4YNDA

The discovery of a-893, a new cell-active benzoxazinone inhibitor of lysine methyltransferase smyd2
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
428
structure length
428
Chain Sequence
AEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of A-893, A New Cell-Active Benzoxazinone Inhibitor of Lysine Methyltransferase SMYD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Tranferase/transferase inhibitor
molecule keywords N-lysine methyltransferase SMYD2
total genus 132
structure length 428
sequence length 428
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4yndA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4yndA01
5JJ0A 2FEZA 4O30A 2RFIA 3ZPJA 2KATA 5F6KC 4CGVA 2XGOA 4W9RA 3ULQA 1B89A 5FZRA 5LCWC 4J7FA 4IJDA 4G25A 1H3IA 4UQYA 5FJYA 2C0MA 3SWCA 5F6LA 3GZ1A 2R3AA 3RIBA 3SF4A 4AIFA 1N6AA 3ZGQA 4WNGA 1YA0A 2HO1A 5FZQA 5KJMA 3TAXA 1QZ2A 1HXIA 3EP0A 3S7BA 3PE4A 3QWWA 4CGWA 4I51A 4G26A 5CCMA 3DB5A 4UQZA 2Q7FA 4Z4PA 3KS2A 4B94A 3CBOA 4GA1A 4LEUA 2NC9A 5EG2A 3S8PA 1ZBPA 4Y6CA 4I9CA 3FWVA 5M72A 3OXFA 5T0KA 3HYMB 3CBMA 4YNPA 4YVQC 3DALA 2O8JA 4G23A 4MI0A 5BNWA 1FCHA 4JDSA 3KMJA 3U3WA 4GCNA 5EX0A 2VGYA 1HZ4A 2HYZA 2KCVA 3Q5MA 4BT9A 4U0UA 1N6CA 4H7XA 2UWJG 3S7JA 1NA3A 3VTYA 3MEKA 2VGXB 1PC2A 3F9ZA 4EQFA 4AU7A 3ESKA 5KJLA 2V5FA 5LSXA 3OXLA 3OOIA 2UY1A 3UUXA 1A17A 3LY9A 4IN3B 4BTBA 3CVQA 1ELRA 5F5EA 5JJTA 3Q49B 3K5KA 4I17A 5D0QD 3ZFWA 4GZ6A 2PQRA 2P58C 4JHRA 3M57A 2J9QA 5T0MA 4UI9C 4J8FA 3AS4A 3PE3A 4JLGA 3RKVA 3M54A 2R5SA 5FT9A 4GCOA 2G46A 3GYZA 2I6HA 1MT6A 4WNDA 3U4TA 4RG6A 1MVXA 3CEQA 3CVPA 3TGOA 5JHNA 3M5AA 4YNMA 3CKCA 3CVNA 3Q47B 4I9EA 4KBQA 4E47A 4GZ3A 3LYAA 4GPKA 1WAO1 2ONDA 3ASDA 4NJ5A 1P5QA 3UPVA 3SZ7A 3RAYA 3KD7A 5EX3A 2XPIA 3QDNA 1TJCA 2KC7A 4J83A 3LPZA 1XNFA 4QEOA 4YNDA 2Y4UA 2FI7A 3M53A 4HOTA 4XI0A 3M55A 3MV3B 2YHCA 4BT8A 3RQ4A 3BEEA 4YPUA 2IF4A 4I1AA 2YQ8A 2VYIA 2AVPA 4KXKB 2XCCA 4BWRA 5FZSA 3QKYA 2KCKA 5EKQD 3M59A 2IGQA 1Y8MA 2LNIA 4HOQA 3MO5A 5KJKA 4APOA 5TTFA 4Y6WA 4NQ0A 2BQZA 2LSUA 3CBPA 3EDTB 3S7DA 1WM5A 4LDGA 4JA7A 4N3BA 4O6FA 3ZHEB 4MI5A 4NVQA 4U0ZA 5ARGA 4BUPA 1MVHA 3TG5A 3VTXA 3URZA 4GA2A 1ZU2A 2W5ZA 2GW1A 1W3BA 4NRHB 3ASFA 2FO7A 3OXGA 2OOEA 3LCAA 2DBAA 4U04A 3MKRA 4UI9K 2QPWA 4U0SA 2HR2A 3F9XA 4WNEA 2LSVA 3FFLA 3JYSA 2L6JA 2E2EA 2Y4TA 4GYOA 1KT1A 3LKUA 5BW8C 4ABNA 3F9YA 4HOSA 2FBNA 3CVLA 3CV0A 5JJ7A 5CPRB 5ARFA 2JV0A 4GYYA 1PEGA 4JA9A 4GZ5A 3CK9A 4N2SA 1HH8A 4QEPA 4WNFA 3OPEA 2PL2A 2WQHA 1OUVA 2PQNA 3FPDA 3WXXA 2C2LA 4UI9J 1N3JA 3GZ2A 4BTAA 4H7YA 4RZ0A 4N39A 2MHKA 5CCLA 5DIZA 1ML9A 1ELWA 2VQ2A 2BUGA 3F9WA 4CDRA 4J0UA 3GW4A 3MA5A 5TH7A 3ZHEA 2XGMA 1NZNA 3MO2A 2XEVA 3N71A 3QWPA 4N5CA 4FMUA 2C0LA 3FP3A 4ME2A 5C1DA 5A7DB 1IHGA 1KLXA 4UQXA 4AY6A 3RU0A 3E4BA 3QOUA 5JINA 3UQ3A 4A1SA 4U07A 2W5YA 1MUFA 5AYWD 5A6CA 3RJVA 4AM9A 2KCLA 3M58A 5DBKA 4XIFA 3QWVA 4XI9A 3M56A 3Q4AB 4YVOA 3TG4A 3KMTA 2VSNA 4HOUA 4F3VA 3IHXA 3AS8A 3IEGA 4WUYA 5FTPA 4QENA 5G04J 3ASHA 3NF1A 3CK8A 5G05J 3ZN3A 2XCBA 4AY5A 2VSYA 4GYWA 5HQ8A 3VUZA 1IYGA 3VV0A 4J8OA 3MV2B 3MO0A 5LSZA 3RO3A 1ZKKA 2WPVA 2JLBA 1QQEA 2QFCA 3RO2A 1E96B 4N2QA 4YPEA 5JIYA 4J8EA 1NA0A 1KT0A 4IJ8A 3SW9A 4N3AA 5D0OD 3S7FA 3KAEA 4J8DA 3BO5A 3LY8A 5LCWJ 4JL0A 4RG9A 2UY1B 5G04C 5TEGA 3RJWA 5G05C 5T5GA 3CKBA 5KJNA 4KYOB 2XGSA 4I2WA 2PZIA 4G24A 4I2ZA 4GA0A 4G1TA 3ASGA 3K9IA 3PDNA 4G2VA 5BT1A 4HORA 5AYFA 2IFUA 3R9AB 4YPAA 3KMAA 1XQHA 5JJ6A 5HI7A 4N3CA 3LY7A 3OS5A 5F59A 3CK7A 4J7IA 3O48A 5CHEE 3Q15A 2F69A 4C1QA 3AS5A 2VGXA 1O9SA 4H12A 3HNAA 2FF4A
chains in the Genus database with same CATH superfamily
4HNAD 3ISMC 4JC8A 1G3NB 5F6KC 1L5JA 3LDZA 1YYHA 3ZEFA 4K5AB 2WXOA 4HI8A 4BX8A 5T4YA 3C3OA 1UJJA 4G25A 2F8YA 4FLHA 3TWTA 3DSUA 3QJZA 3MZLB 2RKKA 2L6BA 5LOZA 4I43A 3GZ1A 3PUJA 4AIFA 4WNGA 4Q96A 2QYUA 2CG2A 1IQRA 1QZ2A 3S7BA 3TL5A 3S2AA 3QWWA 4CGWA 4I51A 4UQZA 3R7QA 3IHVA 3E30A 3PH0C 5AJDA 4DX6D 2DCPA 2NC9A 3LEWA 2KBXA 4I9CA 4PS3A 2WQ6A 2CG3A 1KZPA 5T0KA 2O8JA 1X5BA 4BY6A 2X6HA 4GTPA 2R02A 1N0QA 1N4QA 3U3WA 5EX0A 1HZ4A 3Q5MA 2EQXA 2I2OA 4BT9A 1N6CA 1KPSB 2UWJG 3AU4A 1NA3A 2NYJA 5ENNA 1E8WA 4O1OA 3VLEA 4UWHA 4MLPA 5CECB 1N94A 5G2NA 1V55E 3SI5A 4JHJA 4A3TA 4FJYA 1N4SA 3KEZA 3OXLA 3UUXA 1WY6A 3CVQA 5T3RA 5D0QD 1TN7A 4JHRA 3MGBA 3PE3A 2J4DA 2R5SA 4GCOA 4GMLA 3MCXA 2WMOA 2XEEA 2ZU6B 4RG6A 1MVXA 1V54E 1UN9A 2WVIA 3CVPA 3FH5A 1INZA 1OCZE 4DUIA 1SA4A 1HE8A 4F53A 4KMOA 3CKCA 3CVNA 3DPYA 1HG5A 4B8AA 4D10C 4GPKA 3CHRA 1EYHA 1MHQA 3ZVVA 2AJAA 1Q2ZA 1P5QA 3HDXA 2GRRB 3UPVA 3SZ7A 3IV0A 3EHNA 2H6IA 1LD8A 3QDNA 3CVXA 3FH7A 4QEOA 3U9WA 2B6CA 2YHCA 5JHAA 3ZYMA 3BEEA 4YPUA 2IF4A 3L08A 3PZ3A 1N95A 1U3CA 2I9CA 2XCCA 4HQDA 3V2OA 4U8HA 1OWOA 3M59A 2IGQA 2KZTB 2OCCE 1Y8MA 1H19A 5KJKA 5TTFA 2XPZA 4GAAA 4HB5A 1RZ4A 4XE0A 4GTQA 3CBPA 4K5BA 3UTMA 1Z3YA 1QYMA 5EYLA 3UM2A 1WM5A 4CCAA 3ZHEB 2ILRA 4MI5A 3SNXA 1KZOA 4BESA 4NVQA 4EZJA 4U0ZA 5ARGA 1MVHA 3TG5A 3FUKA 4DK5A 1SVXA 1W3BA 3ASFA 3OXGA 3SY2A 3MKRA 5CERB 3CHOA 3HVEA 4UI9K 2QPWA 2YNQA 3F9XA 3CHMA 3G2WA 2E2EA 4I1MA 2Y4TA 4GYOA 3SD5A 4IYPA 4GTTA 1FT2A 5KWDA 1PEGA 2GRLA 4JEHA 3CK9A 2ZIRA 1HH8A 1S0PA 4JW1A 4WNFA 1OUVA 3WXXA 3PZ4A 3PEVB 3LJNA 3LJ3A 3Q7AA 2MHKA 1JWGA 3EHQA 4QFVA 1ELWA 3UT7A 2BUGA 1QNFA 4BSZB 2PNNA 2A5UA 