4YNDA

The discovery of a-893, a new cell-active benzoxazinone inhibitor of lysine methyltransferase smyd2
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
428
structure length
428
Chain Sequence
AEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Discovery of A-893, A New Cell-Active Benzoxazinone Inhibitor of Lysine Methyltransferase SMYD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Tranferase/transferase inhibitor
total genus 132
structure length 428
sequence length 428
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4yndA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4yndA01
3EDTB 3OOIA 3MO0A 2FBNA 2J9QA 4G2VA 3RO2A 4BT8A 2UY1B 1OUVA 3SWCA 3RQ4A 3ZFWA 3JYSA 4E47A 5CHEE 1WM5A 2IF4A 5G04C 3CBPA 3NF1A 3VTYA 4IJDA 4GZ5A 2LSVA 3ZHEA 4WNGA 3Q4AB 1ML9A 2XEVA 4HOSA 2BUGA 3U4TA 1ELWA 1H3IA 2HO1A 4O6FA 4BWRA 3E4BA 4CGWA 4C1QA 3PE4A 4JA9A 4G24A 4NRHB 3LKUA 2LSUA 1N6AA 3UPVA 3LPZA 2KCVA 3AS4A 4Z4PA 3ZHEB 3QDNA 3F9WA 2R5SA 3M53A 3QWWA 4U0UA 4IN3B 3S7JA 3MO2A 2KC7A 3OXFA 3U3WA 4KYOB 4AIFA 3SW9A 3KMAA 2V5FA 4XI9A 2XCBA 3ASFA 5ARGA 5EKQD 4HOUA 4UQYA 5F6KC 5JJ0A 1B89A 3DALA 4HORA 2VQ2A 5JJTA 3HNAA 3RIBA 1TJCA 5JINA 2IFUA 3QWVA 4I51A 4YPAA 4G26A 4IJ8A 2KCLA 2AVPA 1HH8A 3GZ1A 3VTXA 4YVOA 3OPEA 4U0ZA 4QEPA 4AM9A 3PE3A 2JLBA 3AS5A 3TG4A 1ZBPA 3M55A 4GA1A 3CEQA 4O30A 4WNEA 4XI0A 5FJYA 1N3JA 2GW1A 4GA0A 3KS2A 4GZ6A 3Q15A 4GPKA 2XGMA 4N3BA 4BT9A 3CVLA 1ZKKA 2LNIA 3SZ7A 2I6HA 5FT9A 1HZ4A 2IGQA 4WNDA 4GZ3A 3FP3A 3FPDA 3CK9A 3MEKA 4CDRA 5EX0A 3PDNA 5CCMA 3AS8A 4MI0A 3OXLA 4YPUA 3M59A 3RAYA 3URZA 5BW8C 4ABNA 4G25A 5ARFA 4AY5A 4AY6A 3BEEA 4UI9J 5JHNA 5T0MA 5D0QD 4N3CA 5T0KA 2MHKA 4I9CA 1W3BA 2ONDA 2BQZA 3CVPA 3TGOA 4H12A 3CKCA 1ZU2A 4W9RA 5LCWJ 2JV0A 4B94A 4J83A 4UI9C 3LY8A 3RJVA 1MUFA 3MKRA 3F9XA 2Q7FA 5DBKA 3EP0A 1NA0A 5F6LA 4GYOA 5LCWC 1QZ2A 3LY7A 3TAXA 4CGVA 5M72A 2C2LA 4A1SA 5F59A 3F9ZA 2FEZA 3CBMA 5HI7A 4RG9A 3QWPA 3K5KA 3OS5A 4QENA 5FZSA 3RKVA 4I1AA 4N2QA 2XGOA 4H7XA 3CKBA 2P58C 2YQ8A 2VYIA 3O48A 3M54A 5EX3A 3DB5A 5F5EA 3LY9A 3F9YA 4J8OA 2O8JA 3BO5A 5A7DB 4JA7A 3CVNA 2WPVA 3M57A 2YHCA 4GYYA 5T5GA 4FMUA 5BT1A 2W5ZA 4GYWA 4YNDA 3MV3B 4QEOA 4I9EA 1MVXA 2XPIA 3GW4A 4U07A 1N6CA 1WAO1 4HOQA 4I2ZA 3GYZA 4MI5A 4JHRA 4NQ0A 4J0UA 5G05J 1PC2A 3KMJA 2QFCA 2Y4UA 4Y6CA 1KLXA 4GCNA 5CCLA 4RZ0A 2F69A 3LYAA 3QOUA 2C0LA 2KCKA 2Y4TA 5LSZA 4NJ5A 2C0MA 3M56A 5G05C 2PL2A 5LSXA 4G23A 1QQEA 2FO7A 4JL0A 2HYZA 3IEGA 5TTFA 4UQXA 5JJ6A 3ZGQA 1O9SA 3CV0A 5D0OD 3ZN3A 4WUYA 4YPEA 5TEGA 2VGYA 3ASHA 3GZ2A 5FTPA 3UQ3A 4JDSA 2W5YA 3RU0A 2R3AA 3SF4A 2QPWA 4H7YA 3K9IA 3S7DA 1PEGA 3Q47B 2HR2A 3UUXA 3HYMB 1Y8MA 4LDGA 3ASDA 2OOEA 2XGSA 1XNFA 3R9AB 5FZRA 4XIFA 2WQHA 5JIYA 4J8FA 4U04A 5KJMA 2DBAA 4UI9K 3MV2B 4WNFA 3MO5A 3ZPJA 3RO3A 3CBOA 4GA2A 1YA0A 3ASGA 3WXXA 1XQHA 4I2WA 3CK8A 4N39A 1MVHA 4G1TA 3FWVA 2XCCA 5FZQA 1HXIA 3OXGA 2KATA 3MA5A 4ME2A 4Y6WA 5KJNA 4RG6A 1IHGA 1MT6A 2PQRA 5AYWD 2E2EA 4GCOA 5TH7A 4AU7A 4APOA 4HOTA 3TG5A 2L6JA 2FI7A 1A17A 1E96B 4BTBA 4BUPA 5A6CA 1ELRA 3VUZA 5BNWA 2VSYA 3Q49B 2VSNA 4N3AA 4BTAA 3FFLA 1KT0A 5JJ7A 5KJLA 3M58A 4U0SA 1NA3A 3IHXA 5EG2A 2FF4A 3KMTA 3S7FA 1IYGA 4N5CA 4F3VA 3ESKA 2PZIA 1NZNA 3KD7A 3S7BA 2NC9A 4J8DA 2PQNA 3RJWA 3S8PA 3CVQA 4YNMA 5CPRB 4J7FA 5DIZA 5HQ8A 3KAEA 1P5QA 2VGXA 4JLGA 4J7IA 4J8EA 2G46A 3Q5MA 3N71A 3QKYA 4N2SA 5C1DA 4YNPA 2UY1A 1KT1A 4EQFA 3CK7A 5AYFA 5KJKA 4KXKB 1FCHA 3VV0A 3ULQA 4UQZA 4NVQA 4LEUA 2UWJG 4YVQC 2VGXB 4I17A 3M5AA 3LCAA 2RFIA 5G04J 4KBQA
chains in the Genus database with same CATH superfamily
4TXQA 5BV1A 2P9LG 4MLPA 2IY0C 4JPSA 4AXHA 2WQ6A 3RO2A 4JZYA 1SZAA 4BSZB 3SWCA 3RQ4A 3ZFWA 3JYSA 4E47A 5CHEE 1WM5A 2R03A 3C72A 3VTYA 2GRQB 4IJDA 2WXOA 2WMNA 4XE0A 2GRMA 1V55E 2V4HC 2V4LA 1U2VG 3HRAA 3E4BA 1UJKA 4HBDA 2YNQA 2LUHA 1N6AA 4KZ0A 5ENNA 3B7SA 3B7TA 3CQGB 3ZHEB 3IHYA 5BPPA 4ACKA 2R5SA 1DCEA 3QWWA 4U0UA 4EECA 4LNBA 3TL5A 3FH5A 3UTMA 2WXHA 2XCBA 2P9UG 5ARGA 3SD5A 3CSTA 4UUCA 4M3OA 5CRUA 4HORA 1U3DA 3MGBA 2F8XK 4GMJA 2IFUA 4E85A 4I51A 2LAHA 1HH8A 2XS8A 4HRNA 4YVOA 4AM9A 3G2UA 4NIKA 3LXUX 4GA1A 3ASOE 3LVRE 3CEQA 1N52A 3FTYA 2H6FA 1NI1A 3C98A 4XI0A 1SZ9A 2AWIA 4GA0A 3KS2A 2IO2C 5KCMA 3Q15A 4RSYA 4GPKA 2NXPA 2ETAA 2XGMA 4N3BA 4BT9A 2LNIA 3TWVA 4AEZC 5FT9A 4U8HA 4GMLA 2RFMA 3FEYA 2QYUA 1BPOA 5EX0A 2EQXA 5EIBE 4HRMB 3RAYA 3BQOA 4DI4A 3AAAC 3URZA 2WXGA 5BW8C 4FLHA 4AV7A 4G25A 3PRZA 4AY6A 3BEEA 3Q7AA 5FQ6A 5JHNA 4PS3A 3MYVA 3FU0A 5T0KA 1W3BA 2ONDA 4L1BA 2ILRA 2DVWA 2WXRA 1Z5SC 4HRLA 4U7EB 5E76A 3VLEA 3EP0A 1WG0A 1QYMA 4FP7A 4GYOA 4Q96A 2L0IA 4O1PA 1QZ2A 2CFUA 1JPLA 4CGVA 1N4PA 5M72A 3FTXA 1AWCB 4KZCA 3RKVA 3O4ZA 2PNNA 1H0AA 2WXQA 2ZXWE 3B7BA 4GTMA 5HS0A 3D3MA 3ZIMA 2MRIA 4BFRA 4GZDA 3TWXA 2CG3A 1EYHA 4JA7A 4JEUA 3M57A 1E8WA 2YHCA 4DI3A 4A55A 4FMUA 4OVUA 4DRXE 4GTVA 3MV3B 4I9EA 1KZOA 3UKRG 2YINA 5KWDA 1WAO1 3IXEA 1WY6A 4KVMA 3TXMA 1NFIE 3HXEA 1Y6IA 4J0UA 4KVOA 4Y6CA 1KLXA 2WXMA 4F1SA 4RZ0A 1SVXA 4K5BA 5LSZA 4XZ4A 4Q69A 3M56A 2PL2A 3RRMB 3E37A 3D9MA 3CVXA 2HM8A 3RAUA 3UM2A 1O9SA 1DNPA 5D0OD 2XEHA 3AG2E 2WXIA 3ASHA 5ANRA 5FTPA 5BXOA 2W5YA 5CRVA 3SF4A 3Q47B 1D9SA 3HYMB 4YDYA 1S0PA 1OWMA 1Y8MA 3V31A 2I9CA 3SFYA 5T3RA 3ASDA 1GW6A 2OOEA 3E34A 5FZRA 3S2AA 4DX6D 5KJMA 4K03A 4GMRA 1UN9A 2BF0X 1YMPA 3ZPJA 1MJ0A 3L16A 4Z68A 1MX6A 4F1PA 1YA0A 2LAIA 1H6PA 4OAVB 2YHEA 3EU9A 1XQHA 4F53A 4I2WA 3CK8A 4G1TA 5BUZA 4APFA 1HXIA 3OXGA 3LJNA 3L13A 4G11A 2VSOE 4XKBA 4ME2A 4OAUC 3JUIA 4Y6WA 1IHGA 3BU8A 4FHKA 3E33A 2IJGX 3LJ3A 4HOTA 3TG5A 1DC2A 1BLXB 4CT4A 2B0OE 2GGFA 3ZYQA 3DSTA 4HNAD 4K5CA 3FY4A 4BTBA 4BUPA 1IHBA 2KZTA 1PY1A 2WXJA 4N3AA 2VSNA 2H6GA 3DEOA 5ANLA 3OAWA 5EG2A 2FF4A 3S7FA 4RLYA 4G8LA 3HIZA 4N5CA 4F3VA 3FU6A 4FJYA 2NC9A 4J8DA 3L82A 2EINE 3S8PA 2LXMA 2ZGDA 4YNMA 2R59A 2X6FA 3V2OA 1K1BA 5DIZA 4ANVA 3HG0D 3KAEA 3FUHA 3ZYKA 1NL4A 4JB8P 3G2WA 4UWKA 2X6JA 3Q5MA 3QKYA 4N2SA 4IYPA 3C5RA 2UY1A 3ZYLA 1EPUA 1KT1A 1SA4A 4FJZA 2RFAA 5AYFA 5KBAA 2NYJA 4KXKB 5KJKA 3VV0A 3I5PA 4NVQA 5JA4D 2UWJG 2VSXE 2LXLA 3AG4E 4I43A 4AOFA 5LX8A 3Q9NC 4TXPA 5AQAA 2ETCA 