDXA 2RNJA 3FHZA 3SJMA 2IGKA 2VI6A 2A61A 3JTGA 4BE1A 3KEYA 1UZCA 2BQZA 4JX6A 3HKZN 3OS0A 4M74A 3BZ6A 2JZYA 5L3EA 4DIQA 1RUOA 2J5PA 4XICA 4Z4PA 4EM1A 4C3JJ 2FXAA 1UJ8A 3S3MA 4A6DA 1BR1A 4C1QA 1G59A 5LFAA 1OFCX 2L9RA 2E36A 2WAFA 3KYDB 4MNUA 4EJVA 3DLAA 5E8IA 3Q3SA 1OCOH 1Y8RB 3NQOA 1EH6A 3GFMA 3LSTA 3PNTA 5F08A 3WU2C 2DK8A 2V1DA 3E1SA 3HNAA 3LL7A 4S0HB 2K3PA 1Z3YA 3K6GA 2GLOA 2G7HA 2HQAA 3ZP5A 5HLTA 2RKHA 4FMUA 3DKXA 1ZLJA 2MD0A 2HYGD 4AC0A 3FBIB 1QZYA 5CQGA 3NWSA 5CQEA 4I02A 3VYUB 4AIHA 1FOYA 4HSRA 5FFXA 1FZPB 4B44A 3RDIA 1KONA 4RAYA 2CJJA 2EIMH 3PIOF 2AQEA 3PJRA 3LA2A 2RQQA 3SHFA 4E7IA 4PJMA 2DQRA 3OYCA 1MBGA 4IZZA 5DCMA 3HRTA 3JRIA 2IA0A 4IHVA 4Y15A 3CCVI 3LFUA 2JRMA 3CCRI 3DPLC 4ENNA 1FOXA 3J7AY 3WTVC 1P4AA 1H9GA 1HKQA 4FTHA 1K4TA 3RKXA 1VQLI 3M4OJ 2BW3A 2WADA 4CSWA 3C3WA 3LSGA 5BPIA 4GO1A 2KDOA 1L3LA 1B72B 4L0ZB 2P7CB 1S7OA 1H9TA 2QBYA 1N78A 1OJLA 2NS7A 1DGRM 2Z33A 1V4RA 1WQ2A 1NHAA 5EZGA 4JX4A 3A1YA 3OOUA 3RIRA 1R4MB 4DYCA 3OYLA 3RYRA 2NVQJ 3R61A 3OIQA 3K9TA 4M72A 4CZCA 3OSGA 2XSJC 3L09A 5F1RA 2VBYA 2C6YA 2ZXJA 3OYDA 3QRFF 1YIOA 3F3XA 2E34A 3BROA 2VE9A 5IYDJ 1S9HA 4KT6A 4CYCB 5KVRA 3RCOA 1W5CC 1D0XA 5E3MA 4XLHA 2ECCA 4RAZA 1F5TA 2DCEA 4JX5A 2IS2A 3BG9A 2LREA 3A02A 1F36A 1LFUP 1Y1WJ 1FNNA 1YI2I 2YX7A 2JSPA 5J1UA 4XRFA 3P7NA 3F6OA 1YG2A 1U5TA 4UB8C 2OD5A 1VQOI 1QGPA 3W6KB 3E6BA 1YS7A 3DU6A 1NK3P 1PEGA 4XOPA 3AFHA 5A2QK 3O6BB 1F1ZA 3IRQA 2OU2A 3T5XA 3S14J 4C2UA 3LSKA 1X1AA 4M6VA 4AD9A 2A07F 2GWRA 3LA3A 3F23A 5HLGA 1MMSA 4UVAA 2K86A 1BA5A 2FOKA 5B5EC 1O9SA 1C0WA 2XGCA 1FP2A 1XG1A 2VJIA 4PJJA 2DO7A 3FWEA 5C44J 3ZMDA 4ZYGA 3C2GA 1QRYA 3FK6A 2E71A 2KP6A 5GTHC 2CQNA 2RQPA 2V9KA 3S3OA 1J5YA 3TMOA 4QEOA 3H1CA 1K61A 3B6CA 3WG7H 5BS6A 4YPUA 2AQFA 3I71A 2PEXA 3NWTA 3J7ZI 2P8TA 3DLLF 3KX2A 1MH3A 3QQAA 2Z1DA 3SDGA 2PLYA 1MBJA 5L3CA 5EJCA 2V6EA 4ZJZA 3TG4A 5ERIA 3W2WA 4PSXA 2MC3A 4BUPA 1S29A 3HBLA 3H9GA 1OCZH 5BNGA 3MO2A 2QQBA 3F6VA 1MNMC 1J75A 3CC7I 1V5GA 2R7QA 3QP6A 3I58A 1P92A 4KMUX 4L5JA 4BY7J 3KP2A 5L3BA 1R5ID 4NDLA 1PVEA 2VBXA 2QUFA 2L54A 3FXQA 1PP7U 1QZZA 2DK5A 2E5ZA 2N8GA 2QSGX 3GTLJ 2VJJA 1I27A 2B9SA 2O8XA 5B1AH 3RZDJ 1JT0A 2GXGA 2RFIA 2DT6A 1T0FC 3ABMH 2EINH 1ETKA 1IUFA 2BGCA 1IDZA 2DOAA 2L5QA 4D5FA 2OC6A 2PQ8A 3JRBA 3AG4H 2ESHA 2VKEA 1K79A 2A6EF 4D0PA 2H8WA 2H94A 2E1NA 1P4WA 3BJ6A 1ETWA 1TQIA 2L9NA 2R5ZB 5E20A 2CU7A 2R7RA 1D1CA 3IRRA 4RGSA 3BTJA 2QKLB 1R9TJ 2EZHA 1Z0XA 1UAAA 4IL6C 4KN4X 5F59A 5DUIA 3ZPLA 4ZYDA 1ETOA 1GHCA 2HDDA 2O9LA 1YJWI 3KEOA 3HXLA 2V7FA 1Z91A 1OCRH 2CV0A 4E47A 5H6RA 1R6RA 4FT8A 4YIIA 5IPAA 4IX7A 1NG7A 4IXAA 2FX0A 1ZREA 4HF0A 4CYCA 2DODA 4NUBA 5FLXZ 1FBSA 2OCEA 1MZBA 1AHDP 2V4JC 4O6FA 4BAYA 2EZLA 4B48A 3VYRB 3DALA 3HGGA 1YLFA 2FMYA 4MTEA 3FM3A 2R93J 2DMUA 1U2WA 4LOCA 3MVPA 4WWCA 2HDCA 1D5YA 1VQ8I 3M53A 1P4XA 2DA6A 4R1HA 3FDYA 4ZTFA 3DBRB 3MKLA 2X6OA 5L3FA 2R7UA 3RJPA 3DPUA 3HM5A 5KNLA 1Y0UA 1LDKB 3OXGA 3R0AA 2OAZA 2EB7A 3CUOA 5LGNA 2RV8A 1BW6A 4ENMA 4CCLA 4TV7A 4LDGA 4L5EA 5IYBJ 1BI1A 3IWFA 2IVMA 3H0GJ 2HR3A 2NOJB 4NQWB 2ME6A 2FE3A 4FETA 3BTCA 2CUJA 2ZJQF 2EV0A 4CA0A 2Q1ZB 4KICA 4J01A 2X6YA 3CESA 1ZAOA 2FQ3A 4IHSA 3TOAA 1WJFA 4U0WA 3VV0A 4ESJA 1UFMA 5ARGA 2XPVA 4EJWA 3J80Z 3UNGC 3CF5F 3ZMUA 1ODDA 5EEGA 3FXLA 4BGDA 2QCOA 2EFPA 2WWYA 3F9ZA 4GGGA 2WAEA 1WFXA 4LG3A 3S93A 3GVAA 3H9QA 3TO9A 3F8BA 2VKVA 2R3AA 2JSCA 5GAHJ 3M8JA 5HS9A 2M0CA 1R71A 4KUMA 1U6GA 3OYHA 1ZR2A 1TWFJ 1T39A 3L2UA 3L2WA 3PDNA 4BYYA 3OYAA 3LA7A 1ZR4A 2P4WA 1N3JA 2R5YB 2JMWA 3IWZA 3JCUC 4DGWB 2QENA 1J9IA 3ZQLA 1XGOA 1WRJA 5J3LA 1H0MA 2H8RA 2XKOA 3SDBA 4NNJA 4P9UA 4KITB 2OTJI 2IJLA 3J81K 1N77A 1D8JA 3I59B 4C3IJ 2K9QA 1G3TA 3AG3H 3TQNA 1O7FA 2DPDA 1WVRA 3ZQCA 1SAXA 3H3ZA 2EPFA 2QWWA 1XN7A 2VIXA 2GA1A 2IT0A 3Q0WA 4QEPA 4BACA 4MLOA 1MIJA 3JRCA 2R5ZA 4PUSA 4RS8A 3K0LA 3VB2A 3QWWA 4UHTA 1ACIA 5FLMJ 1BC8C 2XAUA 1K4SA 3DFGA 3L2CA 1U8RA 3FXMA 2M8EA 2KRCA 4B8XA 3HOZJ 1PUFA 2IW5A 2P5VA 3EUHA
chains in the Genus database with same CATH topology
4XONA 4F52A 4XLCA 4NJ5A 4XKCA 3C2HA 4II2A 4HNUA 1QHHD 3S7JA 5HNHA 5CCLA 3OOIA 3F9XA 3QOEA 1D0YA 5LSXA 2DXIA 2M4GA 5AYFA 1J09A 2F4IA 3E0JB 3KYLA 2Z16A 3CZ6A 5JIYA 3IHXA 3S7BA 3DQVC 4XLFA 4YPAA 1OR7C 3ZRGA 4DBRA 5JHNA 4U87A 2E1MB 3BC8A 4XQFA 2F6CA 2ZXHA 3AL0B 4JLGA 2HNHA 1QU3A 2O5RA 4D1QA 2LY1A 2WAQA 1WJEA 2LC2A 2VB6A 2BW3B 4G6TB 4NC7A 4BJ5C 3DTIA 1V5EA 4RM2A 2IGNA 1D1AA 2OUMA 3D5LA 3QYEA 3K4JA 2PJRB 1LVKA 2VASA 4BU2A 2V1NA 2KL4A 3M56A 3LSIA 4ANJA 1N6CA 3HOTA 1MW7A 4BXFA 4NVQA 4XOTA 4PFPA 3RQ4A 3L2VA 2UUZA 3F9WA 2MC4A 3HKZA 1EA3A 3G2BA 5CKTA 1WJ5A 2GOXB 2LBFB 4ZC3A 2R7SA 2VQGA 5TGTA 1P9QC 2CW8A 4XM3A 4AVZA 2FUG2 4BQQA 3HG9A 2CMPA 2WY7Q 1OLTA 1X1BA 3DEEA 3BLYA 2UWMA 3HOSA 2W5YA 3LMMA 1MVXA 4CCOA 3FHNA 2DT7B 2Z2SB 3IP4B 1ZKKA 4GRIA 1WJDA 4OAZA 3HPGA 3I3LA 4RZ0A 4YELA 1BR2A 4II3A 4XN0A 5KCMA 1W36C 4J83A 5LSZA 3F9YA 1MT6A 3QWVA 5EX3A 1D0ZA 2HVQA 3ZGKA 2O8JA 1K6YA 3EP0A 4IQJA 1DP3A 2HDWA 3M1CA 4DJAA 4DBQA 3VDXA 4BL0B 2M0MA 4CCKA 4PSWA 2M3AA 3MEKA 2IGKA 1X4PA 3PFYA 4IQ4A 3ZCOA 3ZQQA 2KRHA 3DTKA 4BE1A 3KEYA 2E60A 1D1BA 3VSLA 2ZSIB 2BQZA 1JI8A 2HU9A 4RM3A 3OS0A 4YNPA 4BEHA 3L2QA 3CF2A 3BCBA 4C30A 3CP2A 3OYKA 4LITA 5TTFA 3CBPA 3DWLE 1SFKA 4DIQA 4PJLA 3K70C 4E7SA 4HRIA 4Z4PA 3S3MA 4QENA 4O30A 1BR1A 3EUKL 3DB5A 4F3QA 4RLFA 2KZVA 3QYBA 4C1QA 3OY9A 2VQHA 2LG4A 1G59A 5LFAA 2W00A 4R79A 2KHMA 2WAFA 3DLAA 3PNTA 3K4KA 3ZXSA 4H12A 3E1SA 3HNAA 1YX3A 3LL7A 2K3PA 3OYBA 1Z3YA 3K6GA 2HQAA 2VJ5A 5HLTA 4FMUA 3DKXA 2MD0A 5KJNA 3OXLA 4P5OA 3AKZA 3FBIB 5CQGA 3NWSA 5CQEA 3VYUB 4HSRA 4B44A 2VL8A 1KONA 4JDSA 4HSTA 2ZSHB 2AQEA 3H5NA 4HG2A 4YNDA 3MKYB 3PJRA 4BS9A 2RQQA 4QPOA 4E7IA 4PJMA 3OYFA 3OYCA 4IZZA 3OR2C 3M55A 4ZDOA 3LFUA 2JUGA 2KPMA 4E7JA 3LSHA 3DPLC 3OYJA 4RLQA 3SEQA 4FASD 3J7AY 4CUGA 1E0EA 3K4BA 2W7NA 2LY2A 2BW3A 2WADA 4CSWA 4E7KA 3SEZA 4BQNA 4YEJA 3LSGA 4KISA 4XR6A 2PJRA 4HNTA 2WY8Q 5HNFA 5F6KC 5T0MA 2KDOA 3CMMA 1N78A 4Y3OA 4J7FA 3CP8A 4EATA 1DGRM 4J8OA 2HVSA 2CUZA 2KMUA 4HPQA 1N6AA 2K9MA 2QPWA 4YRVA 3A1YA 3OOUA 3OWTA 3VSKA 3OYLA 1Y56A 2G46A 2LBFA 3CBOA 