3GW4A 5TH7A 1Z6TA 2JEKA 5AQBA 2WM9A 3BG0B 3CSTA 5KBAA 3MO2A 3N71A 4C9BB 1H6PA 3NQPA 5HS0A 5A7DB 4I6GA 1KLXA 4UQXA 1BPOA 3D9MA 2J09A 3L16A 4A1SA 2H6GA 2W5YA 3C72A 5FWQA 4EHMA 4AM9A 1DVPA 4GZDA 3Q78A 2XS8A 4HFGA 3HRAA 4CT0A 4XZ4A 5BV0A 3M58A 2H6FA 2XZDG 4TUUA 4CT4A 3QWVA 4Q69A 1JCRA 2Y0BG 3Q4AB 3NOCD 4YVOA 4ZHBA 3EIQC 2VSNA 4HOUA 4PS7A 3CSFA 3QC1A 3IHXA 3AS8A 3DSWA 4RLYA 3I5PA 5FTPA 2AWIA 5G04J 2P9IG 3DSTA 3BG1B 2DWZA 4AY5A 5EIDA 4DX2A 1IQUA 2GGFA 4GYWA 4A55A 1IYGA 3RO3A 2WPVA 5ENTD 2QFCA 3RO2A 5JIYA 1NA0A 3APFA 3EUVA 1MYOA 1LD7A 4OAUC 4IJ8A 3LVRE 4FJZA 3S7FA 3BQOA 4BSXA 2P9LG 4J8DA 3RAUA 3LY8A 5LCWJ 1K1AA 3ASNE 3L13A 1HU3A 3TWVA 4C0EA 1UN8A 3CKBA 2ZISA 1NP7A 3PVLA 3T8MA 3U66A 4ILIA 4LCTA 3Q7FA 2GRNB 3ZNGA 4FLBA 3PDNA 5BT1A 2DIWA 1XQHA 4B8CB 2RG8A 1WG0A 3OS5A 1TEZA 5C2YA 3JCKC 4J8YA 5CHEE 4BFRA 3Q15A 5EIBE 3WG7E 4H12A 2WXLA 1RW2A 3LVQE 5BXUA 2FEZA 5KNHD 2KATA 1AP7A 2OV8A 2X6FA 4W9RA 4HRNA 5FZRA 5LCWC 4U95D 3I4RB 4JHKA 1H3IA 5FJYA 1O5MA 2C0MA 1UOHA 3SWCA 3RIBA 3RSEG 2BF0X 3TXNA 1YA0A 4O60A 3BU8A 1MQSA 3FUFA 4HRMB 1FPPA 5B1BE 1JCQA 5CMWA 4QQIA 2QC9A 2JABA 3OAWA 5FQ6A 3ZYKA 4UWGA 4G26A 2WXHA 3DB5A 2X6KA 4WWNA 3T8KA 1WDYA 4PDXA 3R9MA 3CBOA 4FU3A 1JWFA 2E0IA 3S8PA 1ZBPA 1OWLA 3MKQA 3FWVA 2WMNA 3DWLG 2IOSA 4WWOA 2X6JA 4JPSA 3HXEA 4GCNA 4WWPA 4UWFA 2BKGA 2VGYA 4U96D 4U0UA 2L0TB 3S7JA 4U8YD 2RD0A 3VTYA 3RRUA 3MEKA 5J90A 2VGXB 4EBAA 2OEWA 3KSQA 2DZNA 4DPRA 4GB9A 2F8XK 3CHSA 3CVUA 3PNLB 4EQFA 4F7AA 2V0PA 3ESKA 3IKOB 2V5FA 2UY1A 4PUCA 4HBDA 1ELRA 4MRUA 5JJTA 2CHXA 4RSYA 1SQMA 3Q49B 3K5KA 5J08A 3EIJA 4KVOA 3ZFWA 3ZIMA 2J9QA 3ASOE 3FUIA 4NURA 4GZCA 3RKVA 3M54A 4M7CA 2P9KG 1LTXA 3GYZA 5KCMA 3V30A 3ZU7B 3D9KA 5AJLA 3VLDA 4YNMA 4I9EA 5CEDB 4L7TA 1GW6A 4EZLA 1IHBA 1WAO1 2ONDA 1NFIE 1D8EA 1U2VG 3KD7A 3UKRG 2KC7A 3D9IA 1DCQA 2J49A 2Y4UA 2FI7A 3M53A 3X2QE 4GTMA 4XEIG 3M55A 3IXEA 3APCA 3RQ4A 1JCSA 4LNUD 4FC8A 5E76A 4MS6A 3ZXSA 5JA4D 4EPZA 2P9UG 5CMYA 4A3VA 5EKQD 3QAQA 1O1RA 4LUNU 4IULA 4DRXE 3I3NA 2R03A 4HOQA 4FULA 2XZTG 3ESLA 3HXDA 4CDNA 3QARA 2BQZA 2R59A 3FU0A 4JZYA 3S7DA 4LDGA 3ENEA 4IRUA 4JA7A 3D9JA 4N3BA 3URZA 2GW1A 4Q94A 5BPPA 4G8LA 2DBAA 2DZOA 3PUKA 3ZYLA 4TXRA 4U0SA 3UIPC 4BETA 5JHBA 1E8YA 5CRUA 1OCCE 4WNEA 5ENSD 3JUEA 1KT1A 3LKUA 2FBNA 3CVLA 3CV0A 5ARFA 3Q9NC 2I1KA 4EZKA 3B7SA 4HXIA 3W9GA 2PL2A 3SFZA 2WQHA 3W9FA 3CVWA 4AVXA 2C2LA 1N3JA 3GZ2A 4AV7A 2LXMA 3HVEB 1IXVA 4H7YA 1PY1A 1BD8A 1H0AA 1MZCA 2WXKA 2VQ2A 4TUMA 3F9WA 1TNZA 3PS6A 4CDRA 2WXGA 3UI2A 3FUHA 3TJPA 2NXPA 5AN8A 3MA5A 3ZHEA 2XGMA 1NZNA 4PS8A 3SO8A 4FMUA 4N5CA 2C0LA 3ML9A 1Z5SC 2XRYA 5C1DA 1TNUA 4AY6A 