2GRPB 2IU1A 1MQSA 3WG7E 2J07A 2X6KA 2FBNA 4JHJA 4G2VA 4PDXA 4RVBA 1N94A 2R2LA 4BX9A 4GTPA 2R17C 4MRUA 5G04C 3TXNA 3CIAA 2LSVA 3Q4AB 3TWTA 2XEVA 3FU5A 4HOSA 1H3IA 3CVUA 1VDYA 4BWRA 3MZLB 3T5VA 3PE4A 4JA9A 4G24A 1RZ4A 3PUJA 3LKUA 4HI8A 3FUKA 3CVWA 4HVBA 3QDNA 5AENA 5ENSD 1FT1A 3ZU7B 4GTOA 4AIFA 3SW9A 2V5FA 4YDWA 4OYSA 5EKQD 4FLBA 4AVXA 4UQYA 1E7VA 4L7TA 4HFGA 3UM3A 1KPSB 3NOGD 3LEWA 2ZISA 2VQ2A 3UKUG 4U95D 4J7WA 1JWFA 4ILIA 3Q9UC 4G26A 3FUIA 3D9PA 2J49A 3VTXA 4LG6A 4U0ZA 4E6HA 3PE3A 2JLBA 3AS5A 3TG4A 1FPPA 3ZYMA 3FU3A 2M63A 4B0ZA 4WNEA 3T8MA 3I4GA 2GRRB 2F0YA 2GW1A 4BSXA 3L22A 5AN8A 3HXDA 4GZ6A 4A3TA 1BU9A 4BESA 4FA6A 3Q78A 2I6HA 1IKND 1MX4A 2IGQA 1MHQA 4WNDA 4EZLA 5CBNA 4UWFA 3FPDA 4YDEA 4HXIA 3SQVA 4ATGA 5JHBA 3PEVB 5CCMA 3G2VA 4MI0A 3L54A 4YPUA 3M59A 5E75A 4UWGA 2JEKA 4ABNA 2OEVA 1O5MA 3HXFA 2IOLA 4UI9J 1PAQA 2IO3C 4N3CA 4UWHA 4JHKA 2BQZA 1H6KA 1ZU2A 5FQ8A 3JCKC 3HXCA 4MKTA 1TEZA 4FHJA 4ILGA 3F9XA 1S63A 1SQMA 5T4YA 1S64A 3CSFA 5AQ7A 5AQ9A 1H2TC 3Q7FA 3RRUA 2PM7A 3F9ZA 3CBMA 5HI7A 4RG9A 3QWPA 3K5KA 4QENA 4R7LA 2FULA 3EHMA 2V8SE 1K1AA 3FUDA 3PEUB 5AJDA 3U64A 5C2YA 4J6IA 2YQ8A 3TWSA 4FULA 2VYIA 3QK0A 3M54A 3DB5A 2P9IG 2XPYA 3FTVA 4LSZE 4ATZD 3L08A 3BG1B 3BO5A 5A7DB 3UINC 4CEMA 2ETBA 4GTSA 4DJAA 1TN6A 3PH0C 1OWPA 3SNXA 2EIME 5B3SE 4GYYA 4C0MA 5BT1A 4TXRA 3W9GA 4B8AA 2XEEA 2XRZA 3KEZA 3GW4A 3UMVA 2P9KG 4XX5A 3Q73A 3OTNA 2B6CA 1S70B 3DSWA 1KZPA 4GCNA 5CCLA 3TJPA 3LYAA 2BEDA 3QOUA 3FUEA 3AG3E 4JD2G 5LSXA 4G23A 2FO7A 4JL0A 5HRYA 2HYZA 2VJ8A 3DWLG 3TWUA 4UQXA 3ESLA 3SBTB 5TEGA 4GPMA 3FTUA 2J4BA 2KBXA 2AJAA 4HQDA 5H7PA 2QPWA 4H7YA 3K9IA 3S7DA 1HX8A 2A5EA 5CEDB 3X2QE 4ANWA 4LDGA 3SFZA 4ZFHA 3PVLA 4ZHBA 2GRNB 1XNFA 4U8VD 4XIFA 2WQHA 2AXUA 5JIYA 3HHMA 1FVHA 1MYOA 3UIPC 2DBAA 2GRLA 4M7CA 5AQBA 3MO5A 1OCRE 1XGWA 2MYOA 3RO3A 4DX7D 4HB5A 2KM4A 3ASGA 2CFZA 2IQCA 1TNZA 4KMOA 4GTTA 3C3RA 4N39A 1JUQA 4IULA 2IONA 5FZQA 2KATA 4MS6A 2H6IA 5AYWD 2DWZA 1O1TA 5JMND 3NOCD 4BX8A 4APOA 1E8XA 3UT8A 2X3MA 2L6JA 1ELRA 3AJIA 3Q49B 4EBAG 1KT0A 5KJLA 1NA3A 3EHQA 4I6GA 4GU5A 3ZUVB 1BI7B 3ZKJA 1OXJA 3ESKA 4B93B 1NZNA 2PQNA 4HLLA 5KNGA 2OV8A 4JC8A 2KZTB 4L23A 2V0PA 1P5QA 2VGXA 1NP7A 1TNYA 3T5XA 1L5JA 2J8SD 4N5QA 4DX2A 5T8IA 2XRYA 5C1DA 1OWNA 3JXJA 1N11A 4U8YD 5BXUA 3EIQC 1UG3A 1Z6TA 3ULQA 4UQZA 2DYSE 4YVQC 5LFAA 3I3NA 1HG5A 1N54A 5CMWA 4I17A 3UX4A 1BD8A 2RFIA 3DBSA 2DIWA 3EDTB 5FINA 1ZB1A 3OOIA 2J9QA 1HU3A 2OCCE 2UY1B 4LERA 4BT8A 1OUVA 2CHZA 2IF4A 3CBPA 3NF1A 4GZ5A 1ML9A 3I4RB 3AG1E 5AAOA 1ELWA 4O6FA 2CHWA 4CGWA 4C1QA 2QY7A 3DXKG 4NRHB 3J5QB 4L9PA 5JHAA 3UPVA 3JQ1A 3AS4A 4Z4PA 2I1KA 4DX1A 4BERA 5EILA 1HFAA 2WVIA 4NACA 3MX3A 1EF1C 3OXFA 5IY5E 3U3WA 3PREA 3KMAA 4FC8A 3PZ2A 4UWLA 4C48B 3ASFA 4GTQA 4HOUA 2XS1A 4K5AB 5F6KC 2X6IA 3UXGA 3LDZA 3DALA 1JCQA 1A5EA 3HNAA 1OWLA 3RIBA 4BY6A 2NSZA 2WXKA 3P2BA 1ELKA 2EIKE 3B13A 4NURA 3TWQA 1TJCA 5JINA 4YPAA 2I2OA 1H2UA 4IJ8A 2KCLA 3QAQA 2AVPA 3D9OA 2XQ0A 2F8YA 3OPEA 3DSXA 4TRQA 1ZBPA 4TUUA 5ENPD 1OT8A 1N3JA 3UI2A 3T9KA 3FULA 4U96D 1N4RA 1TNOA 3ML8A 5D66A 3ASNE 4LRZA 3CVLA 1ZKKA 1MZCA 3FTSA 1HZ4A 2BKGA 1DVPA 4GZ3A 3R7QA 5D2MC 3FP3A 3W9FA 4I1MA 4LNUD 3CK9A 3P1UA 1H6OA 3UT4A 3LS8A 2BKKB 1OCZE 3PDNA 3AS8A 3RK6A 4I6JA 2A5UA 3DXMG 3AU4A 1N0RA 5EDSA 4O1OA 4AY5A 3APCA 2R02A 2X38A 1H2VC 1AP7A 3SFXA 4I9CA 3CVPA 4AJWA 3TGOA 3D9IA 4H12A 3CKCA 4W9RA 5LCWJ 2JV0A 4HI9A 4B94A 1Z3XA 4UI9C 1MUFA 1JWGA 4I6EA 1D8DA 4IRUA 3QB2A 2Q7FA 4DPRA 1EDUA 5FQ4A 3E30A 2IOSA 1LD8A 3LY7A 3QJZA 3TAXA 4WAFA 2XPZA 5F59A 4A3VA 4B89A 2FEZA 3L9TA 3EU5A 4PUCA 3OS5A 1N95A 1O1RA 4TUMA 4I1AA 4C9BB 2XGOA 3D9JA 1HF8A 5G2NA 1FT2A 3CKBA 2P58C 3PNTB 4GZCA 3F9YA 2O8JA 3CVNA 2J09A 2WPVA 2ZU6B 2RD0A 5T5GA 3JUEA 3G2SA 2W5ZA 4DX5D 5EYPF 3ZW3A 3APFA 4QEOA 3DPDA 2XPIA 3UM1A 1N6CA 4DLQA 4O60A 4HOQA 3ABLE 3B95A 4NQ0A 5G05J 1PC2A 5G55A 5ENQD 2Y4UA 4TV3A 4V3IA 2L9BA 2F69A 2C0LA 1TNUA 5FIOA 4NJ5A 3HDXA 2E0IA 4ILHB 3IEGA 2AW6A 5TTFA 2J4DA 3SI5A 3FUNA 2OVBA 1X81A 5JJ6A 3ZGQA 1FVFA 4ACLA 3CV0A 4WUYA 5CERB 4YPEA 3D9HA 4EPZA 2DYRE 5LP0A 2VGYA 5FWQA 2WQ7A 3GZ2A 3CVVA 3UQ3A 3BG0B 3RSEG 2ZGGA 3PZDA 1PEGA 4EZJA 3EUVA 3UUXA 1UJJA 2V5QC 4F6RD 3IKOB 2L6BA 2WXNA 3L17A 2XZTG 5LOZA 1OCOE 1HE8A 5KNHD 3FTZA 3TWRA 4J8FA 4U04A 4BEPA 5B1BE 2QYJA 4UI9K 3F6QA 3SGHA 3MV2B 5EIDA 4WNFA 3NZUA 3CBOA 2RKKA 2P9PG 3D9NA 5J90A 1IQUA 1MVHA 4CRWA 1TR4A 2XCCA 4X8QA 3EIJA 4RG6A 2PQRA 3U66A 1OY3D 1LF8A 4A63B 3L6AA 4JW1A 4K0RA 1U3CA 2FI7A 1A17A 3FH8A 3UT7A 3NBNB 1QNFA 2VSYA 3FFLA 3CHSA 3PZ3A 4U0SA 4L2YA 3CLJA 3KMTA 5ITZF 3UM0A 1IYGA 2WMOA 3ZNGA 1TN7A 2R05A 3QNKA 3KD7A 3S7BA 3RJWA 3V30A 1INZA 5CPRB 4FU3A 3JQ0A 5AARA 3ABME 5B1AE 3JXIA 3IBEA 4I1OB 4LUNU 3NQPA 4J7IA 4J8EA 3MKQA 2G46A 3CHMA 4PS8A 3V2XA 3N71A 4LNGA 4DLOA 3GZSA 3ABKE 3DSUA 4GB9A 1FCHA 3T8KA 4LEUA 1YYHA 1HO8A 3MJWA 2VGXB 4J8SA 2XENA 4U63A 3M5AA 4KBQA 3MO0A 1K8KG 1E8YA 2PM6A 4QFVA 1D8EA 4YDOA 4KT6B 5CECB 3ZHEA 4GTRA 4PS7A 4WNGA 3DEPA 3ML9A 2BUGA 3QARA 3U4TA 2HO1A 1UOHA 2Y0BG 3V79K 5ENOD 4EZKA 2LSUA 3R9MA 3NZSA 3LPZA 2KCVA 3HVEB 3F9WA 3ZEFA 2P2CP 4B8CB 3M53A 2OEWA 4MBGA 4IN3B 3FUMA 3S7JA 2A4ZA 3MO2A 2KC7A 4KYOB 1Q2ZA 3SY2A 4XI9A 4URKA 3Q75A 1WDYA 2VTBB 2QZAA 1N4SA 5JJ0A 2Y3AA 4EBAA 4GAAA 1B89A 3Q79A 1IQRA 1N9AA 2XZDG 5JJTA 5J08A 1V54E 4CZ2D 3QWVA 5FQ7A 1O1SA 2DZOA 3GZ1A 3FEXA 5ENTD 3FHEA 4QEPA 3TWWA 3M55A 1RW2A 2L0TB 3PUKA 3DRAA 4O30A 5FJYA 3QC1A 4FADA 4F7AA 3PS6A 5EYLA 3ZRHA 3CR3A 3C3OA 4G8KA 3SZ7A 2JABA 5BV0A 3SBSA 3EHRA 4DUIA 3MEKA 4CDRA 3LVQE 3OXLA 3FH7A 3ULYA 2QC9A 5ARFA 1UN8A 2GROB 3HVEA 5T0MA 2I1JA 5D0QD 2MHKA 1TNBA 1H19A 1OCCE 1X5BA 1N4QA 1LD7A 4J83A 3ZXPA 3CGHA 3IV0A 3LY8A 3RJVA 3MKRA 3HXBA 5DBKA 1NA0A 5F6LA 3C3QA 3DSVA 5LCWC 3J5PA 2VTBA 4CDMA 3ONKA 4CT0A 3SHFA 2IEJA 2EIJE 2C2LA 4A1SA 4WWNA 3FUFA 4HS2A 2WXPA 3E32A 4LCTA 2J08A 2Y69E 5FZSA 1MX2A 4N2QA 4H7XA 3VLFA 2XHEA 4QQIA 3CVYA 3IHVA 3NAWA 3O48A 5EX3A 5F5EA 3LY9A 4J8OA 3CHPA 4AP2A 2H6HA 3EJNA 2VGEA 3B7UX 3DSSA 4Q94A 2OVFA 2Y1LE 3NB2A 4GYWA 4YNDA 3ISMC 4WWPA 1MVXA 1Z3YA 1OWOA 1YCSB 4U07A 2EILE 4I2ZA 4D10C 3DPYA 3GYZA 2X6HA 4JXTA 