3K5KA 3OIQA 3D5RC 4CZCA 2JA2A 2XSJC 3A4CA 3EUHC 3UR3C 1Y6IA 4JQFA 5F5EA 3OYDA 3FBNB 2F69A 2XDVA 3OPEA 1MNDA 5KHDA 4PFOA 2X1DA 1S9HA 4XN3A 4KT6A 3S7DA 5KJMA 2K9LA 3MD2A 2VXZA 1MMAA 1PJRA 5CPRB 3RCOA 4B43A 1D0XA 2ZFUA 4XLHA 4B3XA 2DCEA 1GLNA 3PSIA 2E5NA 3QWPA 4B47A 2M7BA 2HPIA 3DU5A 4E6KG 2IS2A 5HI7A 2LREA 3OYGA 4RMNA 2VQLA 3OIPA 2VPLA 3VUZA 1Z3XA 2JSPA 2M4KA 2PMZA 4I51A 1ZELA 4E4HA 3DU6A 4J00A 3MKZA 1PEGA 4XOPA 5TEGA 3AFHA 4E7HA 4MI5A 4C2UA 2CH0A 3LSKA 1X1AA 3W2VA 1BOBA 4F92B 3OMYA 2W82A 4XL9A 3RJWA 3V42A 2CV2A 3VYSB 4PJNA 3N71A 1O9SA 2VJIA 4PJJA 3W2AA 3MMYB 3C2GA 3PNVA 2KP6A 2V9KA 3S3OA 3LSMA 3TMOA 1V5FA 4QEOA 4LIUA 3PNYA 4U7BA 1Z7LA 2X6WA 3OYIA 3MKWB 2HPMA 3OXFA 3M57A 3VWBA 4IJDA 2AQFA 3NWTA 5FRMA 4YPUA 2IGOA 1PYVA 1LFPA 3KX2A 2Z1DA 3K10A 3HC7A 3RIBA 2V6EA 3F9KA 4ZJZA 1UG0A 3TG4A 2HZDA 3W2WA 1ERDA 4PSXA 2IGMA 4BE0A 1HA8A 2ZXIA 4Y4RA 4CCMA 4E7LA 1QHGA 4BUPA 1X1DA 3MO5A 4DOZA 3H9GA 4F91B 2LH9A 2VXDA 4OAYA 2KLOA 3RU0A 1TT0A 2L9SA 3MO2A 1VZ0A 1V5GA 2R7QA 2CW7A 2BVLA 2QKMB 4PK4A 4ZDLA 4AU7A 2R7TA 4H4KC 3FPDA 1TZLA 4AYBA 4BDYA 2CS3A 3HPHA 2Q2EB 2VJ4A 3PUBA 4IKFA 2E5ZA 2DJIA 2VJJA 2JV0A 2RFIA 3PSFA 5T0KA 2VKDA 2DT6A 1T0FC 3A2KA 4C2TA 3M5AA 5HQ8A 1H3IA 2DOAA 3I9V2 2IS4A 2L5QA 2RREA 4ZYAA 2OC6A 3M58A 4BDZA 2MABA 1W36D 2IGQA 5LD2C 2XF5A 2WBMA 1UELB 4ZDPA 3SZGA 1LKXA 3H9JA 3H5AA 3D5SC 4YNMA 5JINA 4N4NB 2L9NA 1T95A 3BG7A 1G8XA 2CFOA 2R7XA 3GBGA 2R7RA 2F5VA 2X1CA 3U21A 3RSNA 1D1CA 2KQRA 3BCAA 4CH7A 2ELJA 3OYEA 1DGWY 2QKLB 3QYFA 4XKBA 1UAAA 1MNEA 3OL3A 1AA7A 2L2OA 5F59A 3BG6A 3QODA 4LIVA 5F6LA 5CCMA 1NG6A 3HXLA 2V7FA 1X1CA 3K4NA 3M59A 2R4GA 2Y0SA 2CV0A 4WUYA 3SW9A 4E47A 3OS2A 1R6RA 4IX7A 2IXSA 5JHFA 1NG7A 1YE9A 3K70D 1FMWA 3ONQA 4KJZA 4NUBA 2LOOA 5HOOA 2V4JC 4O6FA 3EPZA 3IUOA 4HEA2 3VYRB 4B48A 2MYSA 3DALA 2E1MC 5TH7A 2UV1A 2VLAA 3AL0C 4N4OB 3TG5A 2JVGA 3N05A 4YPEA 2IS6A 3M53A 3CJRB 4XMYA 1MMDA 3FDYA 4ZTFA 3W3CA 5EX0A 3S32A 2R7UA 2K5CA 3DPUA 5KNLA 4XKWA 1LDKB 2X85A 2VKHA 3OXGA 3IAM2 2A6TA 4CCLA 4LDGA 2L7KA 2WB1A 5EG2A 3TBIA 2W1OA 1WJCA 4XLAA 3S7FA 2NOJB 4NQWB 2R7VA 4BJTA 5FRNA 4F93B 2I8DA 1Z21A 4FETA 2WA0A 4IJ8A 2W5ZA 5KJLA 2CUJA 1IRXA 4XKVA 3S8PA 4BQOA 2MFZA 2Q1ZB 4CA0A 3K4CA 4J01A 4BE2A 1YX5A 2X6YA 3CESA 4XNFA 3VYTB 3OYMA 3RAYA 3OL4A 3CJQB 1WJFA 3OS5A 3VV0A 1X19A 5ARGA 2M7AA 2W4SA 2V26A 1MMNA 2LRDA 3UNGC 1DQUA 4BGDA 3OR1C 4P1WA 3F9ZA 4OWRB 2WAEA 3RPUD 1WFXA 4LG3A 2X1EA 3S93A 3OS1A 3H9QA 1ML9A 5FROA 4QPQA 2R3AA 4D9JA 3M8JA 5KJKA 2IS1A 3OYHA 4NC8A 3L2UA 2CV1A 1MMGA 3L2WA 3PDNA 2LYCA 3OYAA 5HVQC 4CCNA 3HL2A 3SYTA 4J7IA 1N3JA 2JVHA 3TL4X 4C9YA 2XC7A 4DGWB 4XLEA 2X51A 4MI0A 3KMJA 1BR4A 3CBMA 2HVRA 3BO5A 4CCJA 3PL8A 3RTRA 2BOLA 4BEHB 2VQCA 4NNJA 3SDBA 1MVHA 3K4LA 3KMTA 4KITB 4X0GA 3SWCA 5ARFA 1N77A 1MUFA 4ITVA 3H35A 2OV7A 2XF6A 3IAS2 1WJAA 1WJBA 3HUGB 1FMVA 1U0JA 3MO0A 2VIXA 1SAUA 2P0WA 4BJ6C 5T5GA 3EUAA 4BACA 3H5RA 4MLOA 4QEPA 1N75A 4XORA 4ZTJA 3M54A 3FKJA 3OYNA 3DTEA 4PUSA 5JJ0A 4JOMA 3QWWA 2RNGA 3DKYA 2A5WA 1XQHA 2BVMA 3K4MA 2XAUA 2X6XA 2R7OA 3H0DA 3ZR8X 2XF7A 3DPTA 3L2RA 3KMAA 2GOMA 4E7ZA 1X4OA 2KRCA 2R7WA 4F55A 3S3NA 4Y33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DAL A;  5TH7 A;  4NJ5 A;  3RJW A;  3TG5 A;  3S7J A;  5CCL A;  3OOI A;  4YPE A;  4H12 A;  3HNA A;  3F9X A;  3N71 A;  1O9S A;  3M53 A;  5LSX A;  5AYF A;  5JIY A;  5EX0 A;  3IHX A;  3S7B A;  4FMU A;  4YPA A;  5KJN A;  3OXL A;  5JHN A;  3OXG A;  4QEO A;  4JLG A;  4QEN A;  4IJD A;  4LDG A;  3OXF A;  3M57 A;  4YPU A;  5EG2 A;  4JDS A;  4YND A;  3S7F A;  3RIB A;  4IJ8 A;  2W5Z A;  5KJL A;  3M55 A;  3S8P A;  3TG4 A;  3M56 A;  3RAY A;  1N6C A;  4BUP A;  3OS5 A;  3VV0 A;  3MO5 A;  4NVQ A;  5ARG A;  3RQ4 A;  3F9W A;  3RU0 A;  3MO2 A;  3F9Z A;  5F6K C;  5T0M A;  4AU7 A;  1ML9 A;  3FPD A;  2R3A A;  4J7F A;  5KJK A;  4J8O A;  1N6A A;  2JV0 A;  2RFI A;  5T0K A;  2QPW A;  2W5Y A;  3PDN A;  1MVX A;  1ZKK A;  4J7I A;  3M5A A;  1N3J A;  5HQ8 A;  1H3I A;  3K5K A;  2G46 A;  3CBO A;  4RZ0 A;  3M58 A;  4MI0 A;  3KMJ A;  2IGQ A;  3CBM A;  4J83 A;  5LSZ A;  3BO5 A;  1MT6 A;  3F9Y A;  5F5E A;  3QWV A;  5EX3 A;  4YNM A;  3KMT A;  2F69 A;  1MVH A;  5JIN A;  2O8J A;  3SWC A;  3EP0 A;  3OPE A;  5ARF A;  1MUF A;  3S7D A;  5KJM A;  5CPR B;  3MEK A;  3QWP A;  5F59 A;  3MO0 A;  5HI7 A;  2BQZ A;  5F6L A;  5CCM A;  3VUZ A;  5T5G A;  4YNP A;  4QEP A;  3M54 A;  3M59 A;  3SW9 A;  4WUY A;  4E47 A;  5JJ0 A;  3QWW A;  4I51 A;  5TTF A;  3CBP A;  1XQH A;  3KMA A;  1PEG A;  4Z4P A;  5TEG A;  4O30 A;  3DB5 A;  4O6F A;  4MI5 A;  4C1Q A; 
#chains in the Genus database with same CATH topology
 2CG4 A;  4F52 A;  2DI3 A;  4IRG A;  4XLC A;  1EH7 A;  4NJ5 A;  1SAN A;  4II2 A;  4M71 A;  2CRG A;  1UMQ A;  2VOP A;  2X0L A;  5HNH A;  2M30 A;  3MFK A;  3GEZ A;  1K7A A;  4IHT A;  3QOE A;  5CJ9 A;  5JR3 A;  2VUM J;  2VE8 A;  4BBS J;  2TDX A;  2OF7 A;  2Z16 A;  3BJA A;  4MTD A;  1OR7 C;  1YHQ I;  2NS8 A;  4U87 A;  4RAF A;  2DTR A;  2HOS A;  4HX7 A;  2DOE A;  1SC7 A;  2HNH A;  3J7Y J;  2O5R A;  5FLX K;  3CUQ B;  2LC2 A;  2VB6 A;  4PZJ A;  4G6T B;  4NC7 A;  3I56 I;  1V5E A;  2Y75 A;  3BR3 A;  2H1K A;  3QYE A;  2QEX I;  2LSO A;  1A6I A;  1LPQ A;  2L4M A;  5D5U B;  5EZH A;  1XC5 A;  4KIG A;  2DTZ A;  3M56 A;  1U9N A;  1YFH A;  3FIW A;  2F4O B;  2FEZ A;  1N6C A;  3HOT A;  2JTV A;  2D2W A;  4PFP A;  3RQ4 A;  3W6V A;  4ZYE A;  1TBX A;  1EA3 A;  2LY9 A;  3KET A;  1F43 A;  3BG3 A;  2GOX B;  5TGT A;  3P9I A;  3EDP A;  4CZZ A;  4XLP F;  4FIS A;  4BQQ A;  2P81 A;  1I50 J;  3BR5 A;  1OLT A;  2GBY A;  2HWV A;  1X1B A;  1ETX A;  1IN4 A;  3AG1 H;  1R1V A;  2K4B A;  1FJL A;  5GTI C;  5C4X J;  2W5Y A;  3LMM A;  2V9V A;  3KLO A;  4CCO A;  3FHN A;  2LMD A;  3WGI A;  4PJ0 C;  5H20 A;  2G0E A;  4V2G A;  3BTI A;  3HPG A;  1R49 A;  3MZ8 A;  1OCP A;  4II3 A;  1Z7U A;  4HA8 A;  2AXT C;  3F9Y A;  3OV8 A;  1MT6 A;  4BXU A;  5GPA A;  2RAE A;  3J80 K;  3KIO A;  2O8J A;  3EP0 A;  4BH9 A;  2P5L C;  1V54 H;  1IN6 A;  2FOW A;  3WG9 A;  2L3D A;  3KE2 A;  4DJA A;  1ZTR A;  3CLQ A;  5L3G A;  3M3Y J;  4BL0 B;  2R5Y A;  1MKM A;  2ZO4 A;  3MEK A;  2DA4 A;  3O8H A;  4PDK A;  3PFY A;  3ZCO A;  4BQA A;  3SZP A;  2E60 A;  4GYI A;  4OIQ F;  1B1B A;  2YX4 A;  1GV2 A;  3HOU J;  1SFU A;  3B73 A;  1U8B A;  3CF2 A;  5J6X A;  1K6O A;  1W4M A;  3GO5 A;  3BCB A;  4C30 A;  4XRM A;  4KMF A;  3OYK A;  1LDD A;  2EIL H;  4XRS G;  3QAH A;  3DWL E;  1O3S A;  3I59 A;  1TW3 A;  3L7W A;  5K7H A;  4UVB A;  4PJL A;  3K70 C;  1HQC A;  4E7S A;  2IEK A;  2NVY J;  3L1P A;  4O30 A;  3EUK L;  2OTL I;  1BC7 C;  4F3Q A;  1BI3 A;  2ZJR F;  4L9J A;  1Y8Q B;  3OY9 A;  1IV8 A;  2E7X A;  5D4S A;  4CO8 A;  2KHM A;  4I2O A;  2XAH A;  3MEX A;  5DM7 F;  2M45 A;  5L3D A;  2EV5 A;  1GUU A;  1YX3 A;  3GUD A;  3V8K A;  3WTU C;  2Z5U A;  4B3A A;  5D8K B;  3OYB A;  3GTQ J;  5C3E J;  2VJ5 A;  4E70 A;  3GZ6 A;  1A04 A;  1J0R A;  3OXL A;  1G2H A;  2WV0 A;  2BY2 A;  5JLX A;  3KLN A;  3OOP A;  1KZH A;  3VOD A;  5LGT A;  4FX0 A;  4CXF A;  5J1R A;  2M34 A;  4G9Y A;  4BHP A;  2DLL A;  2H27 A;  2JK3 A;  3V4G A;  2ZSH B;  4HG2 A;  1KU9 A;  4QPO A;  2ZME B;  5IT3 A;  3HOX J;  3CCQ I;  3MAJ A;  1D8K A;  5EEA A;  3JRE A;  3CME I;  2NVT J;  4ZDO A;  3TGN A;  1I6H J;  1AKH B;  3K1P A;  2DYR H;  2OBP A;  3K2A A;  1ZYR F;  3SEQ A;  4ZZD A;  1DU0 A;  3K4B A;  5AON A;  2PI0 A;  2FNA A;  2LY2 A;  3TED A;  3CUQ A;  1YIT I;  2UZK A;  3WTZ A;  1GXP A;  3ASN H;  5FO5 A;  4YEJ A;  1SFE A;  4V19 K;  4LLG F;  4HNT A;  5HNF A;  2DQL A;  1XS9 A;  2K9S A;  1FOK A;  3DEW A;  3M8F A;  2G7U A;  2XAQ A;  4PGH A;  4EJO A;  2VOO A;  5FD5 A;  4LB5 A;  2JUC A;  3BG5 A;  4D7N A;  4UUV A;  1XX5 A;  4UNO A;  2CUZ A;  2Y0M A;  2LF8 A;  2OZ6 A;  3IHU A;  4RDU A;  2GM4 A;  2K9M A;  3S15 J;  2KFD A;  1T08 B;  5EG0 B;  3QWL A;  4GCV A;  3VSK A;  5ILS A;  2RN7 A;  3CBO A;  1OCT C;  3K5K A;  1SMT A;  2L02 A;  2JA7 J;  1KU7 A;  3VPR A;  3IV5 A;  3EUH C;  3UR3 C;  1IC8 A;  5F5E A;  5ILU A;  3F8C A;  4WF2 A;  2L9V A;  2XRL A;  2JA8 J;  1FTT A;  2PX9 A;  3WHC A;  5KHD A;  3I55 I;  4MHG A;  4XN3 A;  1U9O A;  2RDP A;  5KJM A;  2K9L A;  3LSJ A;  2VXZ A;  2P7V B;  1ZGJ A;  4IPA A;  2E5N A;  5JLW A;  1J59 A;  3QWP A;  2M7B A;  4UUS B;  3OYG A;  2A69 F;  2VQL A;  2A05 A;  2BXZ A;  3E6C C;  1OCC H;  1Z3X A;  1HW1 A;  2M4K A;  2FSW A;  5LRR A;  5ILV A;  2JA5 J;  5K5Q A;  3FXK A;  1ZEL A;  2DFF A;  4J00 A;  3GTP J;  5FKM A;  4E7H A;  3U9G A;  2Y9Z A;  4IHW A;  1FYL A;  1EH8 A;  1ONV A;  2CH0 A;  3W2V A;  3BOQ A;  3ML6 A;  2F5E A;  3QPH A;  2AXL A;  3Q9S A;  1AWC A;  2W84 A;  1O3R A;  3CDI A;  2CV2 A;  1X3U A;  1TWA J;  5DD8 A;  4PJN A;  2NNY A;  2Y30 A;  3PQJ A;  3D1N I;  3SFZ A;  4L5I A;  2HOT A;  4XRS A;  2QVO A;  3HHG A;  3FK7 A;  5E1W A;  3CD6 I;  1T0F A;  3E5Q A;  1JJ8 C;  2CWE A;  4UY8 I;  4YG2 F;  4AIJ A;  1UG2 A;  4U7B A;  2HPM A;  2X48 A;  3OXF A;  3JTH A;  1MJA A;  3CMA I;  4YFK F;  5LRS A;  1PYV A;  3HDD A;  1OQY A;  1LFP A;  3K10 A;  2E2H J;  3F9K A;  5B1B H;  2EIK H;  1FLI A;  1VND A;  5CLS A;  1UG0 A;  4A3J J;  4UUT A;  3BR6 A;  3ABT A;  4HBL A;  5GAD J;  1DPU A;  5LBQ A;  4BE0 A;  4CCM A;  4E7L A;  4DOZ A;  1P2F A;  4FHT A;  4Q47 A;  1FSE A;  4F91 B;  2LH9 A;  2VXD A;  3RU0 A;  1TT0 A;  1XMA A;  5TJJ A;  3CC2 I;  1JXS A;  1VZ0 A;  5F27 A;  4ABZ A;  1JHF A;  2ZME A;  2CW7 A;  4AU7 A;  1Y1V J;  3HTS B;  3JRG A;  4M6Y A;  1QZE A;  2EZK A;  2LVS A;  2IP2 A;  1TZL A;  4LG0 A;  2ELK A;  4CHU A;  1HKT A;  4MGR A;  3ZN1 A;  3PUB A;  2K7L A;  3T0Y A;  1QPM A;  4C2T A;  1T33 A;  1VQN I;  3M5A A;  1RET A;  5F6F A;  1XGN A;  1X3W B;  3M58 A;  4BDZ A;  1W36 D;  5DM6 F;  1TT5 B;  1J2X A;  1S72 I;  5DD4 A;  1HDD C;  4QWQ A;  5D5V B;  3HTU A;  4ZDP A;  3SZG A;  2E2I J;  4YNM A;  5JIN A;  3RQI A;  5TRD A;  1IXR C;  2CFO A;  1LEA A;  4A93 J;  2R7X A;  1ENH A;  2X1C A;  3U21 A;  3WGG A;  2VC1 A;  5EG0 A;  2GA2 A;  3I4N J;  3OYE A;  3ESW B;  3QYF A;  3ERE D;  4PGG A;  1K83 J;  2JWT A;  2Z9O A;  1KU3 A;  2YPR A;  2Q0O A;  4LIV A;  5F6L A;  2EQR A;  1MD0 A;  2IBD A;  2ISY A;  1NG6 A;  5KK1 A;  5GAE J;  4S05 A;  1GDT A;  1VTN C;  5FKK A;  4MQ9 F;  4OMZ A;  2B7E A;  4WUY A;  2ZB9 A;  3K2Z A;  4DYR A;  3GWZ A;  1SVO A;  1YE9 A;  2HGC A;  1FMW A;  4G12 A;  3I53 A;  2V9P A;  4KIB A;  5DCF A;  1V3F A;  2ETH A;  2Z99 A;  3L9F A;  4Q48 A;  2LOO A;  4R8H A;  1T6S A;  4Y52 J;  4N9I A;  1KGS A;  4UUS A;  3S16 J;  1DDN A;  2MYS A;  5E3N A;  2EH3 A;  3R6S A;  2UV1 A;  1FX7 A;  4LMY A;  1MJB A;  5F64 A;  4N4O B;  2NNN A;  3TG5 A;  1ZRF A;  3CUQ C;  3H92 A;  1SEU A;  4M3F A;  2EIJ H;  2NRA C;  1NK2 P;  1SFO J;  1XGM A;  4HDU A;  2D45 A;  4BY1 J;  4IEJ A;  3W3C A;  5HS8 A;  1Y39 A;  1MSE C;  5EX0 A;  1JTY A;  3S32 A;  1W7P B;  2K5C A;  5F04 A;  2VKH A;  2XGX A;  1HXD A;  3HRU A;  4PCQ A;  3G71 I;  4FCY A;  3S2W A;  2L7K A;  5EG2 A;  1VQ4 I;  3EYI A;  4FQG A;  4CGZ A;  1FPQ A;  2XHK A;  1R36 A;  1IN8 A;  1EF4 A;  3DV8 A;  4BJT A;  1G3W A;  4ETS A;  4RB1 A;  4OIN F;  2HS5 A;  2MBF A;  3VYT B;  3RAY A;  1XD7 A;  5EGO B;  1X19 A;  1MMN A;  4I0A A;  4LFU A;  1FC3 A;  1TQM A;  3ZQF A;  3P5J A;  4P1W A;  4AID A;  2GXB A;  3WE2 A;  1SD5 A;  4A69 C;  2X1E A;  3G4S I;  1XSD A;  2YU9 J;  4JYK A;  2XIG A;  1ZAR A;  2R92 J;  3CMY A;  4D9J A;  3I4M J;  2X4H A;  1UB9 A;  1P6R A;  4NC8 A;  1YW7 A;  2HYF A;  1WCM J;  1FYM A;  2XB0 X;  4M3D A;  5M3M J;  2BY1 A;  1K78 B;  1VQP I;  4IHX A;  5F0C A;  2DW4 A;  2QGU A;  2JVH A;  3F21 A;  2XC7 A;  4XLE A;  2X51 A;  4U0V A;  2O6G E;  1USS A;  3CCE I;  2Y69 H;  2W57 A;  2HVR A;  3L00 A;  3PL8 A;  3J81 Z;  2EFO A;  3HGY A;  3K4L A;  3UKG A;  2QF7 A;  5ICG A;  1LUJ B;  1OR7 A;  3TW6 A;  4ITV A;  1CQT A;  2DA5 A;  2OV7 A;  1SD6 A;  3E7L A;  4OIP F;  4RGX A;  1R5H A;  3NRV A;  5BPD A;  3HSR A;  2IPQ X;  3S1M J;  1QQI A;  1ZKG A;  3HUG B;  2DAO A;  5FJ8 J;  2K27 A;  3MO0 A;  1HBX G;  1SAU A;  1T98 A;  3BR2 A;  2FNP A;  4ZTJ A;  3GX4 X;  2HYJ A;  2R7D A;  2JT1 A;  2EJR A;  4GXO A;  1Z6R A;  3DKY A;  1ON1 A;  1B72 A;  1XQH A;  