3RU0A 3E4BA 4TXPA 3Q79A 2DVWA 3HHMA 5AAOA 3Q73A 3G2UA 3G2VA 5IY5E 3RRMB 2XS1A 4ATGA 5AIJA 3V31A 4J6IA 5ENRD 3RJVA 5LX8A 3UM1A 3PRZA 4DI4A 4Z68A 5DBKA 4AP2A 4ANXA 4FP7A 3JQ0A 3G2SA 3DEPA 1IKND 3L17A 1TJFA 4HRLA 3FTWA 2KM4A 3D9HA 3ULYA 3KEAA 3NF1A 1YCSB 3ZN3A 2RFAA 5G55A 2QY7A 3VV0A 4J8OA 2WXNA 1EF1C 5LSZA 1ZKKA 3UINC 4N2QA 4YPEA 4J8EA 2X6IA 4LNGA 4YDYA 5CRVA 2J08A 3MX3A 2WQ7A 4RQIA 3AG2E 4JL0A 5BV1A 3FTZA 2UY1B 2WB2A 5T8IA 4FA6A 3P1UA 3RJWA 5G05C 4KYOB 2XGSA 4I2WA 5D66A 4G24A 4I2ZA 3U64A 2LAIA 2NSZA 1Y6IA 4ATZD 3FDHA 3TWQA 2MOWA 3ABKE 4G2VA 1U3DA 2GRPB 4CRWA 3ULEG 2J8SD 3UM3A 3LY7A 4KZCA 3CVVA 3QK0A 3FHEA 3DSVA 4FADA 3AG4E 1QBQA 3E37A 3AS5A 3HNAA 2FF4A 1E8ZA 5JJ0A 3ONLA 4CGVA 2ETAA 1B89A 3F6QA 2F0YA 4J7FA 1ZB1A 1AWCB 3CQCB 2CHZA 1LF8A 4E85A 2X3MA 2AXVA 5F6LA 2YHEA 2R3AA 3PZ1A 3SF4A 3LS8A 1N6AA 3RRNB 1H6KA 5FZQA 3J5PA 3TAXA 3L82A 4HLLA 2QZAA 2V8SE 2P9PG 3ABME 1N0RA 2BTDA 2Q7FA 4L2LA 3FUDA 3DXMG 4B94A 3JXJA 4NIKA 2J07A 3NOGD 2BEDA 4JD2G 5M72A 3OXFA 3ZUVB 3D9PA 3CBMA 4YNPA 4B0ZA 4MI0A 3L54A 3T5XA 3SBSA 1FCHA 4JDSA 3KMJA 3FULA 5AENA 3SGHA 2KCVA 4NACA 1H6OA 3G2TA 4TRQA 2EIJE 2VGEA 1HO8A 3CGHA 3UMVA 5LFAA 4I1OB 3C98A 3B7RL 1S64A 4TXQA 5KJLA 5H7PA 3FTYA 2LUHA 3FU3A 3LY9A 4IN3B 4U7EB 5F5EA 4O1PA 4OAVB 4GZ6A 2PQRA 1H2UA 3M57A 2VSOE 1BU9A 5ANRA 3AS4A 3T9KA 3PZDA 4JLGA 5B3SE 5FT9A 4MBGA 3SHFA 1MT6A 3U4TA 3TGOA 4JXTA 5HKPA 1TN6A 3M5AA 4OVVA 4G11A 5BUZA 4KBQA 4E47A 2GROB 3LYAA 5B1AE 2A5EA 4DX1A 2ZXWE 4YDOA 2OVFA 3B7TA 2P2CP 3RAYA 5EX3A 2XPIA 4J83A 3LPZA 1XNFA 3CHPA 3GZSA 2A4ZA 4YNDA 4JB8P 3IBEA 3TWXA 4HOTA 1NI1A 5AARA 3MV3B 4DX7D 4BT8A 3DSXA 2V4LA 2YQ8A 3UM0A 2VYIA 2AVPA 2P9NG 3ZRHA 3Q75A 3HG0D 1TR4A 4GTRA 4V3IA 1A5EA 2IJGX 4HS2A 1OY3D 4I6JA 3LXUX 3I4GA 2LNIA 3MO5A 5JMND 4LG6A 3E32A 3CQGB 4AXHA 1VDYA 2GRQB 4NQ0A 4DX5D 1O1SA 2LSUA 2AW6A 2FULA 1UJKA 1HF8A 2YINA 1OT8A 2KZTA 5CBNA 3CR3A 1TNBA 3D9NA 2WXPA 1TN8A 3VTXA 3O4ZA 1ZU2A 3APDA 1NL4A 4NRHB 2OOEA 2IY0C 3L9TA 1TNYA 3HXCA 3AJIA 2X38A 2LSVA 3FFLA 3JYSA 4HLEA 3DRAA 5BW8C 3ZXPA 4BERA 3EU5A 4GMJA 5EN5D 4HOSA 3B7BA 5CPRB 1K8KG 2JV0A 1D8DA 4HI9A 2LO6A 3AAAC 4JVSA 4GZ5A 4N2SA 1MX2A 4QEPA 3OPEA 3ZKJA 2R17C 3FUNA 3FPDA 3CLJA 3FTVA 4RVBA 4BTAA 1XGWA 3FTUA 5CCLA 5DIZA 1JUQA 5D2MC 3JXIA 5AQ9A 5ENPD 4GMRA 2OEVA 1OCRE 3QWPA 3FP3A 4UWLA 2CHWA 4ME2A 2WXFA 5LP0A 3FUMA 5E75A 5JINA 1N4PA 3UQ3A 4U07A 2ZGDA 4GTSA 2IONA 2IQCA 3EU9A 2GRMA 5A6CA 1SW6A 4OVUA 4CYMD 4JEUA 3CIAA 3KSLA 4WAFA 1E7UA 1HS6A 2L9BA 2VTBB 3R7RA 5KNGA 3KMTA 1DCEA 1E8XA 4URKA 3IEGA 4ILHB 4WUYA 3ASHA 3CK8A 5G05J 5HQ8A 3VUZA 2IOLA 1N54A 1MX6A 1E96B 3FY4A 1TYQG 1KT0A 3SW9A 