3KSQA 4MI5A 3PZ4A 4XKCA 3ZVVA 4JHRA 1IXVA 3KMJA 2QFCA 4WWOA 1K3ZD 2KCKA 2Y4TA 4HLEA 2C0MA 5G05C 4C0EA 1QQEA 3CHQA 2WM9A 1JCSA 1UW4B 1SW6A 3KEAA 2RG8A 3U9WA 2CG2A 2AXZA 3CQCB 3D9KA 2DZNA 3ZN3A 2DCPA 1E90A 1TN8A 3R7RA 4ANUA 2HE0A 4JDSA 3ULEG 2KXPC 1G3NB 3RU0A 2R3AA 1N0QA 4CDNA 2HR2A 4JVSA 4EHMA 3BUAA 4CYMD 3VLDA 2BTDA 2XGSA 5HKPA 3R9AB 5A23A 2LO6A 3SO8A 1SA5A 3B7RL 1BI8B 4JEHA 2FO1E 2P9SG 1E7UA 1HS6A 3G2TA 1TJFA 4GA2A 3WXXA 5EN5D 1HG2A 3ZXSA 3FWVA 4A1GA 3MA5A 5KJNA 1MT6A 3RRNB 2E2EA 4GCOA 5TH7A 4AU7A 3ONLA 5CEAA 1DCQA 3UIOC 5CMYA 3FUJA 3FTWA 2F37A 1E96B 5A6CA 1TYQG 5ENRD 3VUZA 4OVVA 4RQIA 5BNWA 4BTAA 5JJ7A 3M58A 3KSLA 3IHXA 2WB2A 5AJLA 3ENEA 4PH4B 2PZIA 3CHOA 2WXLA 4XEIG 3CVQA 5CBOA 3PNLB 4J7FA 5AIJA 4ANXA 2CHXA 3APDA 5HQ8A 2WXFA 4JLGA 3FDHA 2ZIRA 2AXVA 2P9NG 1JCRA 4J8YA 3CHRA 4YNPA 3MCXA 1LTXA 4EQFA 3CK7A 4BETA 1E8ZA 3PZ1A 3EHNA 4CCAA 2MOWA 4DK5A 3AU5A 4L2LA 3D9LA 4P29A 3LCAA 1QBQA 3MKQB 5G04J
chains in the Genus database with same CATH topology
3EDTB 2X6KA 3OOIA 3MO0A 5BV1A 4MLPA 2FBNA 2J9QA 4G2VA 4JHJA 4JPSA 4PDXA 1E8YA 1HU3A 2PM6A 4RVBA 3RO2A 4AXHA 2WQ6A 4BT8A 2UY1B 4JZYA 4LERA 4BX9A 1SZAA 1OUVA 3SWCA 4QFVA 3RQ4A 3ZFWA 3JYSA 4E47A 2R17C 5CHEE 4MRUA 1WM5A 2CHZA 2IF4A 5G04C 3TXNA 3NF1A 4KT6B 3CIAA 3VTYA 3CBPA 4IJDA 4GZ5A 2LSVA 3ZHEA 2WXOA 4PS7A 2WMNA 4WNGA 3Q4AB 4XE0A 3ML9A 1ML9A 2GRMA 2XEVA 3FU5A 3I4RB 4HOSA 2BUGA 3QARA 1ELWA 3U4TA 1H3IA 3CVUA 1VDYA 2HO1A 4O6FA 2CHWA 2V4LA 4BWRA 3MZLB 3T5VA 3E4BA 4CGWA 4C1QA 2QY7A 3PE4A 4EZKA 1UJKA 4JA9A 4G24A 3PUJA 4NRHB 3LKUA 2YNQA 2LSUA 5JHAA 3UPVA 1N6AA 3NZSA 4KZ0A 5ENNA 3LPZA 3B7SA 3JQ1A 3FUKA 2KCVA 3CVWA 3B7TA 3CQGB 3AS4A 4HVBA 4Z4PA 3HVEB 3IHYA 2I1KA 3ZHEB 5BPPA 3QDNA 4ACKA 3F9WA 3ZEFA 5AENA 4B8CB 2R5SA 3M53A 3QWWA 4U0UA 4EECA 1HFAA 2WVIA 3FUMA 4IN3B 3S7JA 4NACA 2A4ZA 3MX3A 3MO2A 3TL5A 3FH5A 2KC7A 1EF1C 3OXFA 3U3WA 3PREA 4KYOB 2WXHA 4AIFA 3SW9A 3KMAA 2V5FA 4OYSA 4FC8A 4XI9A 4UWLA 2XCBA 3ASFA 5ARGA 5EKQD 4FLBA 4URKA 4AVXA 4HOUA 4UQYA 2VTBB 3SD5A 1E7VA 5F6KC 3CSTA 2X6IA 4L7TA 3LDZA 4HFGA 2Y3AA 4EBAA 4GAAA 5JJ0A 1B89A 4M3OA 3DALA 1IQRA 1U3DA 3LEWA 4HORA 2VQ2A 5JJTA 3HNAA 1OWLA 3MGBA 3RIBA 5J08A 4BY6A 2NSZA 2WXKA 3P2BA 4GMJA 1ELKA 3B13A 4NURA 1JWFA 4ILIA 1TJCA 5JINA 2IFUA 4E85A 3QWVA 5FQ7A 4I51A 4G26A 2I2OA 4YPAA 1H2UA 2LAHA 4IJ8A 2KCLA 3QAQA 2AVPA 3D9OA 2XQ0A 1HH8A 3GZ1A 3FEXA 3FUIA 3D9PA 2J49A 3VTXA 4YVOA 3OPEA 3FHEA 4U0ZA 4AM9A 4QEPA 4TRQA 4E6HA 3PE3A 2JLBA 3AS5A 3TG4A 1ZBPA 4TUUA 3G2UA 3M55A 3PUKA 2L0TB 3ZYMA 3LXUX 4GA1A 3LVRE 3CEQA 3FU3A 2M63A 4O30A 4B0ZA 1N52A 3FTYA 3C98A 4WNEA 4XI0A 3T8MA 1SZ9A 5FJYA 1N3JA 3I4GA 3QC1A 2AWIA 3FULA 2GW1A 4BSXA 4GA0A 3KS2A 4FADA 3L22A 4GZ6A 5KCMA 3Q15A 4RSYA 4F7AA 4GPKA 4A3TA 2NXPA 3ML8A 3PS6A 2XGMA 4LRZA 4N3BA 4BT9A 3ZRHA 3CR3A 4FA6A 3CVLA 1ZKKA 2LNIA 3SZ7A 2I6HA 4AEZC 5FT9A 3FTSA 1HZ4A 4U8HA 4GMLA 1DVPA 1MHQA 4GZ3A 4WNDA 3R7QA 2IGQA 3FEYA 4EZLA 5BV0A 3FP3A 4UWFA 3FPDA 3SBSA 4HXIA 4I1MA 1BPOA 3CK9A 3MEKA 4CDRA 5EX0A 2EQXA 3P1UA 4ATGA 3UT4A 3LVQE 3LS8A 5JHBA 3PEVB 3PDNA 5CCMA 3G2VA 5LFAA 3AS8A 4MI0A 3L54A 3OXLA 3RK6A 3M59A 4I6JA 4YPUA 2A5UA 3FH7A 3RAYA 4DI4A 5E75A 3URZA 2WXGA 5BW8C 3AU4A 4UWGA 4FLHA 2JEKA 4AV7A 4ABNA 4G25A 5EDSA 3PRZA 5ARFA 1UN8A 4AY5A 4AY6A 3APCA 2IOLA 3BEEA 4UI9J 5FQ6A 1PAQA 3HVEA 5JHNA 2X38A 1H2VC 5T0MA 2I1JA 4PS3A 4N3CA 4UWHA 5D0QD 3MYVA 3FU0A 2MHKA 5T0KA 4I9CA 1W3BA 2ONDA 1H19A 4JHKA 2BQZA 4L1BA 3CVPA 4AJWA 1X5BA 3TGOA 2ILRA 3D9IA 1H6KA 4H12A 3CKCA 1ZU2A 4W9RA 5FQ8A 5LCWJ 2JV0A 4B94A 4J83A 1Z3XA 2WXRA 3JCKC 4MKTA 4UI9C 5E76A 3VLEA 3CGHA 3IV0A 3LY8A 3RJVA 1TEZA 4FHJA 1JWGA 1MUFA 3MKRA 4I6EA 4ILGA 4IRUA 3QB2A 3F9XA 2Q7FA 5DBKA 3EP0A 4FP7A 4DPRA 1SQMA 1NA0A 5T4YA 4GYOA 5F6LA 1EDUA 4Q96A 5LCWC 2L0IA 3CSFA 2VTBA 5FQ4A 4CDMA 1QZ2A 2CFUA 1H2TC 1JPLA 2IOSA 3LY7A 3QJZA 3RRUA 3TAXA 3ONKA 4WAFA 4CT0A 3SHFA 4CGVA 5M72A 2XPZA 2C2LA 4A1SA 5F59A 2PM7A 3FTXA 4WWNA 4A3VA 4B89A 3FUFA 4HS2A 3F9ZA 2FEZA 3CBMA 2WXPA 5HI7A 4KZCA 4RG9A 4LCTA 2J08A 3QWPA 4PUCA 3K5KA 3OS5A 4QENA 4R7LA 5FZSA 3RKVA 4I1AA 3O4ZA 1H0AA 2FULA 3EHMA 4C9BB 2V8SE 2WXQA 2XGOA 3D9JA 3FUDA 4H7XA 3VLFA 3PEUB 4N2QA 1HF8A 5G2NA 2XHEA 3CKBA 5AJDA 3U64A 3D3MA 5C2YA 4J6IA 2P58C 2YQ8A 3CVYA 3ZIMA 2MRIA 3IHVA 4FULA 2VYIA 3O48A 3QK0A 4BFRA 5EX3A 3DB5A 3M54A 2XPYA 5F5EA 3FTVA 3PNTB 4GZCA 3LY9A 4GZDA 3F9YA 3L08A 4J8OA 3CHPA 3BG1B 2O8JA 2CG3A 5A7DB 1EYHA 4JA7A 4JEUA 4CEMA 3BO5A 3CVNA 2J09A 4AP2A 2WPVA 3M57A 1E8WA 2ZU6B 3EJNA 4DJAA 3PH0C 2YHCA 2RD0A 1OWPA 3SNXA 4DI3A 4GYYA 3B7UX 5T5GA 4A55A 4FMUA 4OVUA 4Q94A 2OVFA 4C0MA 3G2SA 5BT1A 2W5ZA 4GYWA 3ZW3A 4YNDA 4B8AA 3APFA 3MV3B 4WWPA 4I9EA 2XRZA 1MVXA 2YINA 3DPDA 3KEZA 4QEOA 2XPIA 1Z3YA 1OWOA 3GW4A 4U07A 1N6CA 1WAO1 4DLQA 4HOQA 1WY6A 4I2ZA 3UMVA 4D10C 3GYZA 2X6HA 4JXTA 4KVMA 3TXMA 4MI5A 4XKCA 3ZVVA 4JHRA 4XX5A 4NQ0A 4J0UA 5G05J 1Y6IA 1PC2A 5G55A 3OTNA 3KMJA 2QFCA 4KVOA 2Y4UA 4WWOA 4Y6CA 4TV3A 4V3IA 1KLXA 2WXMA 4GCNA 4F1SA 2L9BA 5CCLA 3TJPA 3LYAA 2F69A 4RZ0A 3QOUA 2C0LA 2KCKA 2Y4TA 3FUEA 5LSZA 4NJ5A 4XZ4A 4HLEA 4Q69A 3HDXA 2C0MA 3M56A 5G05C 2PL2A 4C0EA 4G23A 5LSXA 1QQEA 3CHQA 2FO7A 2E0IA 2WM9A 4ILHB 4JL0A 2HYZA 1UW4B 3RRMB 3IEGA 2AW6A 3D9MA 2VJ8A 5TTFA 2RG8A 3U9WA 2CG2A 2J4DA 3SI5A 3CVXA 3FUNA 2OVBA 4UQXA 5JJ6A 2HM8A 2AXZA 3ZGQA 1O9SA 3CQCB 3ESLA 1FVFA 4ACLA 3CV0A 3D9KA 1DNPA 5D0OD 3SBTB 3ZN3A 4WUYA 4YPEA 5TEGA 4EPZA 2WXIA 2DCPA 1E90A 3R7RA 3FTUA 5LP0A 2J4BA 2VGYA 4ANUA 5FWQA 2WQ7A 3ASHA 3GZ2A 5ANRA 5FTPA 3CVVA 3UQ3A 4JDSA 3BG0B 2W5YA 3RU0A 2R3AA 3SF4A 2QPWA 3PZDA 3K9IA 4H7YA 3S7DA 1PEGA 4CDNA 1HX8A 3Q47B 4EZJA 2HR2A 3UUXA 4JVSA 1UJJA 3HYMB 1S0PA 1OWMA 1Y8MA 3VLDA 2I9CA 3IKOB 4ANWA 4LDGA 2WXNA 5T3RA 3ASDA 1GW6A 2BTDA 3L17A 3SFZA 2OOEA 3PVLA 5LOZA 2XGSA 1XNFA 3R9AB 5FZRA 4XIFA 5A23A 2WQHA 2AXUA 2LO6A 3S2AA 1HE8A 5JIYA 3HHMA 1FVHA 3B7RL 3FTZA 4J8FA 4U04A 5KJMA 2DBAA 2GRLA 4K03A 4JEHA 4UI9K 3SGHA 3MV2B 1UN9A 4WNFA 2BF0X 3MO5A 3ZPJA 3NZUA 1XGWA 1E7UA 1HS6A 3RO3A 3L16A 3CBOA 3G2TA 1TJFA 4GA2A 1YA0A 2LAIA 2KM4A 3ASGA 3WXXA 2CFZA 2IQCA 3D9NA 2YHEA 1XQHA 4KMOA 4F53A 4I2WA 3CK8A 