1MSF C;  3K4M A;  2F48 A;  2R7O A;  2ZNZ A;  3ZR8 X;  3DPT A;  3CDH A;  3L2R A;  3EET A;  2FF4 A;  4E7Z A;  1KU2 A;  3C18 A;  2DMQ A;  1YS6 A;  1ZH5 A;  1RES A;  4EV0 A;  1ZGA A;  4XON A;  4I98 B;  3TDU C;  3C2H A;  1SD4 A;  3QPL A;  2KIM A;  5D8L B;  2MLG A;  4MIM A;  3OOI A;  1P7J A;  2ZME C;  3ZQG A;  2F5F A;  2M4G A;  4UVC A;  5AYF A;  2F4I A;  2W85 A;  5JIY A;  1E3H A;  4MO7 A;  2HXO A;  3DQV C;  4EJU A;  2FJ1 A;  5IP6 A;  2ZKZ A;  5JHN A;  1X1P A;  2M2E A;  2E1M B;  5DDG A;  4XQF A;  3AL0 B;  2ZXH A;  3Q0U A;  2LY1 A;  2WAQ A;  4BJ5 C;  3DTI A;  4RM2 A;  1D1A A;  3H3U A;  1YIJ I;  1FIP A;  2PJR B;  3S17 J;  2GXA A;  2VAS A;  1W7P A;  4BU2 A;  2V1N A;  4M6X A;  3S2H J;  4JBA A;  3TO7 A;  4FE7 A;  2BBY A;  4BBR J;  4U7D A;  3DCF A;  4A5M A;  1PDN C;  1MW7 A;  3ROU A;  1JKO C;  3OIO A;  3BQZ A;  4ZYH A;  2CQ7 A;  3KP7 A;  3G2B A;  1W5T A;  4BXX J;  5CKT A;  4AM3 A;  1WJ5 A;  2LTP A;  2LBF B;  1YW8 A;  5JVT A;  2R7S A;  1SFX A;  2VQG A;  3RKW A;  2CW8 A;  4AVZ A;  4ZZL A;  3HG9 A;  1XTA A;  2EK5 A;  2O0Y A;  1FWZ A;  3IC7 A;  4P9F A;  1MBF A;  5EGO A;  2QSH X;  2UWM A;  2HKX A;  5FFZ A;  4GDF A;  4A3G J;  5HOD A;  1MJ9 A;  2F4M B;  2DT7 B;  1ULY A;  2XAF A;  2ZNY A;  1YJN I;  1WJD A;  3ZMZ A;  1MGT A;  2BHY A;  4OAZ A;  1I1S A;  3I3L A;  4YEL A;  1BR2 A;  2HTS A;  3CJT B;  4BHC A;  2WAQ N;  4HW0 A;  4IRI A;  3A03 A;  4G6D A;  1ZG5 A;  3QWV A;  4I0B A;  5K5R A;  3ZGK A;  3M07 A;  4HX4 A;  3QU3 A;  1DP3 A;  3CDL A;  4DBQ A;  2M0M A;  4PSW A;  1R1U A;  2QM3 A;  3ZQQ A;  2KRH A;  3GLX A;  3DTK A;  3IH3 A;  2P5K A;  5ICE A;  1ZN2 A;  3VSL A;  2ECB A;  5E17 F;  1ZG3 A;  1SVM A;  1I6X A;  2M1B A;  2QSF X;  3K69 A;  2I10 A;  3FXU A;  4RM3 A;  4EQQ A;  2D1H A;  4YNP A;  3L2Q A;  4G7Z F;  2K9N A;  3CP2 A;  1LFB A;  1Z6T A;  6PAX A;  3P9K A;  5EEH A;  1SFK A;  3HIF A;  4XID A;  4B4C A;  1XDS A;  1VI0 A;  2HFH A;  2IA1 A;  1ORK A;  2OQR A;  3HUG A;  3V8J A;  4RLF A;  2KZV A;  3QYB A;  1FIA A;  2ME0 A;  2LG4 A;  4HZF A;  3DKW A;  3Q0V A;  1F4K A;  1TNT A;  5JI6 A;  1U78 A;  5GAG J;  3RPU A;  2STW A;  4HOB A;  1X58 A;  3U1K A;  3JAM K;  1HSJ A;  4N9H A;  4Y17 A;  3FMS A;  3CTA A;  5CVR A;  4HAM A;  1BJZ A;  4A3B J;  1ZRD A;  3AG2 H;  2E1O A;  1IW7 F;  3KP5 A;  4P5O A;  4ESF A;  2CW0 F;  5DTD A;  2KJC A;  5DYM A;  2EFN A;  1Z67 A;  1YTY A;  2FRH A;  3FMQ A;  1O3Q A;  4YIR X;  2A6H F;  4JDS A;  2M9H A;  3DF8 A;  3E6D A;  4HST A;  1KQ8 A;  4WXH A;  2EA2 A;  3MKY B;  3ZQH A;  2KDZ A;  2LLK A;  2FML A;  3OYF A;  3OR2 C;  3R60 A;  3IKT A;  4M9S A;  5EYR A;  2JUG A;  3RPQ A;  2KPM A;  4E7J A;  3LSH A;  2DN0 A;  2OA4 A;  5HLH A;  3M8E A;  5EDN A;  4Q5S F;  4X6A J;  2GIZ A;  2W7N A;  5H6Q A;  2ZBK A;  1DU6 A;  1ITY A;  4E7K A;  4W97 A;  3SEZ A;  1R1T A;  4KIF A;  4XR6 A;  2PJR A;  2VC0 A;  2WY8 Q;  4S04 A;  5T0M A;  1I3Q J;  4A0Z A;  3CMM A;  4Y3O A;  1A5J A;  2F5C A;  4J7F A;  1BOA A;  3CP8 A;  3KZZ A;  3JRD A;  3ZN0 A;  1I3A A;  1D3Y A;  1HCR A;  2HVS A;  1N6A A;  2QLZ A;  2PMU A;  3RKY A;  3LAP A;  2QPW A;  3T8R A;  1S8N A;  3I4P A;  1VQ9 I;  2QA4 I;  2G46 A;  2LBF A;  5E18 F;  1KA8 A;  1IGN A;  2CFX A;  3A4C A;  2NVU B;  5TIS C;  1Y6I A;  5IT9 Z;  3E3V A;  4KFC A;  1HDP A;  5LEK A;  4NHJ A;  2HZT A;  3FBN B;  2COM A;  4NQW A;  3DEU A;  5J47 A;  4RAG A;  2VON A;  4PFO A;  2X1D A;  5LGU A;  3JRF A;  3S7D A;  3P9C A;  4B43 A;  5CPR B;  1BL0 A;  2ZFU A;  3B6A A;  4B3X A;  3PSI A;  2R7Z J;  4E6K G;  1A6Q A;  3K7A J;  4RMN A;  3LNQ A;  2QQA A;  1HW5 A;  3KP3 A;  4G8X A;  2VPL A;  3VUZ A;  3QOP A;  3KPH A;  1FBQ A;  3BQY A;  4I51 A;  2GIV A;  4ENJ A;  1B9N A;  3IL2 A;  2DFE A;  4E4H A;  1RR7 A;  5FGM A;  5TEG A;  2YR2 A;  3C7J A;  3DBH B;  2BXY A;  3QP5 A;  4F92 B;  1BOB A;  1ZHF A;  3OMY A;  1JKR C;  1R23 A;  1WGX A;  5B66 C;  2W82 A;  4XL9 A;  3WTT C;  4HV6 A;  3M1E A;  3RJW A;  2JPB A;  3V42 A;  3DXJ F;  4KN7 X;  3VFZ A;  3VYS B;  3N71 A;  4NB5 A;  4OU0 A;  3WOD F;  4YIF A;  3W2A A;  3GFJ A;  3MCZ A;  3LSR A;  1V55 H;  4DZP A;  4NBQ A;  1YQA A;  2M5W A;  5E79 C;  3F22 A;  1R7J A;  1JKQ C;  1RKW A;  3G6E I;  1RPW A;  4LIU A;  4A6E A;  3PNY A;  3WTX C;  4IOC F;  3OYI A;  1Z7L A;  2X6W A;  3F8F A;  4IRH A;  2E7W A;  3MKW B;  3GTM J;  1IRZ A;  4IJD A;  1O7L A;  3KP6 A;  5FRM A;  1R5G A;  3C1D A;  5CVI A;  4XK4 A;  5ICF A;  1GVJ A;  4M3B A;  4W1U A;  1E3P A;  1TWH J;  1A36 A;  4A3C J;  1W1W E;  2Y9Y A;  1ERD A;  1PP8 F;  2GZW A;  2KIS A;  4DW6 A;  1H88 C;  2ZXI A;  1TWC J;  1QO0 D;  3GW2 A;  4Y4R A;  4JP0 A;  2KKO A;  5JVG F;  1IXS B;  2KLO A;  2HQ5 A;  2FD5 A;  1HST A;  2K85 A;  4OOI A;  4ZDL A;  2CUE A;  4PK4 A;  2R7T A;  4H4K C;  2P6T A;  3PO2 J;  2JRT A;  1STZ A;  4BNC A;  3ELK A;  1TTY A;  4AYB A;  3HPH A;  1H8A C;  2V1X A;  5JFR A;  5J40 A;  5J1Y A;  3KZI C;  4IKF A;  4D7M A;  3WTS C;  2L4A A;  4L18 B;  2JV0 A;  3PSF A;  1LQ1 A;  1BIB A;  2VKD A;  3LSP A;  5T0K A;  4ON0 A;  2HQN A;  3EYY A;  4G7O F;  4HF2 A;  1MBE A;  3I9V 2;  2RRE A;  3ERM A;  2MAB A;  4MEY F;  4LLL A;  1IUY A;  2IGQ A;  2XF5 A;  2F2E A;  2HI3 A;  1UEL B;  1LKX A;  3H9J A;  4FE4 A;  2LKS A;  4N4N B;  4ESB A;  3ABK H;  3ZOB A;  1IJW C;  1S3J A;  3BG7 A;  2K3F A;  2XV4 S;  3GBG A;  2F5V A;  2NVX J;  4P96 A;  1XMX A;  5IYC J;  1LJ9 A;  1NTC A;  3BCA A;  4UXN A;  4CH7 A;  1DGW Y;  4XKB A;  2L7M P;  1JKP C;  5K5O A;  3CCL I;  1MNE A;  3ABL H;  2YU3 A;  1AA7 A;  2L2O A;  2W48 A;  3OL3 A;  4OIR F;  4A5N A;  2I5U A;  1OMI A;  4WX9 A;  4MFD A;  3K4N A;  2YS9 A;  3M59 A;  2R4G A;  2ID3 A;  3ZMS A;  5HDG A;  2IXS A;  5JHF A;  2CYY A;  3H36 A;  4BHB A;  4AYB N;  4MFE A;  4KJZ A;  3FZV A;  4L9V A;  1APL C;  5ED4 A;  2BV6 A;  3MWM A;  5ICC A;  1XSX A;  5IT9 K;  4D5C A;  5HOO A;  1JGS A;  2DJN A;  3GTG J;  5J8F A;  3O2P E;  4HEA 2;  4RB0 A;  2E1M C;  5TH7 A;  1SVL A;  1XB4 A;  2M87 A;  4LK1 F;  5M5X J;  4A3I J;  2VLA A;  3AL0 C;  2DBB A;  5D6F A;  1GT0 C;  1IAW A;  2QBY B;  2JVG A;  2VT2 A;  3O8G A;  1FOW