4GU5A 4N3AA 3DPDA 4LRZA 5D0OD 1O1TA 1OXJA 2V5QC 2XHEA 2L0IA 3RK6A 4B89A 3D9OA 5T5GA 4GA0A 3DSSA 4K0RA 4G1TA 3ASGA 3FTSA 3K9IA 2BKKB 3VLFA 4J8SA 5AYFA 2MRIA 4CDMA 1FVFA 4KZ0A 3R9AB 5JJ6A 4UUCA 4N3CA 4P29A 5F59A 4J7IA 4DI3A 4YDWA 4C1QA 1DC2A 2VGXA 1O9SA 4ZFHA 3D3MA 2XQ0A 2Y69E 4O30A 3UT8A 2RFIA 3ZPJA 4C0MA 2XGOA 3ULQA 5FQ8A 2Y1LE 3EHMA 4IJDA 1MJ0A 1S63A 3ABLE 4UQYA 4ACKA 1N4RA 3FUJA 4ANUA 4DJAA 4A63B 2ZGGA 2AXUA 2EIKE 2J4BA 3ZGQA 2H6HA 2HO1A 1UG3A 5EILA 5KJMA 1HXIA 2QYJA 3EP0A 4DLOA 4ILGA 3PNTB 5CBOA 3PE4A 3TWWA 3PZ2A 1PAQA 5CCMA 3UXGA 3FEYA 4Z4PA 3AU5A 3KS2A 1MX4A 5AQ7A 4GA1A 4LEUA 5EG2A 4A1GA 4L2YA 2WXMA 4TV3A 4Y6CA 1E7VA 4BX9A 2WXJA 3HYMB 4YVQC 3DALA 4G23A 3C3RA 5BNWA 4LERA 3JQ1A 1HX8A 4K03A 2HYZA 2F37A 4U8VD 4H7XA 4ACLA 2EINE 2CFZA 2FO1E 1PC2A 3F9ZA 4G8KA 4ANVA 1K1BA 2HE0A 2M63A 4BEPA 3EJNA 1EDUA 4AU7A 3ZW3A 2KXPC 4YDEA 1JPLA 3FEXA 5LSXA 3OOIA 4GTOA 5A23A 1A17A 2IU1A 4BTBA 3MKQB 4I17A 3QB2A 3TWUA 3SFYA 3AG1E 2P58C 4AOFA 1D9SA 5T0MA 5FIOA 3HXBA 4UI9C 4J8FA 4AEZC 2G46A 3DEOA 2I6HA 5AQAA 4WNDA 3J5QB 3CEQA 3E34A 4FHJA 5JHNA 2PM6A 1OWNA 3FUEA 3Q47B 4HVBA 4GZ3A 4F1SA 2ETBA 4PH4B 3NZSA 3HXFA 5ITZF 4FHKA 3ASDA 2IO2C 2IEJA 4NJ5A 2V4HC 3DBSA 2AXZA 1TJCA 4M3OA 3FU6A 3UX4A 4C48B 1HG2A 3B7UX 4XI0A 2I1JA 5BXOA 4GTVA 4XKBA 4I1AA 3TWSA 1SA5A 1BI7B 1K3ZD 2IO3C 2VTBA 1EPUA 4KXKB 4BWRA 2WXIA 5FZSA 3QKYA 2KCKA 5EDSA 3NB2A 4L23A 4OYSA 4U63A 1DNPA 4KT6B 4MKTA 4APOA 4Y6WA 1OWPA 1N52A 3FH8A 4APFA 3IHYA 3EDTB 3CVYA 5FQ4A 2VJ8A 3HIZA 4UWKA 2DYSE 4GPMA 2XPYA 4O6FA 1OCOE 5FQ7A 3FU5A 4F1PA 1Z3XA 3ZYQA 4BUPA 2XENA 5HRYA 4GA2A 2W5ZA 4R7LA 2FO7A 3LCAA 3E33A 4U04A 2WXRA 2PM7A 5EYPF 2WXQA 2P9SG 1FT1A 2HR2A 1TNOA 4XX5A 2L6JA 3BUAA 3SQVA 2B0OE 4L9PA 4L1BA 4ABNA 3F9YA 4DLQA 3OTNA 3C5RA 3MYVA 5JJ7A 1E90A 4GYYA 4JA9A 2R2LA 3EHRA 3B95A 2MYOA 3FTXA 2PQNA 3AG3E 1HFAA 2CFUA 2ETCA 4UI9J 3PEUB 4RZ0A 3MJWA 4N39A 5ENOD 1ML9A 1SZAA 3NZUA 3SFXA 3CHQA 3PREA 3ONKA 4J0UA 4B93B 1OWMA 2XEVA 2LAHA 1UW4B 1FVHA 1IHGA 2XEHA 3B13A 3DXKG 3QNKA 2EILE 2RFMA 3QOUA 3T5VA 4J7WA 1BLXB 1MUFA 5CEAA 1S70B 4F6RD 5AYWD 3UT4A 1N9AA 2KCLA 4XIFA 4N5QA 3L22A 4XI9A 3M56A 1ELKA 3TG4A 2VSXE 3D9LA 5FINA 4F3VA 3JUIA 1SZ9A 4QENA 4I6EA 4EECA 2XCBA 2VSYA 3MV2B 3MO0A 2JLBA 1H2VC 1QQEA 4XKCA 4ANWA 4E6HA 3P2BA 3TXMA 3UKUG 2LXLA 4AJWA 2XRZA 1BI8B 2DYRE 3NAWA 3KAEA 3C3QA 3Q9UC 3ML8A 3BO5A 4RG9A 4CZ2D 4X8QA 1YMPA 3SBTB 4EBAG 5G04C 5TEGA 3V79K 3NBNB 5KJNA 3UIOC 5ANLA 1H2TC 2PZIA 4LSZE 2R05A 3TWRA 2HM8A 4CEMA 4HORA 2IFUA 2Y3AA 4LNBA 4YPAA 3KMAA 5HI7A 1X81A 1N11A 3CK7A 3O48A 5ENQD 3L6AA 2OVBA 4K5CA 4KVMA 2F69A 3V2XA 2EIME