5J90A 1IQUA 4N39A 1JUQA 1HG2A 4IULA 1MVHA 4CRWA 4G1TA 3FWVA 2XCCA 2IONA 3ZXSA 5BUZA 5FZQA 4APFA 1HXIA 4A1GA 3OXGA 2KATA 3L13A 2VSOE 3MA5A 4G11A 4ME2A 4MS6A 4XKBA 3JUIA 4Y6WA 5KJNA 3EIJA 4RG6A 1IHGA 1MT6A 2PQRA 3RRNB 5AYWD 2E2EA 4FHKA 3U66A 4GCOA 2IJGX 1LF8A 3LJ3A 3ONLA 3L6AA 5TH7A 4AU7A 4JW1A 4BX8A 4APOA 4HOTA 4K0RA 5CMYA 1E8XA 3FUJA 3TG5A 3UT8A 3FTWA 1U3CA 2X3MA 2L6JA 4CT4A 2GGFA 2FI7A 3ZYQA 1A17A 1E96B 3FH8A 3FY4A 4BTBA 4BUPA 5A6CA 3UT7A 1ELRA 3VUZA 2KZTA 1PY1A 2WXJA 4OVVA 5BNWA 1QNFA 2VSYA 3Q49B 2VSNA 4N3AA 4BTAA 3FFLA 4EBAG 1KT0A 5JJ7A 5KJLA 3M58A 3CHSA 1NA3A 4U0SA 5ANLA 3OAWA 3IHXA 4L2YA 3CLJA 4I6GA 2FF4A 5EG2A 2WB2A 3KMTA 3S7FA 5AJLA 1IYGA 4GU5A 2WMOA 3ENEA 4PH4B 3HIZA 4N5CA 4F3VA 3ESKA 3QNKA 3FU6A 2PZIA 1NZNA 3CHOA 3KD7A 2WXLA 4FJYA 3S7BA 2NC9A 4J8DA 2PQNA 3RJWA 3S8PA 3CVQA 2OV8A 1INZA 4YNMA 5CPRB 2R59A 3PNLB 4J7FA 5AIJA 4ANXA 2CHXA 4FU3A 3JQ0A 2X6FA 2KZTB 4JC8A 4L23A 5DIZA 3APDA 4ANVA 2V0PA 5HQ8A 3KAEA 1P5QA 3FUHA 2VGXA 2WXFA 4JLGA 1NP7A 3ZYKA 3IBEA 4I1OB 3G2WA 4LUNU 3FDHA 3NQPA 4UWKA 3T5XA 4J7IA 2AXVA 4J8EA 3MKQA 2G46A 3CHMA 1L5JA 2X6JA 3Q5MA 4PS8A 3N71A 3CHRA 3QKYA 5T8IA 4N2SA 2XRYA 5C1DA 4IYPA 1OWNA 4DLOA 4YNPA 3GZSA 3MCXA 2UY1A 3ZYLA 1EPUA 1KT1A 4FJZA 4EQFA 3CK7A 4GB9A 5AYFA 3EIQC 5KJKA 4KXKB 1FCHA 1E8ZA 1UG3A 1Z6TA 3VV0A 3I5PA 3ULQA 4UQZA 4NVQA 4LEUA 3EHNA 2UWJG 2VSXE 2MOWA 4YVQC 4CCAA 4DK5A 1HO8A 3I3NA 3AU5A 1HG5A 3MJWA 4I43A 2VGXB 4J8SA 4L2LA 3D9LA 1N54A 4P29A 4AOFA 5CMWA 4U63A 5LX8A 4I17A 3UX4A 3M5AA 3LCAA 2RFIA 2IU1A 3DBSA 1MQSA 3MKQB 5G04J 2DIWA 4KBQA 2J07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EDT B;  3OOI A;  3MO0 A;  2FBN A;  2J9Q A;  4G2V A;  3RO2 A;  4BT8 A;  2UY1 B;  1OUV A;  3SWC A;  3RQ4 A;  3ZFW A;  3JYS A;  4E47 A;  5CHE E;  1WM5 A;  2IF4 A;  5G04 C;  3CBP A;  3NF1 A;  3VTY A;  4IJD A;  4GZ5 A;  2LSV A;  3ZHE A;  4WNG A;  3Q4A B;  1ML9 A;  2XEV A;  4HOS A;  2BUG A;  3U4T A;  1ELW A;  1H3I A;  2HO1 A;  4O6F A;  4BWR A;  3E4B A;  4CGW A;  4C1Q A;  3PE4 A;  4JA9 A;  4G24 A;  4NRH B;  3LKU A;  2LSU A;  1N6A A;  3UPV A;  3LPZ A;  2KCV A;  3AS4 A;  4Z4P A;  3ZHE B;  3QDN A;  3F9W A;  2R5S A;  3M53 A;  3QWW A;  4U0U A;  4IN3 B;  3S7J A;  3MO2 A;  2KC7 A;  3OXF A;  3U3W A;  4KYO B;  4AIF A;  3SW9 A;  3KMA A;  2V5F A;  4XI9 A;  2XCB A;  3ASF A;  5ARG A;  5EKQ D;  4HOU A;  4UQY A;  5F6K C;  5JJ0 A;  1B89 A;  3DAL A;  4HOR A;  2VQ2 A;  5JJT A;  3HNA A;  3RIB A;  1TJC A;  5JIN A;  2IFU A;  3QWV A;  4I51 A;  4YPA A;  4G26 A;  4IJ8 A;  2KCL A;  2AVP A;  1HH8 A;  3GZ1 A;  3VTX A;  4YVO A;  3OPE A;  4U0Z A;  4QEP A;  4AM9 A;  3PE3 A;  2JLB A;  3AS5 A;  3TG4 A;  1ZBP A;  3M55 A;  4GA1 A;  3CEQ A;  4O30 A;  4WNE A;  4XI0 A;  5FJY A;  1N3J A;  2GW1 A;  4GA0 A;  3KS2 A;  4GZ6 A;  3Q15 A;  4GPK A;  2XGM A;  4N3B A;  4BT9 A;  3CVL A;  1ZKK A;  2LNI A;  3SZ7 A;  2I6H A;  5FT9 A;  1HZ4 A;  2IGQ A;  4WND A;  4GZ3 A;  3FP3 A;  3FPD A;  3CK9 A;  3MEK A;  4CDR A;  5EX0 A;  3PDN A;  5CCM A;  3AS8 A;  4MI0 A;  3OXL A;  4YPU A;  3M59 A;  3RAY A;  3URZ A;  5BW8 C;  4ABN A;  4G25 A;  5ARF A;  4AY5 A;  4AY6 A;  3BEE A;  4UI9 J;  5JHN A;  5T0M A;  5D0Q D;  4N3C A;  5T0K A;  2MHK A;  4I9C A;  1W3B A;  2OND A;  2BQZ A;  3CVP A;  3TGO A;  4H12 A;  3CKC A;  1ZU2 A;  4W9R A;  5LCW J;  2JV0 A;  4B94 A;  4J83 A;  4UI9 C;  3LY8 A;  3RJV A;  1MUF A;  3MKR A;  3F9X A;  2Q7F A;  5DBK A;  3EP0 A;  1NA0 A;  5F6L A;  4GYO A;  5LCW C;  1QZ2 A;  3LY7 A;  3TAX A;  4CGV A;  5M72 A;  2C2L A;  4A1S A;  5F59 A;  3F9Z A;  2FEZ A;  3CBM A;  5HI7 A;  4RG9 A;  3QWP A;  3K5K A;  3OS5 A;  4QEN A;  5FZS A;  3RKV A;  4I1A A;  4N2Q A;  2XGO A;  4H7X A;  3CKB A;  2P58 C;  2YQ8 A;  2VYI A;  3O48 A;  3M54 A;  5EX3 A;  3DB5 A;  5F5E A;  3LY9 A;  3F9Y A;  4J8O A;  2O8J A;  3BO5 A;  5A7D B;  4JA7 A;  3CVN A;  2WPV A;  3M57 A;  2YHC A;  4GYY A;  5T5G A;  4FMU A;  5BT1 A;  2W5Z A;  4GYW A;  4YND A;  3MV3 B;  4QEO A;  4I9E A;  1MVX A;  2XPI A;  3GW4 A;  4U07 A;  1N6C A;  1WAO 1;  4HOQ A;  4I2Z A;  3GYZ A;  4MI5 A;  4JHR A;  4NQ0 A;  4J0U A;  5G05 J;  1PC2 A;  3KMJ A;  2QFC A;  2Y4U A;  4Y6C A;  1KLX A;  4GCN A;  5CCL A;  4RZ0 A;  2F69 A;  3LYA A;  3QOU A;  2C0L A;  2KCK A;  2Y4T A;  5LSZ A;  4NJ5 A;  2C0M A;  3M56 A;  5G05 C;  2PL2 A;  5LSX A;  4G23 A;  1QQE A;  2FO7 A;  4JL0 A;  2HYZ A;  3IEG A;  5TTF A;  4UQX A;  5JJ6 A;  3ZGQ A;  1O9S A;  3CV0 A;  5D0O D;  3ZN3 A;  4WUY A;  4YPE A;  5TEG A;  2VGY A;  3ASH A;  3GZ2 A;  5FTP A;  3UQ3 A;  4JDS A;  2W5Y A;  3RU0 A;  2R3A A;  3SF4 A;  2QPW A;  4H7Y A;  3K9I A;  3S7D A;  1PEG A;  3Q47 B;  2HR2 A;  3UUX A;  3HYM B;  1Y8M A;  4LDG A;  3ASD A;  2OOE A;  2XGS A;  1XNF A;  3R9A B;  5FZR A;  4XIF A;  2WQH A;  5JIY A;  4J8F A;  4U04 A;  5KJM A;  2DBA A;  4UI9 K;  3MV2 B;  4WNF A;  3MO5 A;  3ZPJ A;  3RO3 A;  3CBO A;  4GA2 A;  1YA0 A;  3ASG A;  3WXX A;  1XQH A;  4I2W A;  3CK8 A;  4N39 A;  1MVH A;  4G1T A;  3FWV A;  2XCC A;  5FZQ A;  1HXI A;  3OXG A;  2KAT A;  3MA5 A;  4ME2 A;  4Y6W A;  5KJN A;  4RG6 A;  1IHG A;  1MT6 A;  2PQR A;  5AYW D;  2E2E A;  4GCO A;  5TH7 A;  4AU7 A;  4APO A;  4HOT A;  3TG5 A;  2L6J A;  2FI7 A;  1A17 A;  1E96 B;  4BTB A;  4BUP A;  5A6C A;  1ELR A;  3VUZ A;  5BNW A;  2VSY A;  3Q49 B;  2VSN A;  4N3A A;  4BTA A;  3FFL A;  1KT0 A;  5JJ7 A;  5KJL A;  3M58 A;  4U0S A;  1NA3 A;  3IHX A;  5EG2 A;  2FF4 A;  3KMT A;  3S7F A;  1IYG A;  4N5C A;  4F3V A;  3ESK A;  2PZI A;  1NZN A;  3KD7 A;  3S7B A;  2NC9 A;  4J8D A;  2PQN A;  3RJW A;  3S8P A;  3CVQ A;  4YNM A;  5CPR B;  4J7F A;  5DIZ A;  5HQ8 A;  3KAE A;  1P5Q A;  2VGX A;  4JLG A;  4J7I A;  4J8E A;  2G46 A;  3Q5M A;  3N71 A;  3QKY A;  4N2S A;  5C1D A;  4YNP A;  2UY1 A;  1KT1 A;  4EQF A;  3CK7 A;  5AYF A;  5KJK A;  4KXK B;  1FCH A;  3VV0 A;  3ULQ A;  4UQZ A;  4NVQ A;  4LEU A;  2UWJ G;  4YVQ C;  2VGX B;  4I17 A;  3M5A A;  3LCA A;  2RFI A;  5G04 J;  4KBQ A; 
#chains in the Genus database with same CATH topology