A;  4ZH4 F;  1LVA A;  3GXO A;  4YPE A;  2IS6 A;  3SXY A;  4UV9 A;  1MBH A;  5IP9 J;  1MMD A;  1O3T A;  5EF6 A;  1WHU A;  3IH2 A;  1DUX C;  2O3F A;  5BQT A;  2GQQ A;  3WU1 B;  2CUF A;  2XSD C;  1S7A A;  2CQQ A;  1OKR A;  1F9N A;  2PN6 A;  2PFB A;  1FT9 A;  3TBI A;  3JRA A;  3T8T A;  3SQN A;  2R7V A;  5FRN A;  2XAJ A;  2WA0 A;  3KYC B;  3RZO J;  4IJ8 A;  4XKV A;  1DPR A;  2E2J J;  3CCS I;  5HLI A;  2V1U A;  2CQK A;  5BOX A;  3LQR A;  5IP7 J;  3CJQ B;  3OS5 A;  3M9A A;  2M7A A;  4I7H A;  2W4S A;  2V26 A;  5K7F A;  2LRD A;  1ZQ3 P;  2R3S A;  1AOY A;  3OR1 C;  5LEJ A;  2ZJP F;  2NXN B;  3RKQ A;  1RNL A;  2MW8 A;  4OIO F;  1ML9 A;  1U5T B;  4QPQ A;  3FF5 A;  4LK0 F;  1B6A A;  2W24 A;  1XMK A;  2FU4 A;  2BEO A;  3GLL A;  4HQE A;  3REO A;  1CGP A;  1MMG A;  2V79 A;  3WE3 A;  2LYC A;  1OIS A;  5HVQ C;  1E17 A;  3SYT A;  4J7I A;  5DS9 A;  4C9Y A;  3HZJ A;  1Z9C A;  1OPC A;  3JSP A;  3G73 A;  4MI0 A;  4HLX A;  4M9X A;  3CBM A;  2STT A;  3TO6 A;  3FKI J;  3FX3 A;  2L01 A;  2RVC A;  3RTR A;  5BMZ A;  2BOL A;  4BEH B;  2VQC A;  1RKT A;  1E3O C;  3QPS A;  1MVH A;  4IVN A;  4X0G A;  3TDZ C;  1OYY A;  2H09 A;  3TP0 A;  1VQK I;  5D5X B;  2FQ4 A;  4O5V A;  4QIW N;  1W0T A;  3H35 A;  1X3Z B;  3BPV A;  4XSX F;  3E97 A;  2EFW A;  3IAS 2;  1WJA A;  2D5V A;  1WJB A;  1AKH A;  1WI3 A;  2R0Q C;  4M3E A;  2VT3 A;  3V7C A;  4MQV A;  1S5L C;  2IRF G;  2P0W A;  1EV7 A;  2EWN A;  2JPC A;  3EUA A;  1N75 A;  4XOR A;  3DTE A;  4UV8 A;  4C2M J;  4EGY A;  2RNG A;  2OZU A;  2O7O A;  3KMA A;  2LR8 A;  3G1L A;  2XF7 A;  2GOM A;  3NAR A;  3CLO A;  2ZXW H;  2R7W A;  3HOW J;  5LD2 C;  4ASN A;  2QQ9 A;  5IOZ A;  1GV5 A;  2JQ7 A;  3Q9V A;  5LHH A;  4A12 A;  2M8G X;  1ZG1 A;  4HNU A;  4GYG A;  1P7I A;  2MD5 A;  1JUM A;  5CCL A;  3GTK J;  3F9X A;  1S6L A;  1D0Y A;  1B9M A;  5LSX A;  2KIU A;  2DXI A;  2HOA A;  5F0H A;  4G94 A;  3KYL A;  3CZ6 A;  2HTJ A;  3G1M A;  3GTJ J;  3IHX A;  3ISP A;  4XLF A;  3S7B A;  1XGS A;  2YUS A;  2TCT A;  1BW5 A;  4I6Z A;  3BTL A;  1AU7 A;  1TC3 C;  1FY7 A;  1ZRC A;  2F6C A;  4JLG A;  1QU3 A;  1B8I B;  1WJE A;  3ZQ7 A;  4EVI A;  3KFW X;  2IGN A;  3K4J A;  2CSO A;  3F8N A;  2D1V A;  1LVK A;  4A0X A;  1B4A A;  4LJZ F;  2Q8K A;  5KAF C;  5FKN A;  1JE8 A;  4RBO A;  4DYQ A;  4ANJ A;  2KRF A;  4GFB A;  1M1E B;  3FXO A;  3GYH X;  2Z3Y A;  3L2V A;  2FBH A;  3NAU A;  2ADU A;  4B09 A;  4Q4Z F;  3S1N J;  3C2B A;  4ZC3 A;  4M73 A;  1YRN B;  1P9Q C;  4XM3 A;  1IF1 A;  1VF9 A;  3FXR A;  1RZ4 A;  2WY7 Q;  1J7K A;  1O57 A;  4F7Z A;  3CO6 C;  2HOE A;  3BLY A;  3LAJ A;  1YW9 A;  1GXQ A;  3HOS A;  4EGZ A;  2ZC2 A;  4RB3 C;  5F0F A;  2XB5 A;  4EJT A;  2Z2S B;  5HDK A;  3IP4 B;  2Y31 A;  2PJP A;  3HRM A;  1U3E M;  4RZ0 A;  3GFL A;  4XN0 A;  3MQ0 A;  5KCM A;  1W36 C;  4J83 A;  5LSZ A;  4N0B A;  5EX3 A;  1D0Z A;  2HVQ A;  2DMT A;  1TW2 A;  1K6Y A;  3FMR A;  4IHY A;  3I5U A;  2ZFW A;  5J4Y A;  1YOV B;  3M1C A;  3HSE A;  1WPK A;  4CCK A;  2M3A A;  4IQ4 A;  1X4P A;  3S2D J;  2EZI A;  1FSH A;  3WTY C;  1D1B A;  2ICW G;  3K1N A;  2ZSI B;  3R0J A;  1HOM A;  3CO7 C;  1QNT A;  1JI8 A;  2HU9 A;  4BEH A;  2DA1 A;  2COB A;  3SFI A;  4O6J A;  1A35 A;  3E5U A;  4L9T A;  4LIT A;  5TTF A;  5DEQ A;  5LLQ A;  3CBP A;  5D6E A;  3F0C A;  2DOF A;  4HRI A;  2AO9 A;  3DB5 A;  1TP4 A;  1JGG A;  2ID6 A;  2VQH A;  4EM2 A;  2IAI A;  2W00 A;  3R4K A;  1MBK A;  4R79 A;  4AWX B;  2X9D A;  5HS7 A;  4A3L J;  1BBY A;  3K4K A;  3JAM Z;  3ZXS A;  1GVD A;  5DUK A;  4H12 A;  3S1R J;  3I0T A;  1B59 A;  3CCY A;  4IJA A;  1YJ9 I;  2R7F A;  2JJ7 A;  4ENK A;  4KA4 A;  3LWF A;  4V2F A;  3N97 A;  5CVU A;  5KJN A;  5E1Z B;  3AKZ A;  1RI7 A;  5J4V A;  1FTZ A;  2HXI A;  2KZG A;  3PM1 A;  1UHW A;  3JR9 A;  1VQ6 I;  4QSH A;  4EM0 B;  1I39 A;  2VL8 A;  1JT6 A;  2A5Y B;  4Y13 A;  1MH4 A;  3H5N A;  2MH2 A;  4Z2Y A;  4YND A;  4BS9 A;  4HDV A;  2QYO A;  1WSU A;  2ZCW A;  3QU6 A;  3VEP A;  4YFX F;  3M55 A;  3BDD A;  3LQQ A;  4I09 A;  3OYJ A;  4X1E A;  5C4J J;  4RLQ A;  4FAS D;  4CUG A;  1E0E A;  1N25 A;  5E1X A;  3U1D A;  4M3G A;  3BT9 A;  1TLH B;  3X2Q H;  5D5W B;  1B8I A;  1ETQ A;  4BQN A;  2DFI A;  5E3O A;  1YO5 C;  4KIS A;  5F6K C;  4CYD A;  3KP4 A;  4U88 A;  2K02 A;  1LE8 B;  4O3M A;  2ACJ A;  2E1C A;  1I1G A;  2O8K A;  5F1J A;  3O3K A;  2FBK A;  4EAT A;  2PMH A;  4J8O A;  2XGE A;  4A3E J;  2KMU A;  2NOG A;  4KT5 C;  5E3L A;  1PUF B;  4HPQ A;  4G6Q A;  4YRV A;  1BJA A;  2MG4 A;  2EV6 A;  2JN6 A;  3BR1 A;  3GZ5 A;  3OWT A;  1Y56 A;  1DP7 P;  1YRN A;  2EA4 A;  3D5R C;  1BM9 A;  2JA2 A;  2FA5 A;  4JQF A;  2VOD A;  1Q1V A;  1QVU A;  3S1Q J;  2F69 A;  3CCJ I;  2DPU A;  2XDV A;  4DNC A;  3OPE A;  1LEB A;  1MND A;  2WC2 A;  2VBZ A;  1RUN A;  1BI0 A;  2KJB A;  3V8L A;  1IN7 A;  1WH5 A;  3MD2 A;  3WU0 A;  1MMA A;  1PJR A;  4LLN A;  1BN5 A;  2XRN A;  4RB2 C;  1GLN A;  1RC9 A;  3EQL F;  4B47 A;  2HPI A;  3DU5 A;  5HI7 A;  4Z6Y A;  2Y48 A;  3OIP A;  1IG7 A;  3CC4 I;  5FLV A;  4AIK A;  1G6N A;  2LNB A;  3QPT A;  1I5Z A;  4KDP A;  4WXC A;  2PMZ A;  3TOB A;  4U0Y A;  1G3S A;  4WCG A;  4J19 A;  3MKZ A;  5GP9 A;  4XLN F;  2WTE A;  3FXJ A;  3AAF A;  1R4N B;  1KQ9 A;  4MI5 A;  5H2F C;  1Q1H A;  1K78 A;  3BR0 A;  1Y0N A;  2F5D A;  1YYV A;  1MDM B;  3I54 A;  3ASO H;  5FB2 A;  4KYW A;  2DA7 A;  1T8I A;  3TP3 A;  2HQR A;  2MH9 A;  4FX4 A;  2B63 J;  3KEQ A;  4EMS A;  5FD6 A;  3NEU A;  3MMY B;  4HLY A;  2XKP A;  3PNV A;  3GTO J;  3LSM A;  1V5F A;  1G4D A;  9ANT A;  3H3V K;  3ULQ B;  5K7Z A;  4QEN A;  4LB6 B;  5KAI C;  3M57 A;  3VWB A;  2ESN A;  3BPX A;  4HF1 A;  2IGO A;  4H0E A;  1POG A;  2E35 A;  1QA6 A;  3TKY A;  1FEX A;  1OYW A;  2BZT A;  3HC7 A;  1TQP A;  1U5T C;  3OSF A;  3V7S A;  1A31 A;  3RIB A;  1R00 A;  2PMZ N;  3T1B A;  4AVP A;  1G3Y A;  2B0L A;  2HZD A;  3DP7 A;  3COA C;  1CF7 B;  1RRJ A;  2MGQ A;  1H89 C;  2IGM A;  1PUE E;  1HA8 A;  3B02 A;  1QHG A;  2DDB A;  1X1D A;  3MO5 A;  3A01 B;  3GFI A;  4K2E A;  1QBJ A;  5FKO A;  1VQ7 I;  4OAY A;  