chains in the Genus database with same CATH topology
5JJ0A 2XQ0A 2FEZA 4JC8A 4O30A 3UT8A 3ONLA 2RFIA 3ZPJA 4C0MA 2KATA 5F6KC 1L5JA 3LDZA 2OV8A 4CGVA 2X6FA 2XGOA 4W9RA 3ULQA 3ZEFA 1B89A 5FQ8A 5FZRA 2WXOA 5LCWC 3EHMA 4J7FA 4BX8A 3I4RB 5T4YA 4IJDA 4JHKA 1UJJA 4G25A 1H3IA 4FLHA 4UQYA 4ACKA 3CQCB 3QJZA 3FUJA 2CHZA 1LF8A 3MZLB 4ANUA 5FJYA 4DJAA 2C0MA 4E85A 2X3MA 3SWCA 2AXUA 2AXVA 5F6LA 2YHEA 5LOZA 4I43A 3GZ1A 2R3AA 2J4BA 3RIBA 3SF4A 3PUJA 4AIFA 3LS8A 2BF0X 1N6AA 3ZGQA 3TXNA 4WNGA 1YA0A 3RRNB 2HO1A 4Q96A 1UG3A 1H6KA 2CG2A 5FZQA 1IQRA 5KJMA 3TAXA 1QZ2A 1HXIA 1MQSA 3FUFA 3EP0A 5CMWA 4DLOA 4ILGA 2V8SE 3PNTB 3S7BA 3TL5A 3OAWA 5FQ6A 3ZYKA 3S2AA 4UWGA 3PE4A 3QWWA 4CGWA 4I51A 4G26A 1PAQA 5CCMA 2BTDA 2WXHA 3DB5A 4UQZA 2X6KA 4WWNA 3R7QA 2Q7FA 4L2LA 3FEYA 4Z4PA 3AU5A 3FUDA 3IHVA 3KS2A 4PDXA 4B94A 3CBOA 4FU3A 3PH0C 5AJDA 1JWFA 4GA1A 4LEUA 2DCPA 2E0IA 2J07A 2NC9A 5EG2A 3S8PA 4A1GA 1ZBPA 3LEWA 1OWLA 3MKQA 2WXMA 4L2YA 4TV3A 4Y6CA 1E7VA 4BX9A 2WXJA 4I9CA 4PS3A 2WQ6A 3FWVA 2CG3A 5M72A 2WMNA 3OXFA 5T0KA 3HYMB 3D9PA 3CBMA 4YNPA 4YVQC 4B0ZA 3DALA 2IOSA 4WWOA 4G23A 2O8JA 4MI0A 5BNWA 3L54A 2X6JA 3T5XA 4LERA 1X5BA 4BY6A 2X6HA 3JQ1A 1HX8A 4JPSA 3SBSA 4K03A 1FCHA 4JDSA 3KMJA 3U3WA 4GCNA 3FULA 4WWPA 4UWFA 5EX0A 5AENA 3SGHA 2VGYA 1HZ4A 2HYZA 2KCVA 2EQXA 2I2OA 3Q5MA 4U0UA 4BT9A 1N6CA 4H7XA 4ACLA 2L0TB 4NACA 2UWJG 3G2TA 2CFZA 3S7JA 4TRQA 3AU4A 1NA3A 2RD0A 5ENNA 1E8WA 3RRUA 3MEKA 3VLEA 3VTYA 2VGXB 4UWHA 5J90A 1PC2A 3F9ZA 1HO8A 4MLPA 4EBAA 3CGHA 3UMVA 4ANVA 5LFAA 4I1OB 5G2NA 4DPRA 3C98A 3SI5A 2M63A 4GB9A 3B7RL 3CHSA 3EJNA 4JHJA 4A3TA 3CVUA 3PNLB 4FJYA 4EQFA 1EDUA 4F7AA 4AU7A 3ZW3A 2V0PA 3ESKA 3IKOB 3KEZA 1JPLA 5KJLA 2V5FA 3FEXA 3FTYA 5LSXA 3OXLA 3OOIA 2UY1A 3UUXA 5A23A 1A17A 3FU3A 3LY9A 4IN3B 4PUCA 2IU1A 4BTBA 1WY6A 3CVQA 3MKQB 1ELRA 4MRUA 5F5EA 5JJTA 5T3RA 2CHXA 4RSYA 1SQMA 3Q49B 3K5KA 4I17A 5D0QD 3QB2A 5J08A 3EIJA 4KVOA 3ZFWA 4GZ6A 2PQRA 1H2UA 2P58C 4JHRA 3ZIMA 3M57A 4AOFA 2J9QA 2VSOE 5T0MA 3FUIA 3MGBA 4UI9C 3LVQE 4J8FA 4GZCA 4NURA 5ANRA 3AS4A 3PE3A 3PZDA 4JLGA 3RKVA 2J4DA 3M54A 4AEZC 2R5SA 5FT9A 4GCOA 4GMLA 3MCXA 2WMOA 2G46A 3GYZA 5KCMA 2I6HA 3SHFA 1MT6A 4WNDA 3U4TA 3D9KA 2ZU6B 4RG6A 1MVXA 3CEQA 5AJLA 3VLDA 1UN9A 2WVIA 3CVPA 3TGOA 4JXTA 3FH5A 4FHJA 1INZA 2PM6A 5JHNA 3M5AA 1OWNA 4OVVA 1HE8A 4F53A 4KMOA 4G11A 3FUEA 3CKCA 3CVNA 3Q47B 4I9EA 4YNMA 5BUZA 4KBQA 4E47A 4L7TA 4HVBA 4GZ3A 1GW6A 4F1SA 4EZLA 1HG5A 3LYAA 4PH4B 4B8AA 4D10C 4GPKA 1WAO1 3NZSA 3CHRA 1EYHA 1MHQA 4FHKA 2ONDA 3ASDA 3ZVVA 4NJ5A 2OVFA 1P5QA 3HDXA 3UPVA 3SZ7A 3IV0A 3EHNA 3B7TA 3RAYA 3DBSA 3KD7A 5EX3A 2XPIA 2AXZA 1TJCA 2KC7A 3QDNA 3LPZA 