 4TXQ A;  5BV1 A;  2P9L G;  4MLP A;  2IY0 C;  4JPS A;  4AXH A;  2WQ6 A;  3RO2 A;  4JZY A;  1SZA A;  4BSZ B;  3SWC A;  3RQ4 A;  3ZFW A;  3JYS A;  4E47 A;  5CHE E;  1WM5 A;  2R03 A;  3C72 A;  3VTY A;  2GRQ B;  4IJD A;  2WXO A;  2WMN A;  4XE0 A;  2GRM A;  1V55 E;  2V4H C;  2V4L A;  1U2V G;  3HRA A;  3E4B A;  1UJK A;  4HBD A;  2YNQ A;  2LUH A;  1N6A A;  4KZ0 A;  5ENN A;  3B7S A;  3B7T A;  3CQG B;  3ZHE B;  3IHY A;  5BPP A;  4ACK A;  2R5S A;  1DCE A;  3QWW A;  4U0U A;  4EEC A;  4LNB A;  3TL5 A;  3FH5 A;  3UTM A;  2WXH A;  2XCB A;  2P9U G;  5ARG A;  3SD5 A;  3CST A;  4UUC A;  4M3O A;  5CRU A;  4HOR A;  1U3D A;  3MGB A;  2F8X K;  4GMJ A;  2IFU A;  4E85 A;  4I51 A;  2LAH A;  1HH8 A;  2XS8 A;  4HRN A;  4YVO A;  4AM9 A;  3G2U A;  4NIK A;  3LXU X;  4GA1 A;  3ASO E;  3LVR E;  3CEQ A;  1N52 A;  3FTY A;  2H6F A;  1NI1 A;  3C98 A;  4XI0 A;  1SZ9 A;  2AWI A;  4GA0 A;  3KS2 A;  2IO2 C;  5KCM A;  3Q15 A;  4RSY A;  4GPK A;  2NXP A;  2ETA A;  2XGM A;  4N3B A;  4BT9 A;  2LNI A;  3TWV A;  4AEZ C;  5FT9 A;  4U8H A;  4GML A;  2RFM A;  3FEY A;  2QYU A;  1BPO A;  5EX0 A;  2EQX A;  5EIB E;  4HRM B;  3RAY A;  3BQO A;  4DI4 A;  3AAA C;  3URZ A;  2WXG A;  5BW8 C;  4FLH A;  4AV7 A;  4G25 A;  3PRZ A;  4AY6 A;  3BEE A;  3Q7A A;  5FQ6 A;  5JHN A;  4PS3 A;  3MYV A;  3FU0 A;  5T0K A;  1W3B A;  2OND A;  4L1B A;  2ILR A;  2DVW A;  2WXR A;  1Z5S C;  4HRL A;  4U7E B;  5E76 A;  3VLE A;  3EP0 A;  1WG0 A;  1QYM A;  4FP7 A;  4GYO A;  4Q96 A;  2L0I A;  4O1P A;  1QZ2 A;  2CFU A;  1JPL A;  4CGV A;  1N4P A;  5M72 A;  3FTX A;  1AWC B;  4KZC A;  3RKV A;  3O4Z A;  2PNN A;  1H0A A;  2WXQ A;  2ZXW E;  3B7B A;  4GTM A;  5HS0 A;  3D3M A;  3ZIM A;  2MRI A;  4BFR A;  4GZD A;  3TWX A;  2CG3 A;  1EYH A;  4JA7 A;  4JEU A;  3M57 A;  1E8W A;  2YHC A;  4DI3 A;  4A55 A;  4FMU A;  4OVU A;  4DRX E;  4GTV A;  3MV3 B;  4I9E A;  1KZO A;  3UKR G;  2YIN A;  5KWD A;  1WAO 1;  3IXE A;  1WY6 A;  4KVM A;  3TXM A;  1NFI E;  3HXE A;  1Y6I A;  4J0U A;  4KVO A;  4Y6C A;  1KLX A;  2WXM A;  4F1S A;  4RZ0 A;  1SVX A;  4K5B A;  5LSZ A;  4XZ4 A;  4Q69 A;  3M56 A;  2PL2 A;  3RRM B;  3E37 A;  3D9M A;  3CVX A;  2HM8 A;  3RAU A;  3UM2 A;  1O9S A;  1DNP A;  5D0O D;  2XEH A;  3AG2 E;  2WXI A;  3ASH A;  5ANR A;  5FTP A;  5BXO A;  2W5Y A;  5CRV A;  3SF4 A;  3Q47 B;  1D9S A;  3HYM B;  4YDY A;  1S0P A;  1OWM A;  1Y8M A;  3V31 A;  2I9C A;  3SFY A;  5T3R A;  3ASD A;  1GW6 A;  2OOE A;  3E34 A;  5FZR A;  3S2A A;  4DX6 D;  5KJM A;  4K03 A;  4GMR A;  1UN9 A;  2BF0 X;  1YMP A;  3ZPJ A;  1MJ0 A;  3L16 A;  4Z68 A;  1MX6 A;  4F1P A;  1YA0 A;  2LAI A;  1H6P A;  4OAV B;  2YHE A;  3EU9 A;  1XQH A;  4F53 A;  4I2W A;  3CK8 A;  4G1T A;  5BUZ A;  4APF A;  1HXI A;  3OXG A;  3LJN A;  3L13 A;  4G11 A;  2VSO E;  4XKB A;  4ME2 A;  4OAU C;  3JUI A;  4Y6W A;  1IHG A;  3BU8 A;  4FHK A;  3E33 A;  2IJG X;  3LJ3 A;  4HOT A;  3TG5 A;  1DC2 A;  1BLX B;  4CT4 A;  2B0O E;  2GGF A;  3ZYQ A;  3DST A;  4HNA D;  4K5C A;  3FY4 A;  4BTB A;  4BUP A;  1IHB A;  2KZT A;  1PY1 A;  2WXJ A;  4N3A A;  2VSN A;  2H6G A;  3DEO A;  5ANL A;  3OAW A;  5EG2 A;  2FF4 A;  3S7F A;  4RLY A;  4G8L A;  3HIZ A;  4N5C A;  4F3V A;  3FU6 A;  4FJY A;  2NC9 A;  4J8D A;  3L82 A;  2EIN E;  3S8P A;  2LXM A;  2ZGD A;  4YNM A;  2R59 A;  2X6F A;  3V2O A;  1K1B A;  5DIZ A;  4ANV A;  3HG0 D;  3KAE A;  3FUH A;  3ZYK A;  1NL4 A;  4JB8 P;  3G2W A;  4UWK A;  2X6J A;  3Q5M A;  3QKY A;  4N2S A;  4IYP A;  3C5R A;  2UY1 A;  3ZYL A;  1EPU A;  1KT1 A;  1SA4 A;  4FJZ A;  2RFA A;  5AYF A;  5KBA A;  2NYJ A;  4KXK B;  5KJK A;  3VV0 A;  3I5P A;  4NVQ A;  5JA4 D;  2UWJ G;  2VSX E;  2LXL A;  3AG4 E;  4I43 A;  4AOF A;  5LX8 A;  3Q9N C;  4TXP A;  5AQA A;  2ETC A;  2GRP B;  2IU1 A;  1MQS A;  3WG7 E;  2J07 A;  2X6K A;  2FBN A;  4JHJ A;  4G2V A;  4PDX A;  4RVB A;  1N94 A;  2R2L A;  4BX9 A;  4GTP A;  2R17 C;  4MRU A;  5G04 C;  3TXN A;  3CIA A;  2LSV A;  3Q4A B;  3TWT A;  2XEV A;  3FU5 A;  4HOS A;  1H3I A;  3CVU A;  1VDY A;  4BWR A;  3MZL B;  3T5V A;  3PE4 A;  4JA9 A;  4G24 A;  1RZ4 A;  3PUJ A;  3LKU A;  4HI8 A;  3FUK A;  3CVW A;  4HVB A;  3QDN A;  5AEN A;  5ENS D;  1FT1 A;  3ZU7 B;  4GTO A;  4AIF A;  3SW9 A;  2V5F A;  4YDW A;  4OYS A;  5EKQ D;  4FLB A;  4AVX A;  4UQY A;  1E7V A;  4L7T A;  4HFG A;  3UM3 A;  1KPS B;  3NOG D;  3LEW A;  2ZIS A;  2VQ2 A;  3UKU G;  4U95 D;  4J7W A;  1JWF A;  4ILI A;  3Q9U C;  4G26 A;  3FUI A;  3D9P A;  2J49 A;  3VTX A;  4LG6 A;  4U0Z A;  4E6H A;  3PE3 A;  2JLB A;  3AS5 A;  3TG4 A;  1FPP A;  3ZYM A;  3FU3 A;  2M63 A;  4B0Z A;  4WNE A;  3T8M A;  3I4G A;  2GRR B;  2F0Y A;  2GW1 A;  4BSX A;  3L22 A;  5AN8 A;  3HXD A;  4GZ6 A;  4A3T A;  1BU9 A;  4BES A;  4FA6 A;  3Q78 A;  2I6H A;  1IKN D;  1MX4 A;  2IGQ A;  1MHQ A;  4WND A;  4EZL A;  5CBN A;  4UWF A;  3FPD A;  4YDE A;  4HXI A;  3SQV A;  4ATG A;  5JHB A;  3PEV B;  5CCM A;  3G2V A;  4MI0 A;  3L54 A;  4YPU A;  3M59 A;  5E75 A;  4UWG A;  2JEK A;  4ABN A;  2OEV A;  1O5M A;  3HXF A;  2IOL A;  4UI9 J;  1PAQ A;  2IO3 C;  4N3C A;  4UWH A;  4JHK A;  2BQZ A;  1H6K A;  1ZU2 A;  5FQ8 A;  3JCK C;  3HXC A;  4MKT A;  1TEZ A;  4FHJ A;  4ILG A;  3F9X A;  1S63 A;  1SQM A;  5T4Y A;  1S64 A;  3CSF A;  5AQ7 A;  5AQ9 A;  1H2T C;  3Q7F A;  3RRU A;  2PM7 A;  3F9Z A;  3CBM A;  5HI7 A;  4RG9 A;  3QWP A;  3K5K A;  4QEN A;  4R7L A;  2FUL A;  3EHM A;  2V8S E;  1K1A A;  3FUD A;  3PEU B;  5AJD A;  3U64 A;  5C2Y A;  4J6I A;  2YQ8 A;  3TWS A;  4FUL A;  2VYI A;  3QK0 A;  3M54 A;  3DB5 A;  2P9I G;  2XPY A;  3FTV A;  4LSZ E;  4ATZ D;  3L08 A;  3BG1 B;  3BO5 A;  5A7D B;  3UIN C;  4CEM A;  2ETB A;  4GTS A;  4DJA A;  1TN6 A;  3PH0 C;  1OWP A;  3SNX A;  2EIM E;  5B3S E;  4GYY A;  4C0M A;  5BT1 A;  4TXR A;  3W9G A;  4B8A A;  2XEE A;  2XRZ A;  3KEZ A;  3GW4 A;  3UMV A;  2P9K G;  4XX5 A;  3Q73 A;  3OTN A;  2B6C A;  1S70 B;  3DSW A;  1KZP A;  4GCN A;  5CCL A;  3TJP A;  3LYA A;  2BED A;  3QOU A;  3FUE A;  3AG3 E;  4JD2 G;  5LSX A;  4G23 A;  2FO7 A;  4JL0 A;  5HRY A;  2HYZ A;  2VJ8 A;  3DWL G;  3TWU A;  4UQX A;  3ESL A;  3SBT B;  5TEG A;  4GPM A;  3FTU A;  2J4B A;  2KBX A;  