4I99 C;  2KIF A;  3CJN A;  2L9S A;  4M9Z A;  2LKP A;  1HW2 A;  2BVL A;  2QKM B;  2LF7 A;  2MSY A;  4A0Y A;  2ISZ A;  3CCM I;  3FPD A;  1T2K A;  1TWG J;  2XUB A;  3GZN B;  4BDY A;  2CS3 A;  1TNS A;  1FBU A;  2Q2E B;  2VJ4 A;  1IZ1 A;  5E8G A;  4G7H F;  2XPU A;  2DJI A;  3E5X A;  3WGH A;  3SZT A;  1ETV A;  1REP C;  3A2K A;  2FBI A;  5HQ8 A;  2K40 A;  1H3I A;  1S7E A;  2IS4 A;  3BZK A;  2DT5 A;  4ZYA A;  1LE8 A;  5AIP A;  3HOV J;  4EEF G;  3IKV A;  5B3S H;  2WBM A;  1OYI A;  5FKL A;  1W7P D;  3H5A A;  2RC4 A;  3D5S C;  1HF0 A;  2PBI A;  2VN2 A;  2G9W A;  3LOC A;  3I64 A;  5LHI A;  1XCB A;  1T95 A;  3BY6 A;  1G8X A;  3E6M A;  1KYZ A;  1XCV A;  1XSV A;  3RSN A;  2O61 A;  2KQR A;  1XPX A;  1X2N A;  2DDA A;  2ELJ A;  2ELH A;  4HYE A;  4AUX A;  1RR8 C;  1D5V A;  3PQK A;  3BG6 A;  3QOD A;  2XRO A;  5CCM A;  2CO5 A;  2DA2 A;  3BZC A;  4L9N A;  1X1C A;  3J7A O;  3BWG A;  2Y0S A;  3SW9 A;  4IF4 A;  4CIC A;  1SD7 A;  5D4R A;  3OS2 A;  2MA3 A;  3K70 D;  2EBI A;  3Q5F A;  1JUP A;  2DFH A;  3ONQ A;  4QTR A;  1KYW A;  4HV5 A;  3WHB A;  5DV5 A;  3EPZ A;  3IUO A;  4DZJ A;  1EJ9 A;  4CDG A;  1LNW A;  2EFQ A;  4A3M J;  3CQZ J;  1UHM A;  4OMY A;  1Z05 A;  2OJE D;  3N05 A;  3CJR B;  4XMY A;  3BJO A;  3FM5 A;  3GF2 A;  3HHH A;  5AIQ A;  4XKW A;  1VQ5 I;  2X85 A;  4WK8 F;  1ZLK A;  4C3H J;  2LKX A;  4RA2 A;  2BYV E;  1MDM A;  3IAM 2;  3JSO A;  2J5O A;  2HKO A;  2A6T A;  3GCM A;  4HX8 A;  5K1Y A;  1R22 A;  2CGP A;  2WB1 A;  3GME A;  4YFN F;  1UHS A;  2RGV A;  3PO3 J;  2W1O A;  3ECH A;  1WJC A;  3PFI A;  4XLA A;  2E19 A;  5M5W J;  3HB9 A;  4NC6 A;  5LHG A;  3S7F A;  1IXC A;  4F93 B;  2I8D A;  1Z21 A;  2AHQ A;  2Y0S N;  3U2R A;  1LB2 A;  2W5Z A;  5KJL A;  1SMY F;  5CVV A;  1IRX A;  1ON2 A;  4JK1 X;  4HQM A;  3S8P A;  4BQO A;  2MFZ A;  3K4C A;  4BE2 A;  1FYK A;  1YX5 A;  4XNF A;  3OYM A;  3OL4 A;  2O03 A;  4A2U A;  5JHU A;  2V6C A;  1KQ0 A;  1L0O C;  2YSR A;  1DQU A;  2GAU A;  3G1O A;  2OCC H;  4OWR B;  3RPU D;  1BI2 A;  3KZY A;  4Y7N J;  3OS1 A;  1JUS A;  3HSF A;  5FRO A;  1XDU A;  1O4X A;  2MLK A;  1Z1D A;  1IDY A;  2LK2 A;  1CF7 A;  5KJK A;  2IS1 A;  4A3F J;  3D0S A;  2A68 F;  3A01 A;  2KIQ A;  2CV1 A;  1T38 A;  2L7Z A;  3HL2 A;  4CCN A;  1JTX A;  2XAS A;  3HJE A;  2DA3 A;  2JA6 J;  3JW4 A;  3TL4 X;  3W6J B;  2W25 A;  2XGD A;  2NS0 A;  4XBF A;  5CVJ A;  1EKE A;  3KMJ A;  2Y2Z A;  2WB1 N;  1BR4 A;  2NAZ A;  2A3S A;  5GPC A;  1ETY A;  3ZQI A;  3BO5 A;  4CCJ A;  4A3K J;  2BY0 A;  2DYS H;  2Q2E A;  3KMT A;  2UXN A;  3MZH A;  4UB6 C;  3SWC A;  3HYI A;  5ARF A;  2BE5 F;  1MUF A;  4RGR A;  3HOY J;  2XF6 A;  5M5Y J;  2P6S A;  1T56 A;  3KCC A;  2BY3 A;  3HEF A;  1FMV A;  1U0J A;  3VOE A;  3BP8 A;  4BJ6 C;  5T5G A;  2L0K A;  1IRG A;  3H5R A;  3MN2 A;  3M54 A;  5M3F J;  1HKS A;  3FKJ A;  3OYN A;  5JJ0 A;  4JOM A;  2A5W A;  2BVM A;  2X6X A;  3H0D A;  1HC8 A;  1HLV A;  1Z77 A;  1X4O A;  2DMN A;  4B1R A;  4IOA F;  4F55 A;  3S3N A;  3ECO A;  4Y33 A;  1RIO H;  1IRF A;  2TRT A;  3A0H C;  1QVT A;  4XKC A;  3K1M A;  4P55 A;  1JHH A;  3ZMV A;  1QHH D;  1NH3 A;  3S7J A;  2NYX A;  2DU9 A;  4LG0 B;  2H1L A;  2IA2 A;  1WZ2 A;  2H6C A;  2XPW A;  1J09 A;  3E0J B;  1BIA A;  5DCM B;  2K4J A;  4YPA A;  3M7G A;  3ZRG A;  4DBR A;  5J8C A;  1WI9 A;  1IN5 A;  1VQM I;  1TL8 A;  2LP0 A;  1WH7 A;  5CYV A;  3BC8 A;  4DQ2 A;  2PG4 A;  2BHZ A;  2XAG A;  4L0Y B;  1IO2 A;  4D1Q A;  1WKM A;  2LFB A;  4LGW A;  2AS5 F;  2BW3 B;  3PIP F;  1E2X A;  1R58 A;  1X2M A;  2KT0 A;  2OUM A;  3D5L A;  3CCU I;  2L7F P;  3HRS A;  3N4M A;  2KL4 A;  2LDU A;  2VBW A;  5IOY A;  4BKX A;  2ZJ2 A;  3G3Z A;  4WXD A;  1VFC A;  3LSI A;  2H6B A;  1W0U A;  1ZK8 A;  2QQ8 A;  2DMP A;  4MEX F;  2CQX A;  2VPR A;  4BXF A;  4NVQ A;  4XOT A;  4HNV A;  2UUZ A;  3LFK A;  5IY5 H;  3F9W A;  2MC4 A;  3HKZ A;  3MZY A;  3PUF A;  1QPI A;  1UCR A;  4RGU A;  2OQG A;  3TW7 A;  1JJ6 C;  2LD5 A;  2OPT A;  2FUG 2;  3DBL B;  2CMP A;  3FIS A;  4XSZ F;  4QLC U;  2QZ8 A;  3DEE A;  4KNY A;  2UXX A;  1FP1 D;  1UST A;  1LDJ A;  3IH4 A;  3RYP A;  5HDN A;  4LD5 A;  4A3D J;  1MVX A;  3F72 A;  1ZKK A;  2HEO A;  4GRI A;  3JRH A;  3WTW C;  4I01 A;  3ZMT A;  5A2Q Z;  4I76 A;  3RI4 A;  4IO9 F;  3ABU A;  1WWX A;  3V7R A;  1ZGW A;  1IV6 A;  3A0B C;  4IQJ A;  1W5S A;  3F8M A;  2WV1 A;  2XVC A;  2HDW A;  3VDX A;  2RNJ A;  3FHZ A;  3SJM A;  2IGK A;  2VI6 A;  2A61 A;  3JTG A;  4BE1 A;  3KEY A;  1UZC A;  2BQZ A;  4JX6 A;  3HKZ N;  3OS0 A;  4M74 A;  3BZ6 A;  2JZY A;  5L3E A;  4DIQ A;  1RUO A;  2J5P A;  4XIC A;  4Z4P A;  4EM1 A;  4C3J J;  2FXA A;  1UJ8 A;  3S3M A;  4A6D A;  1BR1 A;  4C1Q A;  1G59 A;  5LFA A;  1OFC X;  2L9R A;  2E36 A;  2WAF A;  3KYD B;  4MNU A;  4EJV A;  3DLA A;  5E8I A;  3Q3S A;  1OCO H;  1Y8R B;  3NQO A;  1EH6 A;  3GFM A;  3LST A;  3PNT A;  5F08 A;  3WU2 C;  2DK8 A;  2V1D A;  3E1S A;  3HNA A;  3LL7 A;  4S0H B;  2K3P A;  1Z3Y A;  3K6G A;  2GLO A;  2G7H A;  2HQA A;  3ZP5 A;  5HLT A;  2RKH A;  4FMU A;  3DKX A;  1ZLJ A;  2MD0 A;  2HYG D;  4AC0 A;  3FBI B;  1QZY A;  5CQG A;  3NWS A;  5CQE A;  4I02 A;  3VYU B;  4AIH A;  1FOY A;  4HSR A;  5FFX A;  1FZP B;  4B44 A;  3RDI A;  1KON A;  4RAY A;  2CJJ A;  2EIM H;  3PIO F;  2AQE A;  3PJR A;  3LA2 A;  2RQQ A;  3SHF A;  4E7I A;  4PJM A;  2DQR A;  3OYC A;  1MBG A;  4IZZ A;  5DCM A;  3HRT A;  3JRI A;  2IA0 A;  4IHV A;  4Y15 A;  3CCV I;  3LFU A;  2JRM A;  3CCR I;  3DPL C;  4ENN A;  1FOX A;  3J7A Y;  3WTV C;  1P4A A;  1H9G A;  1HKQ A;  4FTH A;  1K4T A;  3RKX A;  1VQL I;  3M4O J;  2BW3 A;  2WAD A;  4CSW A;  3C3W A;  3LSG A;  5BPI A;  4GO1 A;  2KDO A;  1L3L A;  1B72 B;  4L0Z B;  2P7C B;  1S7O A;  1H9T A;  2QBY A;  1N78 A;  1OJL A;  2NS7 A;  1DGR M;  2Z33 A;  1V4R A;  1WQ2 A;  1NHA A;  5EZG A;  4JX4 A;  3A1Y A;  3OOU A;  3RIR A;  1R4M B;  4DYC A;  3OYL A;  3RYR A;  2NVQ J;  3R61 A;  3OIQ A;  3K9T A;  4M72 A;  4CZC A;  3OSG A;  2XSJ C;  3L09 A;  5F1R A;  2VBY A;  2C6Y A;  2ZXJ A;  3OYD A;  3QRF F;  1YIO A;  3F3X A;  2E34 A;  3BRO