4M3OA 3CVXA 1XNFA 3D9IA 3FH7A 3FU6A 4J83A 3UX4A 4QEOA 3U9WA 3CHPA 3GZSA 2A4ZA 4YNDA 2J49A 1HG2A 2FI7A 2Y4UA 3M53A 3IBEA 4HOTA 3B7UX 4XI0A 3M55A 3MV3B 2I1JA 2YHCA 4BT8A 5JHAA 3ZYMA 3APCA 3RQ4A 3BEEA 4XKBA 4YPUA 2IF4A 3L08A 4I1AA 4FC8A 2V4LA 5E76A 4MS6A 2VTBA 2YQ8A 1U3CA 1EPUA 2VYIA 2AVPA 4KXKB 3ZXSA 4EPZA 2I9CA 2XCCA 3ZRHA 2WXIA 4BWRA 5FZSA 5CMYA 3QKYA 4A3VA 2KCKA 4V3IA 5EKQD 3QAQA 5EDSA 2IJGX 4U8HA 1OWOA 4LUNU 4HS2A 4IULA 4L23A 4I6JA 4OYSA 4U63A 3M59A 1DNPA 2IGQA 2KZTB 3LXUX 1Y8MA 3I4GA 3I3NA 2LNIA 1H19A 4HOQA 3MO5A 4KT6B 4FULA 5KJKA 4MKTA 4APOA 5TTFA 2XPZA 3CQGB 4AXHA 1VDYA 4Y6WA 3ESLA 1OWPA 4GAAA 4NQ0A 4CDNA 1N52A 3FH8A 3QARA 4XE0A 2BQZA 4APFA 2LSUA 3IHYA 3CBPA 2R59A 2AW6A 3EDTB 2FULA 3CVYA 1UJKA 1HF8A 1Z3YA 2YINA 3FU0A 2KZTA 4JZYA 3S7DA 1WM5A 5FQ4A 4LDGA 3CR3A 2VJ8A 3ENEA 4IRUA 3HIZA 4JA7A 4UWKA 3D9JA 2XPYA 3D9NA 4CCAA 4N3BA 4O6FA 2ILRA 3ZHEB 3SNXA 4MI5A 4NVQA 4EZJA 5FQ7A 2WXPA 3FU5A 4U0ZA 1Z3XA 3ZYQA 5ARGA 4BUPA 1MVHA 3TG5A 3VTXA 3URZA 3O4ZA 3FUKA 4GA2A 1ZU2A 3APDA 2W5ZA 4DK5A 2GW1A 4R7LA 1W3BA 4NRHB 3ASFA 2FO7A 4Q94A 3OXGA 2OOEA 3LCAA 5BPPA 2DBAA 4U04A 3PUKA 2WXRA 2PM7A 3MKRA 3CHOA 2WXQA 3HVEA 4UI9K 4U0SA 2YNQA 3ZYLA 2HR2A 2QPWA 2X38A 5JHBA 1E8YA 3F9XA 3CHMA 4WNEA 2LSVA 3FFLA 3G2WA 3JYSA 4XX5A 2L6JA 2E2EA 4I1MA 4HLEA 2Y4TA 4GYOA 3SD5A 1KT1A 4IYPA 3LKUA 5BW8C 4L1BA 4ABNA 3F9YA 4GMJA 4DLQA 4HOSA 3OTNA 2FBNA 3CVLA 3CV0A 3MYVA 5JJ7A 5ARFA 2JV0A 5CPRB 1E90A 4GYYA 1PEGA 2GRLA 4JA9A 4JEHA 2LO6A 4JVSA 4GZ5A 3CK9A 2I1KA 4N2SA 1HH8A 1S0PA 4JW1A 4EZKA 4QEPA 4WNFA 3B7SA 3OPEA 4HXIA 3FTXA 2PL2A 3SFZA 2R17C 2WQHA 3FUNA 1OUVA 2PQNA 3CVWA 3FPDA 3WXXA 3CLJA 1HFAA 2CFUA 3FTVA 4AVXA 2C2LA 4UI9J 1N3JA 3GZ2A 4RVBA 4AV7A 3HVEB 4BTAA 1XGWA 3FTUA 3PEVB 4H7YA 3LJ3A 3PEUB 4RZ0A 3MJWA 1PY1A 4N39A 2MHKA 1JWGA 4QFVA 5DIZA 5CCLA 1ML9A 1H0AA 1JUQA 1ELWA 2WXKA 2VQ2A 3UT7A 1SZAA 3NZUA 2BUGA 3F9WA 3PS6A 4CDRA 1QNFA 2WXGA 3CHQA 3PREA 3FUHA 3ONKA 4J0UA 3TJPA 2NXPA 2A5UA 3GW4A 3MA5A 5TH7A 3ZHEA 1Z6TA 2JEKA 2XGMA 2WM9A 3BG0B 1NZNA 4PS8A 3CSTA 1OWMA 3MO2A 2XEVA 2LAHA 1UW4B 3N71A 3QWPA 1FVHA 4N5CA 4C9BB 2C0LA 4FMUA 3FP3A 3NQPA 4UWLA 2CHWA 3ML9A 2XRYA 4ME2A 2WXFA 5C1DA 5A7DB 1IHGA 3B13A 4I6GA 1KLXA 4UQXA 5LP0A 1BPOA 3QNKA 3D9MA 3RU0A 4AY6A 3E4BA 3FUMA 2J09A 5E75A 3QOUA 5JINA 3HHMA 3L16A 3UQ3A 4A1SA 4U07A 3G2UA 3T5VA 3G2VA 2W5YA 3RRMB 1MUFA 2IONA 2IQCA 4ATGA 5AIJA 5FWQA 2GRMA 5AYWD 5A6CA 4J6IA 3RJVA 1DVPA 4GZDA 4OVUA 3UT4A 4AM9A 5LX8A 4HFGA 3PRZA 4CT0A 4DI4A 4JEUA 3CIAA 4XZ4A 2KCLA 5BV0A 3M58A 5DBKA 4AP2A 4TUUA 4WAFA 4XIFA 4CT4A 3QWVA 1E7UA 1HS6A 2L9BA 3L22A 4XI9A 4Q69A 3R7RA 2VTBB 