2AJA A;  4HQD A;  5H7P A;  2QPW A;  4H7Y A;  3K9I A;  3S7D A;  1HX8 A;  2A5E A;  5CED B;  3X2Q E;  4ANW A;  4LDG A;  3SFZ A;  4ZFH A;  3PVL A;  4ZHB A;  2GRN B;  1XNF A;  4U8V D;  4XIF A;  2WQH A;  2AXU A;  5JIY A;  3HHM A;  1FVH A;  1MYO A;  3UIP C;  2DBA A;  2GRL A;  4M7C A;  5AQB A;  3MO5 A;  1OCR E;  1XGW A;  2MYO A;  3RO3 A;  4DX7 D;  4HB5 A;  2KM4 A;  3ASG A;  2CFZ A;  2IQC A;  1TNZ A;  4KMO A;  4GTT A;  3C3R A;  4N39 A;  1JUQ A;  4IUL A;  2ION A;  5FZQ A;  2KAT A;  4MS6 A;  2H6I A;  5AYW D;  2DWZ A;  1O1T A;  5JMN D;  3NOC D;  4BX8 A;  4APO A;  1E8X A;  3UT8 A;  2X3M A;  2L6J A;  1ELR A;  3AJI A;  3Q49 B;  4EBA G;  1KT0 A;  5KJL A;  1NA3 A;  3EHQ A;  4I6G A;  4GU5 A;  3ZUV B;  1BI7 B;  3ZKJ A;  1OXJ A;  3ESK A;  4B93 B;  1NZN A;  2PQN A;  4HLL A;  5KNG A;  2OV8 A;  4JC8 A;  2KZT B;  4L23 A;  2V0P A;  1P5Q A;  2VGX A;  1NP7 A;  1TNY A;  3T5X A;  1L5J A;  2J8S D;  4N5Q A;  4DX2 A;  5T8I A;  2XRY A;  5C1D A;  1OWN A;  3JXJ A;  1N11 A;  4U8Y D;  5BXU A;  3EIQ C;  1UG3 A;  1Z6T A;  3ULQ A;  4UQZ A;  2DYS E;  4YVQ C;  5LFA A;  3I3N A;  1HG5 A;  1N54 A;  5CMW A;  4I17 A;  3UX4 A;  1BD8 A;  2RFI A;  3DBS A;  2DIW A;  3EDT B;  5FIN A;  1ZB1 A;  3OOI A;  2J9Q A;  1HU3 A;  2OCC E;  2UY1 B;  4LER A;  4BT8 A;  1OUV A;  2CHZ A;  2IF4 A;  3CBP A;  3NF1 A;  4GZ5 A;  1ML9 A;  3I4R B;  3AG1 E;  5AAO A;  1ELW A;  4O6F A;  2CHW A;  4CGW A;  4C1Q A;  2QY7 A;  3DXK G;  4NRH B;  3J5Q B;  4L9P A;  5JHA A;  3UPV A;  3JQ1 A;  3AS4 A;  4Z4P A;  2I1K A;  4DX1 A;  4BER A;  5EIL A;  1HFA A;  2WVI A;  4NAC A;  3MX3 A;  1EF1 C;  3OXF A;  5IY5 E;  3U3W A;  3PRE A;  3KMA A;  4FC8 A;  3PZ2 A;  4UWL A;  4C48 B;  3ASF A;  4GTQ A;  4HOU A;  2XS1 A;  4K5A B;  5F6K C;  2X6I A;  3UXG A;  3LDZ A;  3DAL A;  1JCQ A;  1A5E A;  3HNA A;  1OWL A;  3RIB A;  4BY6 A;  2NSZ A;  2WXK A;  3P2B A;  1ELK A;  2EIK E;  3B13 A;  4NUR A;  3TWQ A;  1TJC A;  5JIN A;  4YPA A;  2I2O A;  1H2U A;  4IJ8 A;  2KCL A;  3QAQ A;  2AVP A;  3D9O A;  2XQ0 A;  2F8Y A;  3OPE A;  3DSX A;  4TRQ A;  1ZBP A;  4TUU A;  5ENP D;  1OT8 A;  1N3J A;  3UI2 A;  3T9K A;  3FUL A;  4U96 D;  1N4R A;  1TNO A;  3ML8 A;  5D66 A;  3ASN E;  4LRZ A;  3CVL A;  1ZKK A;  1MZC A;  3FTS A;  1HZ4 A;  2BKG A;  1DVP A;  4GZ3 A;  3R7Q A;  5D2M C;  3FP3 A;  3W9F A;  4I1M A;  4LNU D;  3CK9 A;  3P1U A;  1H6O A;  3UT4 A;  3LS8 A;  2BKK B;  1OCZ E;  3PDN A;  3AS8 A;  3RK6 A;  4I6J A;  2A5U A;  3DXM G;  3AU4 A;  1N0R A;  5EDS A;  4O1O A;  4AY5 A;  3APC A;  2R02 A;  2X38 A;  1H2V C;  1AP7 A;  3SFX A;  4I9C A;  3CVP A;  4AJW A;  3TGO A;  3D9I A;  4H12 A;  3CKC A;  4W9R A;  5LCW J;  2JV0 A;  4HI9 A;  4B94 A;  1Z3X A;  4UI9 C;  1MUF A;  1JWG A;  4I6E A;  1D8D A;  4IRU A;  3QB2 A;  2Q7F A;  4DPR A;  1EDU A;  5FQ4 A;  3E30 A;  2IOS A;  1LD8 A;  3LY7 A;  3QJZ A;  3TAX A;  4WAF A;  2XPZ A;  5F59 A;  4A3V A;  4B89 A;  2FEZ A;  3L9T A;  3EU5 A;  4PUC A;  3OS5 A;  1N95 A;  1O1R A;  4TUM A;  4I1A A;  4C9B B;  2XGO A;  3D9J A;  1HF8 A;  5G2N A;  1FT2 A;  3CKB A;  2P58 C;  3PNT B;  4GZC A;  3F9Y A;  2O8J A;  3CVN A;  2J09 A;  2WPV A;  2ZU6 B;  2RD0 A;  5T5G A;  3JUE A;  3G2S A;  2W5Z A;  4DX5 D;  5EYP F;  3ZW3 A;  3APF A;  4QEO A;  3DPD A;  2XPI A;  3UM1 A;  1N6C A;  4DLQ A;  4O60 A;  4HOQ A;  3ABL E;  3B95 A;  4NQ0 A;  5G05 J;  1PC2 A;  5G55 A;  5ENQ D;  2Y4U A;  4TV3 A;  4V3I A;  2L9B A;  2F69 A;  2C0L A;  1TNU A;  5FIO A;  4NJ5 A;  3HDX A;  2E0I A;  4ILH B;  3IEG A;  2AW6 A;  5TTF A;  2J4D A;  3SI5 A;  3FUN A;  2OVB A;  1X81 A;  5JJ6 A;  3ZGQ A;  1FVF A;  4ACL A;  3CV0 A;  4WUY A;  5CER B;  4YPE A;  3D9H A;  4EPZ A;  2DYR E;  5LP0 A;  2VGY A;  5FWQ A;  2WQ7 A;  3GZ2 A;  3CVV A;  3UQ3 A;  3BG0 B;  3RSE G;  2ZGG A;  3PZD A;  1PEG A;  4EZJ A;  3EUV A;  3UUX A;  1UJJ A;  2V5Q C;  4F6R D;  3IKO B;  2L6B A;  2WXN A;  3L17 A;  2XZT G;  5LOZ A;  1OCO E;  1HE8 A;  5KNH D;  3FTZ A;  3TWR A;  4J8F A;  4U04 A;  4BEP A;  5B1B E;  2QYJ A;  4UI9 K;  3F6Q A;  3SGH A;  3MV2 B;  5EID A;  4WNF A;  3NZU A;  3CBO A;  2RKK A;  2P9P G;  3D9N A;  5J90 A;  1IQU A;  1MVH A;  4CRW A;  1TR4 A;  2XCC A;  4X8Q A;  3EIJ A;  4RG6 A;  2PQR A;  3U66 A;  1OY3 D;  1LF8 A;  4A63 B;  3L6A A;  4JW1 A;  4K0R A;  1U3C A;  2FI7 A;  1A17 A;  3FH8 A;  3UT7 A;  3NBN B;  1QNF A;  2VSY A;  3FFL A;  3CHS A;  3PZ3 A;  4U0S A;  4L2Y A;  3CLJ A;  3KMT A;  5ITZ F;  3UM0 A;  1IYG A;  2WMO A;  3ZNG A;  1TN7 A;  2R05 A;  3QNK A;  3KD7 A;  3S7B A;  3RJW A;  3V30 A;  1INZ A;  5CPR B;  4FU3 A;  3JQ0 A;  5AAR A;  3ABM E;  5B1A E;  3JXI A;  3IBE A;  4I1O B;  4LUN U;  3NQP A;  4J7I A;  4J8E A;  3MKQ A;  2G46 A;  3CHM A;  4PS8 A;  3V2X A;  3N71 A;  4LNG A;  4DLO A;  3GZS A;  3ABK E;  3DSU A;  4GB9 A;  1FCH A;  3T8K A;  4LEU A;  1YYH A;  1HO8 A;  3MJW A;  2VGX B;  4J8S A;  2XEN A;  4U63 A;  3M5A A;  4KBQ A;  3MO0 A;  1K8K G;  1E8Y A;  2PM6 A;  4QFV A;  1D8E A;  4YDO A;  4KT6 B;  5CEC B;  3ZHE A;  4GTR A;  4PS7 A;  4WNG A;  3DEP A;  3ML9 A;  2BUG A;  3QAR A;  3U4T A;  2HO1 A;  1UOH A;  2Y0B G;  3V79 K;  5ENO D;  4EZK A;  2LSU A;  3R9M A;  3NZS A;  3LPZ A;  2KCV A;  3HVE B;  3F9W A;  3ZEF A;  2P2C P;  4B8C B;  3M53 A;  2OEW A;  4MBG A;  4IN3 B;  3FUM A;  3S7J A;  2A4Z A;  3MO2 A;  2KC7 A;  4KYO B;  1Q2Z A;  3SY2 A;  4XI9 A;  4URK A;  3Q75 A;  1WDY A;  2VTB B;  2QZA A;  1N4S A;  5JJ0 A;  2Y3A A;  4EBA A;  4GAA A;  1B89 A;  3Q79 A;  1IQR A;  1N9A A;  2XZD G;  5JJT A;  5J08 A;  1V54 E;  4CZ2 D;  3QWV A;  5FQ7 A;  1O1S A;  2DZO A;  3GZ1 A;  3FEX A;  5ENT D;  3FHE A;  4QEP A;  3TWW A;  3M55 A;  1RW2 A;  2L0T B;  3PUK A;  3DRA A;  4O30 A;  5FJY A;  3QC1 A;  4FAD A;  4F7A A;  3PS6 A;  5EYL A;  3ZRH A;  3CR3 A;  3C3O A;  4G8K A;  3SZ7 A;  2JAB A;  5BV0 A;  3SBS A;  3EHR A;  4DUI A;  3MEK A;  4CDR A;  3LVQ E;  3OXL A;  3FH7 A;  3ULY A;  2QC9 A;  5ARF A;  1UN8 A;  2GRO B;  3HVE A;  5T0M A;  2I1J A;  5D0Q D;  2MHK A;  1TNB A;  1H19 A;  1OCC E;  1X5B A;  1N4Q A;  1LD7 A;  4J83 A;  3ZXP A;  3CGH A;  3IV0 A;  3LY8 A;  3RJV A;  3MKR A;  3HXB