A;  2VE9 A;  5IYD J;  1S9H A;  4KT6 A;  4CYC B;  5KVR A;  3RCO A;  1W5C C;  1D0X A;  5E3M A;  4XLH A;  2ECC A;  4RAZ A;  1F5T A;  2DCE A;  4JX5 A;  2IS2 A;  3BG9 A;  2LRE A;  3A02 A;  1F36 A;  1LFU P;  1Y1W J;  1FNN A;  1YI2 I;  2YX7 A;  2JSP A;  5J1U A;  4XRF A;  3P7N A;  3F6O A;  1YG2 A;  1U5T A;  4UB8 C;  2OD5 A;  1VQO I;  1QGP A;  3W6K B;  3E6B A;  1YS7 A;  3DU6 A;  1NK3 P;  1PEG A;  4XOP A;  3AFH A;  5A2Q K;  3O6B B;  1F1Z A;  3IRQ A;  2OU2 A;  3T5X A;  3S14 J;  4C2U A;  3LSK A;  1X1A A;  4M6V A;  4AD9 A;  2A07 F;  2GWR A;  3LA3 A;  3F23 A;  5HLG A;  1MMS A;  4UVA A;  2K86 A;  1BA5 A;  2FOK A;  5B5E C;  1O9S A;  1C0W A;  2XGC A;  1FP2 A;  1XG1 A;  2VJI A;  4PJJ A;  2DO7 A;  3FWE A;  5C44 J;  3ZMD A;  4ZYG A;  3C2G A;  1QRY A;  3FK6 A;  2E71 A;  2KP6 A;  5GTH C;  2CQN A;  2RQP A;  2V9K A;  3S3O A;  1J5Y A;  3TMO A;  4QEO A;  3H1C A;  1K61 A;  3B6C A;  3WG7 H;  5BS6 A;  4YPU A;  2AQF A;  3I71 A;  2PEX A;  3NWT A;  3J7Z I;  2P8T A;  3DLL F;  3KX2 A;  1MH3 A;  3QQA A;  2Z1D A;  3SDG A;  2PLY A;  1MBJ A;  5L3C A;  5EJC A;  2V6E A;  4ZJZ A;  3TG4 A;  5ERI A;  3W2W A;  4PSX A;  2MC3 A;  4BUP A;  1S29 A;  3HBL A;  3H9G A;  1OCZ H;  5BNG A;  3MO2 A;  2QQB A;  3F6V A;  1MNM C;  1J75 A;  3CC7 I;  1V5G A;  2R7Q A;  3QP6 A;  3I58 A;  1P92 A;  4KMU X;  4L5J A;  4BY7 J;  3KP2 A;  5L3B A;  1R5I D;  4NDL A;  1PVE A;  2VBX A;  2QUF A;  2L54 A;  3FXQ A;  1PP7 U;  1QZZ A;  2DK5 A;  2E5Z A;  2N8G A;  2QSG X;  3GTL J;  2VJJ A;  1I27 A;  2B9S A;  2O8X A;  5B1A H;  3RZD J;  1JT0 A;  2GXG A;  2RFI A;  2DT6 A;  1T0F C;  3ABM H;  2EIN H;  1ETK A;  1IUF A;  2BGC A;  1IDZ A;  2DOA A;  2L5Q A;  4D5F A;  2OC6 A;  2PQ8 A;  3JRB A;  3AG4 H;  2ESH A;  2VKE A;  1K79 A;  2A6E F;  4D0P A;  2H8W A;  2H94 A;  2E1N A;  1P4W A;  3BJ6 A;  1ETW A;  1TQI A;  2L9N A;  2R5Z B;  5E20 A;  2CU7 A;  2R7R A;  1D1C A;  3IRR A;  4RGS A;  3BTJ A;  2QKL B;  1R9T J;  2EZH A;  1Z0X A;  1UAA A;  4IL6 C;  4KN4 X;  5F59 A;  5DUI A;  3ZPL A;  4ZYD A;  1ETO A;  1GHC A;  2HDD A;  2O9L A;  1YJW I;  3KEO A;  3HXL A;  2V7F A;  1Z91 A;  1OCR H;  2CV0 A;  4E47 A;  5H6R A;  1R6R A;  4FT8 A;  4YII A;  5IPA A;  4IX7 A;  1NG7 A;  4IXA A;  2FX0 A;  1ZRE A;  4HF0 A;  4CYC A;  2DOD A;  4NUB A;  5FLX Z;  1FBS A;  2OCE A;  1MZB A;  1AHD P;  2V4J C;  4O6F A;  4BAY A;  2EZL A;  4B48 A;  3VYR B;  3DAL A;  3HGG A;  1YLF A;  2FMY A;  4MTE A;  3FM3 A;  2R93 J;  2DMU A;  1U2W A;  4LOC A;  3MVP A;  4WWC A;  2HDC A;  1D5Y A;  1VQ8 I;  3M53 A;  1P4X A;  2DA6 A;  4R1H A;  3FDY A;  4ZTF A;  3DBR B;  3MKL A;  2X6O A;  5L3F A;  2R7U A;  3RJP A;  3DPU A;  3HM5 A;  5KNL A;  1Y0U A;  1LDK B;  3OXG A;  3R0A A;  2OAZ A;  2EB7 A;  3CUO A;  5LGN A;  2RV8 A;  1BW6 A;  4ENM A;  4CCL A;  4TV7 A;  4LDG A;  4L5E A;  5IYB J;  1BI1 A;  3IWF A;  2IVM A;  3H0G J;  2HR3 A;  2NOJ B;  4NQW B;  2ME6 A;  2FE3 A;  4FET A;  3BTC A;  2CUJ A;  2ZJQ F;  2EV0 A;  4CA0 A;  2Q1Z B;  4KIC A;  4J01 A;  2X6Y A;  3CES A;  1ZAO A;  2FQ3 A;  4IHS A;  3TOA A;  1WJF A;  4U0W A;  3VV0 A;  4ESJ A;  1UFM A;  5ARG A;  2XPV A;  4EJW A;  3J80 Z;  3UNG C;  3CF5 F;  3ZMU A;  1ODD A;  5EEG A;  3FXL A;  4BGD A;  2QCO A;  2EFP A;  2WWY A;  3F9Z A;  4GGG A;  2WAE A;  1WFX A;  4LG3 A;  3S93 A;  3GVA A;  3H9Q A;  3TO9 A;  3F8B A;  2VKV A;  2R3A A;  2JSC A;  5GAH J;  3M8J A;  5HS9 A;  2M0C A;  1R71 A;  4KUM A;  1U6G A;  3OYH A;  1ZR2 A;  1TWF J;  1T39 A;  3L2U A;  3L2W A;  3PDN A;  4BYY A;  3OYA A;  3LA7 A;  1ZR4 A;  2P4W A;  1N3J A;  2R5Y B;  2JMW A;  3IWZ A;  3JCU C;  4DGW B;  2QEN A;  1J9I A;  3ZQL A;  1XGO A;  1WRJ A;  5J3L A;  1H0M A;  2H8R A;  2XKO A;  3SDB A;  4NNJ A;  4P9U A;  4KIT B;  2OTJ I;  2IJL A;  3J81 K;  1N77 A;  1D8J A;  3I59 B;  4C3I J;  2K9Q A;  1G3T A;  3AG3 H;  3TQN A;  1O7F A;  2DPD A;  1WVR A;  3ZQC A;  1SAX A;  3H3Z A;  2EPF A;  2QWW A;  1XN7 A;  2VIX A;  2GA1 A;  2IT0 A;  3Q0W A;  4QEP A;  4BAC A;  4MLO A;  1MIJ A;  3JRC A;  2R5Z A;  4PUS A;  4RS8 A;  3K0L A;  3VB2 A;  3QWW A;  4UHT A;  1ACI A;  5FLM J;  1BC8 C;  2XAU A;  1K4S A;  3DFG A;  3L2C A;  1U8R A;  3FXM A;  2M8E A;  2KRC A;  4B8X A;  3HOZ J;  1PUF A;  2IW5 A;  2P5V A;  3EUH A; 
#chains in the Genus database with same CATH homology
 4XON A;  4F52 A;  4XLC A;  4NJ5 A;  4XKC A;  3C2H A;  4II2 A;  4HNU A;  1QHH D;  3S7J A;  5HNH A;  5CCL A;  3OOI A;  3F9X A;  3QOE A;  1D0Y A;  5LSX A;  2DXI A;  2M4G A;  5AYF A;  1J09 A;  2F4I A;  3E0J B;  3KYL A;  2Z16 A;  3CZ6 A;  5JIY A;  3IHX A;  3S7B A;  3DQV C;  4XLF A;  4YPA A;  1OR7 C;  3ZRG A;  4DBR A;  5JHN A;  4U87 A;  2E1M B;  3BC8 A;  4XQF A;  2F6C A;  2ZXH A;  3AL0 B;  4JLG A;  2HNH A;  1QU3 A;  2O5R A;  4D1Q A;  2LY1 A;  2WAQ A;  1WJE A;  2LC2 A;  2VB6 A;  2BW3 B;  4G6T B;  4NC7 A;  4BJ5 C;  3DTI A;  1V5E A;  4RM2 A;  2IGN A;  1D1A A;  2OUM A;  3D5L A;  3QYE A;  3K4J A;  2PJR B;  1LVK A;  2VAS A;  4BU2 A;  2V1N A;  2KL4 A;  3M56 A;  3LSI A;  4ANJ A;  1N6C A;  3HOT A;  1MW7 A;  4BXF A;  4NVQ A;  4XOT A;  4PFP A;  3RQ4 A;  3L2V A;  2UUZ A;  3F9W A;  2MC4 A;  3HKZ A;  1EA3 A;  3G2B A;  5CKT A;  1WJ5 A;  2GOX B;  2LBF B;  4ZC3 A;  2R7S A;  2VQG A;  5TGT A;  1P9Q C;  2CW8 A;  4XM3 A;  4AVZ A;  2FUG 2;  4BQQ A;  3HG9 A;  2CMP A;  2WY7 Q;  1OLT A;  1X1B A;  3DEE A;  3BLY A;  2UWM A;  3HOS A;  2W5Y A;  3LMM A;  1MVX A;  4CCO A;  3FHN A;  2DT7 B;  2Z2S B;  3IP4 B;  1ZKK A;  4GRI A;  1WJD A;  4OAZ A;  3HPG A;  3I3L A;  4RZ0 A;  4YEL A;  1BR2 A;  4II3 A;  4XN0 A;  5KCM A;  1W36 C;  4J83 A;  5LSZ A;  3F9Y A;  1MT6 A;  3QWV A;  5EX3 A;  1D0Z A;  2HVQ A;  3ZGK A;  2O8J A;  1K6Y A;  3EP0 A;  4IQJ A;  1DP3 A;  2HDW A;  3M1C A;  4DJA A;  4DBQ A;  3VDX A;  4BL0 B;  2M0M A;  4CCK A;  4PSW A;  2M3A A;  3MEK A;  2IGK A;  1X4P A;  3PFY A;  4IQ4 A;  3ZCO A;  3ZQQ A;  2KRH A;  3DTK A;  4BE1 A;  3KEY A;  2E60 A;  1D1B A;  3VSL A;  2ZSI B;  2BQZ A;  1JI8 A;  2HU9 A;  4RM3 A;  3OS0 A;  4YNP A;  4BEH A;  3L2Q A;  3CF2 A;  3BCB A;  4C30 A;  3CP2 A;  3OYK A;  4LIT A;  5TTF A;  