A;  5DBK A;  1NA0 A;  5F6L A;  3C3Q A;  3DSV A;  5LCW C;  3J5P A;  2VTB A;  4CDM A;  3ONK A;  4CT0 A;  3SHF A;  2IEJ A;  2EIJ E;  2C2L A;  4A1S A;  4WWN A;  3FUF A;  4HS2 A;  2WXP A;  3E32 A;  4LCT A;  2J08 A;  2Y69 E;  5FZS A;  1MX2 A;  4N2Q A;  4H7X A;  3VLF A;  2XHE A;  4QQI A;  3CVY A;  3IHV A;  3NAW A;  3O48 A;  5EX3 A;  5F5E A;  3LY9 A;  4J8O A;  3CHP A;  4AP2 A;  2H6H A;  3EJN A;  2VGE A;  3B7U X;  3DSS A;  4Q94 A;  2OVF A;  2Y1L E;  3NB2 A;  4GYW A;  4YND A;  3ISM C;  4WWP A;  1MVX A;  1Z3Y A;  1OWO A;  1YCS B;  4U07 A;  2EIL E;  4I2Z A;  4D10 C;  3DPY A;  3GYZ A;  2X6H A;  4JXT A;  3KSQ A;  4MI5 A;  3PZ4 A;  4XKC A;  3ZVV A;  4JHR A;  1IXV A;  3KMJ A;  2QFC A;  4WWO A;  1K3Z D;  2KCK A;  2Y4T A;  4HLE A;  2C0M A;  5G05 C;  4C0E A;  1QQE A;  3CHQ A;  2WM9 A;  1JCS A;  1UW4 B;  1SW6 A;  3KEA A;  2RG8 A;  3U9W A;  2CG2 A;  2AXZ A;  3CQC B;  3D9K A;  2DZN A;  3ZN3 A;  2DCP A;  1E90 A;  1TN8 A;  3R7R A;  4ANU A;  2HE0 A;  4JDS A;  3ULE G;  2KXP C;  1G3N B;  3RU0 A;  2R3A A;  1N0Q A;  4CDN A;  2HR2 A;  4JVS A;  4EHM A;  3BUA A;  4CYM D;  3VLD A;  2BTD A;  2XGS A;  5HKP A;  3R9A B;  5A23 A;  2LO6 A;  3SO8 A;  1SA5 A;  3B7R L;  1BI8 B;  4JEH A;  2FO1 E;  2P9S G;  1E7U A;  1HS6 A;  3G2T A;  1TJF A;  4GA2 A;  3WXX A;  5EN5 D;  1HG2 A;  3ZXS A;  3FWV A;  4A1G A;  3MA5 A;  5KJN A;  1MT6 A;  3RRN B;  2E2E A;  4GCO A;  5TH7 A;  4AU7 A;  3ONL A;  5CEA A;  1DCQ A;  3UIO C;  5CMY A;  3FUJ A;  3FTW A;  2F37 A;  1E96 B;  5A6C A;  1TYQ G;  5ENR D;  3VUZ A;  4OVV A;  4RQI A;  5BNW A;  4BTA A;  5JJ7 A;  3M58 A;  3KSL A;  3IHX A;  2WB2 A;  5AJL A;  3ENE A;  4PH4 B;  2PZI A;  3CHO A;  2WXL A;  4XEI G;  3CVQ A;  5CBO A;  3PNL B;  4J7F A;  5AIJ A;  4ANX A;  2CHX A;  3APD A;  5HQ8 A;  2WXF A;  4JLG A;  3FDH A;  2ZIR A;  2AXV A;  2P9N G;  1JCR A;  4J8Y A;  3CHR A;  4YNP A;  3MCX A;  1LTX A;  4EQF A;  3CK7 A;  4BET A;  1E8Z A;  3PZ1 A;  3EHN A;  4CCA A;  2MOW A;  4DK5 A;  3AU5 A;  4L2L A;  3D9L A;  4P29 A;  3LCA A;  1QBQ A;  3MKQ B;  5G04 J; 
#chains in the Genus database with same CATH homology
 3EDT B;  2X6K A;  3OOI A;  3MO0 A;  5BV1 A;  4MLP A;  2FBN A;  2J9Q A;  4G2V A;  4JHJ A;  4JPS A;  4PDX A;  1E8Y A;  1HU3 A;  2PM6 A;  4RVB A;  3RO2 A;  4AXH A;  2WQ6 A;  4BT8 A;  2UY1 B;  4JZY A;  4LER A;  4BX9 A;  1SZA A;  1OUV A;  3SWC A;  4QFV A;  3RQ4 A;  3ZFW A;  3JYS A;  4E47 A;  2R17 C;  5CHE E;  4MRU A;  1WM5 A;  2CHZ A;  2IF4 A;  5G04 C;  3TXN A;  3NF1 A;  4KT6 B;  3CIA A;  3VTY A;  3CBP A;  4IJD A;  4GZ5 A;  2LSV A;  3ZHE A;  2WXO A;  4PS7 A;  2WMN A;  4WNG A;  3Q4A B;  4XE0 A;  3ML9 A;  1ML9 A;  2GRM A;  2XEV A;  3FU5 A;  3I4R B;  4HOS A;  2BUG A;  3QAR A;  1ELW A;  3U4T A;  1H3I A;  3CVU A;  1VDY A;  2HO1 A;  4O6F A;  2CHW A;  2V4L A;  4BWR A;  3MZL B;  3T5V A;  3E4B A;  4CGW A;  4C1Q A;  2QY7 A;  3PE4 A;  4EZK A;  1UJK A;  4JA9 A;  4G24 A;  3PUJ A;  4NRH B;  3LKU A;  2YNQ A;  2LSU A;  5JHA A;  3UPV A;  1N6A A;  3NZS A;  4KZ0 A;  5ENN A;  3LPZ A;  3B7S A;  3JQ1 A;  3FUK A;  2KCV A;  3CVW A;  3B7T A;  3CQG B;  3AS4 A;  4HVB A;  4Z4P A;  3HVE B;  3IHY A;  2I1K A;  3ZHE B;  5BPP A;  3QDN A;  4ACK A;  3F9W A;  3ZEF A;  5AEN A;  4B8C B;  2R5S A;  3M53 A;  3QWW A;  4U0U A;  4EEC A;  1HFA A;  2WVI A;  3FUM A;  4IN3 B;  3S7J A;  4NAC A;  2A4Z A;  3MX3 A;  3MO2 A;  3TL5 A;  3FH5 A;  2KC7 A;  1EF1 C;  3OXF A;  3U3W A;  3PRE A;  4KYO B;  2WXH A;  4AIF A;  3SW9 A;  3KMA A;  2V5F A;  4OYS A;  4FC8 A;  4XI9 A;  4UWL A;  2XCB A;  3ASF A;  5ARG A;  5EKQ D;  4FLB A;  4URK A;  4AVX A;  4HOU A;  4UQY A;  2VTB B;  3SD5 A;  1E7V A;  5F6K C;  3CST A;  2X6I A;  4L7T A;  3LDZ A;  4HFG A;  2Y3A A;  4EBA A;  4GAA A;  5JJ0 A;  1B89 A;  4M3O A;  3DAL A;  1IQR A;  1U3D A;  3LEW A;  4HOR A;  2VQ2 A;  5JJT A;  3HNA A;  1OWL A;  3MGB A;  3RIB A;  5J08 A;  4BY6 A;  2NSZ A;  2WXK A;  3P2B A;  4GMJ A;  1ELK A;  3B13 A;  4NUR A;  1JWF A;  4ILI A;  1TJC A;  5JIN A;  2IFU A;  4E85 A;  3QWV A;  5FQ7 A;  4I51 A;  4G26 A;  2I2O A;  4YPA A;  1H2U A;  2LAH A;  4IJ8 A;  2KCL A;  3QAQ A;  2AVP A;  3D9O A;  2XQ0 A;  1HH8 A;  3GZ1 A;  3FEX A;  3FUI A;  3D9P A;  2J49 A;  3VTX A;  4YVO A;  3OPE A;  3FHE A;  4U0Z A;  4AM9 A;  4QEP A;  4TRQ A;  4E6H A;  3PE3 A;  2JLB A;  3AS5 A;  3TG4 A;  1ZBP A;  4TUU A;  3G2U A;  3M55 A;  3PUK A;  2L0T B;  3ZYM A;  3LXU X;  4GA1 A;  3LVR E;  3CEQ A;  3FU3 A;  2M63 A;  4O30 A;  4B0Z A;  1N52 A;  3FTY A;  3C98 A;  4WNE A;  4XI0 A;  3T8M A;  1SZ9 A;  5FJY A;  1N3J A;  3I4G A;  3QC1 A;  2AWI A;  3FUL A;  2GW1 A;  4BSX A;  4GA0 A;  3KS2 A;  4FAD A;  3L22 A;  4GZ6 A;  5KCM A;  3Q15 A;  4RSY A;  4F7A A;  4GPK A;  4A3T A;  2NXP A;  3ML8 A;  3PS6 A;  2XGM A;  4LRZ A;  4N3B A;  4BT9 A;  3ZRH A;  3CR3 A;  4FA6 A;  3CVL A;  1ZKK A;  2LNI A;  3SZ7 A;  2I6H A;  4AEZ C;  5FT9 A;  3FTS A;  1HZ4 A;  4U8H A;  4GML A;  1DVP A;  1MHQ A;  4GZ3 A;  4WND A;  3R7Q A;  2IGQ A;  3FEY A;  4EZL A;  5BV0 A;  3FP3 A;  4UWF A;  3FPD A;  3SBS A;  4HXI A;  4I1M A;  1BPO A;  3CK9 A;  3MEK A;  4CDR A;  5EX0 A;  2EQX A;  3P1U A;  4ATG A;  3UT4 A;  3LVQ E;  3LS8 A;  5JHB A;  3PEV B;  3PDN A;  5CCM A;  3G2V A;  5LFA A;  3AS8 A;  4MI0 A;  3L54 A;  3OXL A;  3RK6 A;  3M59 A;  4I6J A;  4YPU A;  2A5U A;  3FH7 A;  3RAY A;  4DI4 A;  5E75 A;  3URZ A;  2WXG A;  5BW8 C;  3AU4 A;  4UWG A;  4FLH A;  2JEK A;  4AV7 A;  4ABN A;  4G25 A;  5EDS A;  3PRZ A;  5ARF A;  1UN8 A;  4AY5 A;  4AY6 A;  3APC A;  2IOL A;  3BEE A;  4UI9 J;  5FQ6 A;  1PAQ A;  3HVE A;  5JHN A;  2X38 A;  1H2V C;  5T0M A;  2I1J A;  4PS3 A;  4N3C A;  4UWH A;  5D0Q D;  3MYV A;  3FU0 A;  2MHK A;  5T0K A;  4I9C A;  1W3B A;  2OND A;  1H19 A;  4JHK A;  2BQZ A;  4L1B A;  3CVP A;  4AJW A;  1X5B A;  3TGO A;  2ILR A;  3D9I A;  1H6K A;  4H12 A;  3CKC A;  1ZU2 A;  4W9R A;  5FQ8 A;  5LCW J;  2JV0 A;  4B94 A;  4J83 A;  1Z3X A;  2WXR A;  3JCK C;  4MKT A;  4UI9 C;  5E76 A;  3VLE A;  3CGH A;  3IV0 A;  3LY8 A;  3RJV A;  1TEZ A;  4FHJ A;  1JWG A;  1MUF A;  3MKR A;  4I6E A;  4ILG A;  4IRU A;  3QB2 A;  3F9X A;  2Q7F A;  5DBK A;  3EP0 A;  4FP7 A;  4DPR A;  1SQM A;  1NA0 A;  5T4Y A;  4GYO A;  5F6L A;  1EDU A;  4Q96 A;  5LCW C;  2L0I A;  3CSF A;  2VTB A;  5FQ4 A;  4CDM A;  1QZ2 A;  2CFU A;  1H2T C;  1JPL A;  2IOS A;  3LY7 A;  3QJZ A;  3RRU A;  3TAX A;  3ONK A;  4WAF A;  4CT0 A;  3SHF A;  4CGV A;  5M72 A;  2XPZ A;  2C2L A;  4A1S A;  5F59 A;  2PM7 A;  3FTX A;  4WWN A;  4A3V A;  4B89 A;  3FUF A;  4HS2 A;  3F9Z A;  2FEZ A;  3CBM A;  2WXP A;  5HI7 A;  4KZC A;  4RG9 A;  4LCT A;  2J08 A;  3QWP A;  4PUC A;  3K5K A;  3OS5 A;  4QEN A;  4R7L A;  5FZS A;  3RKV A;  4I1A A;  3O4Z A;  1H0A A;  2FUL A;  3EHM A;  4C9B B;  2V8S E;  2WXQ A;  2XGO A;  3D9J A;  3FUD A;  4H7X A;  3VLF A;  3PEU B;  4N2Q A;  1HF8 A;  5G2N A;  2XHE A;  3CKB A;  5AJD A;  3U64 A;  3D3M A;  5C2Y A;  4J6I A;  2P58 C;  2YQ8 A;  3CVY A;  3ZIM A;  2MRI A;  3IHV A;  4FUL A;  2VYI A;  3O48 A;  3QK0 A;  4BFR A;  5EX3 A;  3DB5 A;  3M54 A;  2XPY A;  5F5E A;  3FTV A;  3PNT B;  4GZC A;  3LY9 A;  4GZD A;  3F9Y A;  3L08 A;  4J8O A;  3CHP A;  3BG1 B;  2O8J A;  2CG3 A;  5A7D B;  1EYH A;  4JA7 A;  4JEU A;  4CEM A;  3BO5 A;  3CVN A;  2J09 A;  4AP2 A;  2WPV A;  3M57 A;  1E8W A;  2ZU6 B;  3EJN A;  4DJA A;  3PH0 C;  2YHC A;  2RD0 A;  1OWP A;  3SNX A;  4DI3 A;  4GYY A;  3B7U X;  5T5G A;  4A55 A;  4FMU A;  4OVU A;  4Q94 A;  2OVF A;  4C0M A;  3G2S A;  5BT1 A;  2W5Z A;  4GYW A;  3ZW3 A;  4YND A;  4B8A A;  3APF A;  3MV3 B;  4WWP A;  4I9E A;  2XRZ A;  1MVX A;  2YIN A;  3DPD A;  3KEZ A;  4QEO A;  2XPI A;  1Z3Y A;  1OWO A;  3GW4 A;  4U07 A;  1N6C A;  1WAO 1;  4DLQ A;  4HOQ A;  1WY6 A;  4I2Z A;  3UMV A;  4D10 C;  3GYZ A;  2X6H A;  4JXT A;  4KVM A;  3TXM A;  4MI5 A;  4XKC A;  3ZVV A;  4JHR A;  4XX5 A;  4NQ0 A;  4J0U A;  5G05 J;  1Y6I A;  1PC2 A;  5G55 A;  3OTN A;  3KMJ A;  2QFC A;  4KVO A;  2Y4U A;  4WWO A;  4Y6C A;  4TV3 A;  4V3I A;  1KLX A;  2WXM A;  4GCN A;  4F1S A;  2L9B A;  5CCL A;  3TJP A;  3LYA A;  2F69 A;  4RZ0 A;  3QOU A;  2C0L A;  2KCK A;  2Y4T A;  3FUE A;  5LSZ A;  4NJ5 A;  4XZ4 A;  4HLE A;  4Q69 A;  3HDX A;  2C0M A;  3M56 A;  5G05 C;  2PL2 A;  4C0E A;  4G23 A;  5LSX A;  1QQE A;  3CHQ A;  2FO7 A;  2E0I A;  2WM9 A;  4ILH B;  4JL0 A;  2HYZ A;  1UW4 B;  3RRM B;  3IEG A;  2AW6 A;  3D9M A;  2VJ8 A;  5TTF A;  2RG8 A;  3U9W A;  2CG2 A;  2J4D A;  3SI5 A;  3CVX A;  3FUN A;  2OVB A;  4UQX A;  5JJ6 A;  2HM8 A;  2AXZ A;  3ZGQ A;  1O9S A;  3CQC B;  3ESL A;  1FVF A;  4ACL A;  3CV0 A;  3D9K A;  1DNP A;  5D0O D;  3SBT B;  3ZN3 A;  4WUY A;  4YPE A;  5TEG A;  4EPZ A;  2WXI A;  2DCP A;  1E90 A;  3R7R A;  3FTU A;  5LP0 A;  2J4B A;  2VGY A;  4ANU A;  5FWQ A;  2WQ7 A;  3ASH A;  3GZ2 A;  5ANR A;  5FTP A;  3CVV A;  3UQ3 A;  4JDS A;  3BG0 B;  2W5Y A;  3RU0 A;  2R3A A;  3SF4 A;  2QPW A;  3PZD A;  3K9I A;  4H7Y A;  3S7D A;  1PEG A;  4CDN A;  1HX8 A;  3Q47 B;  4EZJ A;  2HR2 A;  3UUX A;  4JVS A;  1UJJ A;  3HYM B;  1S0P A;  1OWM A;  1Y8M A;  3VLD A;  2I9C A;  3IKO B;  4ANW A;  4LDG A;  2WXN A;  5T3R A;  3ASD A;  1GW6 A;  2BTD A;  3L17 A;  3SFZ A;  2OOE A;  3PVL A;  5LOZ A;  2XGS A;  1XNF A;  3R9A B;  5FZR A;  4XIF A;  5A23 A;  2WQH A;  2AXU A;  2LO6 A;  3S2A A;  1HE8 A;  5JIY A;  3HHM A;  1FVH A;  3B7R L;  3FTZ A;  4J8F A;  4U04 A;  5KJM A;  2DBA A;  2GRL A;  4K03 A;  4JEH A;  4UI9 K;  3SGH A;  3MV2 B;  1UN9 A;  4WNF A;  2BF0 X;  3MO5 A;  3ZPJ A;  3NZU A;  1XGW A;  1E7U A;  1HS6 A;  3RO3 A;  3L16 A;  3CBO A;  3G2T A;  1TJF A;  4GA2 A;  1YA0 A;  2LAI A;  2KM4 A;  3ASG A;  3WXX A;  2CFZ A;  2IQC A;  3D9N A;  2YHE A;  1XQH A;  4KMO A;  4F53 A;  4I2W A;  3CK8 A;  5J90 A;  1IQU A;  4N39 A;  1JUQ A;  1HG2 A;  4IUL A;  1MVH A;  4CRW A;  4G1T A;  3FWV A;  2XCC A;  2ION A;  3ZXS A;  5BUZ A;  5FZQ A;  4APF A;  1HXI A;  4A1G A;  3OXG A;  2KAT A;  3L13 A;  2VSO E;  3MA5 A;  4G11 A;  4ME2 A;  4MS6 A;  4XKB A;  3JUI A;  4Y6W A;  5KJN A;  3EIJ A;  4RG6 A;  1IHG A;  1MT6 A;  2PQR A;  3RRN B;  5AYW D;  2E2E A;  4FHK A;  3U66 A;  4GCO A;  2IJG X;  1LF8 A;  3LJ3 A;  3ONL A;  3L6A A;  5TH7 A;  4AU7 A;  4JW1 A;  4BX8 A;  4APO A;  4HOT A;  4K0R A;  5CMY A;  1E8X A;  3FUJ A;  3TG5 A;  3UT8 A;  3FTW A;  1U3C A;  2X3M A;  2L6J A;  4CT4 A;  2GGF A;  2FI7 A;  3ZYQ A;  1A17 A;  1E96 B;  3FH8 A;  3FY4 A;  4BTB A;  4BUP A;  5A6C A;  3UT7 A;  1ELR A;  3VUZ A;  2KZT A;  1PY1 A;  2WXJ A;  4OVV A;  5BNW A;  1QNF A;  2VSY A;  3Q49 B;  2VSN A;  4N3A A;  4BTA A;  3FFL A;  4EBA G;  1KT0 A;  5JJ7 A;  5KJL A;  3M58 A;  3CHS A;  1NA3 A;  4U0S A;  5ANL A;  3OAW A;  3IHX A;  4L2Y A;  3CLJ A;  4I6G A;  2FF4 A;  5EG2 A;  2WB2 A;  3KMT A;  3S7F A;  5AJL A;  1IYG A;  4GU5 A;  2WMO A;  3ENE A;  4PH4 B;  3HIZ A;  4N5C A;  4F3V A;  3ESK A;  3QNK A;  3FU6 A;  2PZI A;  1NZN A;  3CHO A;  3KD7 A;  2WXL A;  4FJY A;  3S7B A;  2NC9 A;  4J8D A;  2PQN A;  3RJW A;  3S8P A;  3CVQ A;  2OV8 A;  1INZ A;  4YNM A;  5CPR B;  2R59 A;  3PNL B;  4J7F A;  5AIJ A;  4ANX A;  2CHX A;  4FU3 A;  3JQ0 A;  2X6F A;  2KZT B;  4JC8 A;  4L23 A;  5DIZ A;  3APD A;  4ANV A;  2V0P A;  5HQ8 A;  3KAE A;  1P5Q A;  3FUH A;  2VGX A;  2WXF A;  4JLG A;  1NP7 A;  3ZYK A;  3IBE A;  4I1O B;  3G2W A;  4LUN U;  3FDH A;  3NQP A;  4UWK A;  3T5X A;  4J7I A;  2AXV A;  4J8E A;  3MKQ A;  2G46 A;  3CHM A;  1L5J A;  2X6J A;  3Q5M A;  4PS8 A;  3N71 A;  3CHR A;  3QKY A;  5T8I A;  4N2S A;  2XRY A;  5C1D A;  4IYP A;  1OWN A;  4DLO A;  4YNP A;  3GZS A;  3MCX A;  2UY1 A;  3ZYL A;  1EPU A;  1KT1 A;  4FJZ A;  4EQF A;  3CK7 A;  4GB9 A;  5AYF A;  3EIQ C;  5KJK A;  4KXK B;  1FCH A;  1E8Z A;  1UG3 A;  1Z6T A;  3VV0 A;  3I5P A;  3ULQ A;  4UQZ A;  4NVQ A;  4LEU A;  3EHN A;  2UWJ G;  2VSX E;  2MOW A;  4YVQ C;  4CCA A;  4DK5 A;  1HO8 A;  3I3N A;  3AU5 A;  1HG5 A;  3MJW A;  4I43 A;  2VGX B;  4J8S A;  4L2L A;  3D9L A;  1N54 A;  4P29 A;  4AOF A;  5CMW A;  4U63 A;  5LX8 A;  4I17 A;  3UX4 A;  3M5A A;  3LCA A;  2RFI A;  2IU1 A;  3DBS A;  1MQS A;  3MKQ B;  5G04 J;  2DIW A;  4KBQ A;  2J07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...