3CBP A;  3DWL E;  1SFK A;  4DIQ A;  4PJL A;  3K70 C;  4E7S A;  4HRI A;  4Z4P A;  3S3M A;  4QEN A;  4O30 A;  1BR1 A;  3EUK L;  3DB5 A;  4F3Q A;  4RLF A;  2KZV A;  3QYB A;  4C1Q A;  3OY9 A;  2VQH A;  2LG4 A;  1G59 A;  5LFA A;  2W00 A;  4R79 A;  2KHM A;  2WAF A;  3DLA A;  3PNT A;  3K4K A;  3ZXS A;  4H12 A;  3E1S A;  3HNA A;  1YX3 A;  3LL7 A;  2K3P A;  3OYB A;  1Z3Y A;  3K6G A;  2HQA A;  2VJ5 A;  5HLT A;  4FMU A;  3DKX A;  2MD0 A;  5KJN A;  3OXL A;  4P5O A;  3AKZ A;  3FBI B;  5CQG A;  3NWS A;  5CQE A;  3VYU B;  4HSR A;  4B44 A;  2VL8 A;  1KON A;  4JDS A;  4HST A;  2ZSH B;  2AQE A;  3H5N A;  4HG2 A;  4YND A;  3MKY B;  3PJR A;  4BS9 A;  2RQQ A;  4QPO A;  4E7I A;  4PJM A;  3OYF A;  3OYC A;  4IZZ A;  3OR2 C;  3M55 A;  4ZDO A;  3LFU A;  2JUG A;  2KPM A;  4E7J A;  3LSH A;  3DPL C;  3OYJ A;  4RLQ A;  3SEQ A;  4FAS D;  3J7A Y;  4CUG A;  1E0E A;  3K4B A;  2W7N A;  2LY2 A;  2BW3 A;  2WAD A;  4CSW A;  4E7K A;  3SEZ A;  4BQN A;  4YEJ A;  3LSG A;  4KIS A;  4XR6 A;  2PJR A;  4HNT A;  2WY8 Q;  5HNF A;  5F6K C;  5T0M A;  2KDO A;  3CMM A;  1N78 A;  4Y3O A;  4J7F A;  3CP8 A;  4EAT A;  1DGR M;  4J8O A;  2HVS A;  2CUZ A;  2KMU A;  4HPQ A;  1N6A A;  2K9M A;  2QPW A;  4YRV A;  3A1Y A;  3OOU A;  3OWT A;  3VSK A;  3OYL A;  1Y56 A;  2G46 A;  2LBF A;  3CBO A;  3K5K A;  3OIQ A;  3D5R C;  4CZC A;  2JA2 A;  2XSJ C;  3A4C A;  3EUH C;  3UR3 C;  1Y6I A;  4JQF A;  5F5E A;  3OYD A;  3FBN B;  2F69 A;  2XDV A;  3OPE A;  1MND A;  5KHD A;  4PFO A;  2X1D A;  1S9H A;  4XN3 A;  4KT6 A;  3S7D A;  5KJM A;  2K9L A;  3MD2 A;  2VXZ A;  1MMA A;  1PJR A;  5CPR B;  3RCO A;  4B43 A;  1D0X A;  2ZFU A;  4XLH A;  4B3X A;  2DCE A;  1GLN A;  3PSI A;  2E5N A;  3QWP A;  4B47 A;  2M7B A;  2HPI A;  3DU5 A;  4E6K G;  2IS2 A;  5HI7 A;  2LRE A;  3OYG A;  4RMN A;  2VQL A;  3OIP A;  2VPL A;  3VUZ A;  1Z3X A;  2JSP A;  2M4K A;  2PMZ A;  4I51 A;  1ZEL A;  4E4H A;  3DU6 A;  4J00 A;  3MKZ A;  1PEG A;  4XOP A;  5TEG A;  3AFH A;  4E7H A;  4MI5 A;  4C2U A;  2CH0 A;  3LSK A;  1X1A A;  3W2V A;  1BOB A;  4F92 B;  3OMY A;  2W82 A;  4XL9 A;  3RJW A;  3V42 A;  2CV2 A;  3VYS B;  4PJN A;  3N71 A;  1O9S A;  2VJI A;  4PJJ A;  3W2A A;  3MMY B;  3C2G A;  3PNV A;  2KP6 A;  2V9K A;  3S3O A;  3LSM A;  3TMO A;  1V5F A;  4QEO A;  4LIU A;  3PNY A;  4U7B A;  1Z7L A;  2X6W A;  3OYI A;  3MKW B;  2HPM A;  3OXF A;  3M57 A;  3VWB A;  4IJD A;  2AQF A;  3NWT A;  5FRM A;  4YPU A;  2IGO A;  1PYV A;  1LFP A;  3KX2 A;  2Z1D A;  3K10 A;  3HC7 A;  3RIB A;  2V6E A;  3F9K A;  4ZJZ A;  1UG0 A;  3TG4 A;  2HZD A;  3W2W A;  1ERD A;  4PSX A;  2IGM A;  4BE0 A;  1HA8 A;  2ZXI A;  4Y4R A;  4CCM A;  4E7L A;  1QHG A;  4BUP A;  1X1D A;  3MO5 A;  4DOZ A;  3H9G A;  4F91 B;  2LH9 A;  2VXD A;  4OAY A;  2KLO A;  3RU0 A;  1TT0 A;  2L9S A;  3MO2 A;  1VZ0 A;  1V5G A;  2R7Q A;  2CW7 A;  2BVL A;  2QKM B;  4PK4 A;  4ZDL A;  4AU7 A;  2R7T A;  4H4K C;  3FPD A;  1TZL A;  4AYB A;  4BDY A;  2CS3 A;  3HPH A;  2Q2E B;  2VJ4 A;  3PUB A;  4IKF A;  2E5Z A;  2DJI A;  2VJJ A;  2JV0 A;  2RFI A;  3PSF A;  5T0K A;  2VKD A;  2DT6 A;  1T0F C;  3A2K A;  4C2T A;  3M5A A;  5HQ8 A;  1H3I A;  2DOA A;  3I9V 2;  2IS4 A;  2L5Q A;  2RRE A;  4ZYA A;  2OC6 A;  3M58 A;  4BDZ A;  2MAB A;  1W36 D;  2IGQ A;  5LD2 C;  2XF5 A;  2WBM A;  1UEL B;  4ZDP A;  3SZG A;  1LKX A;  3H9J A;  3H5A A;  3D5S C;  4YNM A;  5JIN A;  4N4N B;  2L9N A;  1T95 A;  3BG7 A;  1G8X A;  2CFO A;  2R7X A;  3GBG A;  2R7R A;  2F5V A;  2X1C A;  3U21 A;  3RSN A;  1D1C A;  2KQR A;  3BCA A;  4CH7 A;  2ELJ A;  3OYE A;  1DGW Y;  2QKL B;  3QYF A;  4XKB A;  1UAA A;  1MNE A;  3OL3 A;  1AA7 A;  2L2O A;  5F59 A;  3BG6 A;  3QOD A;  4LIV A;  5F6L A;  5CCM A;  1NG6 A;  3HXL A;  2V7F A;  1X1C A;  3K4N A;  3M59 A;  2R4G A;  2Y0S A;  2CV0 A;  4WUY A;  3SW9 A;  4E47 A;  3OS2 A;  1R6R A;  4IX7 A;  2IXS A;  5JHF A;  1NG7 A;  1YE9 A;  3K70 D;  1FMW A;  3ONQ A;  4KJZ A;  4NUB A;  2LOO A;  5HOO A;  2V4J C;  4O6F A;  3EPZ A;  3IUO A;  4HEA 2;  3VYR B;  4B48 A;  2MYS A;  3DAL A;  2E1M C;  5TH7 A;  2UV1 A;  2VLA A;  3AL0 C;  4N4O B;  3TG5 A;  2JVG A;  3N05 A;  4YPE A;  2IS6 A;  3M53 A;  3CJR B;  4XMY A;  1MMD A;  3FDY A;  4ZTF A;  3W3C A;  5EX0 A;  3S32 A;  2R7U A;  2K5C A;  3DPU A;  5KNL A;  4XKW A;  1LDK B;  2X85 A;  2VKH A;  3OXG A;  3IAM 2;  2A6T A;  4CCL A;  4LDG A;  2L7K A;  2WB1 A;  5EG2 A;  3TBI A;  2W1O A;  1WJC A;  4XLA A;  3S7F A;  2NOJ B;  4NQW B;  2R7V A;  4BJT A;  5FRN A;  4F93 B;  2I8D A;  1Z21 A;  4FET A;  2WA0 A;  4IJ8 A;  2W5Z A;  5KJL A;  2CUJ A;  1IRX A;  4XKV A;  3S8P A;  4BQO A;  2MFZ A;  2Q1Z B;  4CA0 A;  3K4C A;  4J01 A;  4BE2 A;  1YX5 A;  2X6Y A;  3CES A;  4XNF A;  3VYT B;  3OYM A;  3RAY A;  3OL4 A;  3CJQ B;  1WJF A;  3OS5 A;  3VV0 A;  1X19 A;  5ARG A;  2M7A A;  2W4S A;  2V26 A;  1MMN A;  2LRD A;  3UNG C;  1DQU A;  4BGD A;  3OR1 C;  4P1W A;  3F9Z A;  4OWR B;  2WAE A;  3RPU D;  1WFX A;  4LG3 A;  2X1E A;  3S93 A;  3OS1 A;  3H9Q A;  1ML9 A;  5FRO A;  4QPQ A;  2R3A A;  4D9J A;  3M8J A;  5KJK A;  2IS1 A;  3OYH A;  4NC8 A;  3L2U A;  2CV1 A;  1MMG A;  3L2W A;  3PDN A;  2LYC A;  3OYA A;  5HVQ C;  4CCN A;  3HL2 A;  3SYT A;  4J7I A;  1N3J A;  2JVH A;  3TL4 X;  4C9Y A;  2XC7 A;  4DGW B;  4XLE A;  2X51 A;  4MI0 A;  3KMJ A;  1BR4 A;  3CBM A;  2HVR A;  3BO5 A;  4CCJ A;  3PL8 A;  3RTR A;  2BOL A;  4BEH B;  2VQC A;  4NNJ A;  3SDB A;  1MVH A;  3K4L A;  3KMT A;  4KIT B;  4X0G A;  3SWC A;  5ARF A;  1N77 A;  1MUF A;  4ITV A;  3H35 A;  2OV7 A;  2XF6 A;  3IAS 2;  1WJA A;  1WJB A;  3HUG B;  1FMV A;  1U0J A;  3MO0 A;  2VIX A;  1SAU A;  2P0W A;  4BJ6 C;  5T5G A;  3EUA A;  4BAC A;  3H5R A;  4MLO A;  4QEP A;  1N75 A;  4XOR A;  4ZTJ A;  3M54 A;  3FKJ A;  3OYN A;  3DTE A;  4PUS A;  5JJ0 A;  4JOM A;  3QWW A;  2RNG A;  3DKY A;  2A5W A;  1XQH A;  2BVM A;  3K4M A;  2XAU A;  2X6X A;  2R7O A;  3H0D A;  3ZR8 X;  2XF7 A;  3DPT A;  3L2R A;  3KMA A;  2GOM A;  4E7Z A;  1X4O A;  2KRC A;  2R7W A;  4F55 A;  3S3N A;  4Y33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...