3M56A 4ANXA 3Q4AB 4FP7A 1ELKA 4YVOA 3TG4A 2VSXE 3JQ0A 3KMTA 3D9LA 3EIQC 2VSNA 3G2SA 4HOUA 4PS7A 4F3VA 3CSFA 3L17A 3QC1A 3IHXA 3AS8A 1TJFA 1E8XA 4URKA 3IEGA 4ILHB 3FTWA 1SZ9A 2KM4A 3I5PA 3JUIA 4WUYA 5FTPA 4QENA 2AWIA 5G04J 3ASHA 3NF1A 4I6EA 3CK8A 5G05J 3ZN3A 4EECA 2XCBA 3BG1B 4AY5A 2VSYA 5G55A 1IQUA 2QY7A 2GGFA 4GYWA 4A55A 5HQ8A 3VUZA 1IYGA 2IOLA 3VV0A 4J8OA 2WXNA 3MV2B 1N54A 3MO0A 1EF1C 5LSZA 3RO3A 1ZKKA 2WPVA 2JLBA 1H2VC 1QQEA 2QFCA 4XKCA 3RO2A 1E96B 3P2BA 4ANWA 3FY4A 4E6HA 4J8EA 4N2QA 1NA0A 3APFA 4YPEA 5JIYA 3TXMA 2X6IA 4AJWA 2XRZA 1KT0A 4IJ8A 3SW9A 4GU5A 4N3AA 3DPDA 3LVRE 2J08A 4LRZA 3MX3A 4FJZA 5D0OD 3S7FA 2XHEA 3KAEA 4BSXA 2WQ7A 3ML8A 4J8DA 3BO5A 3LY8A 5LCWJ 4JL0A 4RG9A 2L0IA 5BV1A 3L13A 1HU3A 3FTZA 2UY1B 3RK6A 3SBTB 4B89A 4C0EA 4EBAG 5G04C 2WB2A 5TEGA 5T8IA 3D9OA 4FA6A 3P1UA 3RJWA 5G05C 1UN8A 5T5GA 3CKBA 5KJNA 4KYOB 2XGSA 5ANLA 1H2TC 2PZIA 4I2WA 4G24A 4I2ZA 4GA0A 3U64A 2LAIA 1NP7A 2NSZA 1Y6IA 3PVLA 3T8MA 3U66A 4K0RA 4ILIA 3FDHA 4G1TA 3ASGA 4LCTA 3FTSA 2MOWA 3K9IA 4FLBA 3PDNA 4G2VA 2HM8A 3VLFA 4J8SA 4CEMA 2IFUA 5BT1A 4HORA 5AYFA 2MRIA 2Y3AA 4CDMA 2DIWA 1U3DA 1FVFA 4KZ0A 3R9AB 4YPAA 3KMAA 4CRWA 1XQHA 4B8CB 5JJ6A 5HI7A 2RG8A 4N3CA 3LY7A 4P29A 3OS5A 5F59A 4KZCA 3CVVA 3QK0A 3CK7A 1TEZA 4J7IA 3FHEA 3O48A 5C2YA 4DI3A 4FADA 3JCKC 5CHEE 4BFRA 3L6AA 2OVBA 3Q15A 4KVMA 2F69A 4C1QA 3AS5A 2VGXA 1O9SA 4H12A 2WXLA 3HNAA 2FF4A 3D3MA 1E8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JJ0 A;  2FEZ A;  4O30 A;  2RFI A;  3ZPJ A;  2KAT A;  5F6K C;  4CGV A;  2XGO A;  4W9R A;  3ULQ A;  1B89 A;  5FZR A;  5LCW C;  4J7F A;  4IJD A;  4G25 A;  1H3I A;  4UQY A;  5FJY A;  2C0M A;  3SWC A;  5F6L A;  3GZ1 A;  2R3A A;  3RIB A;  3SF4 A;  4AIF A;  1N6A A;  3ZGQ A;  4WNG A;  1YA0 A;  2HO1 A;  5FZQ A;  5KJM A;  3TAX A;  1QZ2 A;  1HXI A;  3EP0 A;  3S7B A;  3PE4 A;  3QWW A;  4CGW A;  4I51 A;  4G26 A;  5CCM A;  3DB5 A;  4UQZ A;  2Q7F A;  4Z4P A;  3KS2 A;  4B94 A;  3CBO A;  4GA1 A;  4LEU A;  2NC9 A;  5EG2 A;  3S8P A;  1ZBP A;  4Y6C A;  4I9C A;  3FWV A;  5M72 A;  3OXF A;  5T0K A;  3HYM B;  3CBM A;  4YNP A;  4YVQ C;  3DAL A;  2O8J A;  4G23 A;  4MI0 A;  5BNW A;  1FCH A;  4JDS A;  3KMJ A;  3U3W A;  4GCN A;  5EX0 A;  2VGY A;  1HZ4 A;  2HYZ A;  2KCV A;  3Q5M A;  4BT9 A;  4U0U A;  1N6C A;  4H7X A;  2UWJ G;  3S7J A;  1NA3 A;  3VTY A;  3MEK A;  2VGX B;  1PC2 A;  3F9Z A;  4EQF A;  4AU7 A;  3ESK A;  5KJL A;  2V5F A;  5LSX A;  3OXL A;  3OOI A;  2UY1 A;  3UUX A;  1A17 A;  3LY9 A;  4IN3 B;  4BTB A;  3CVQ A;  1ELR A;  5F5E A;  5JJT A;  3Q49 B;  3K5K A;  4I17 A;  5D0Q D;  3ZFW A;  4GZ6 A;  2PQR A;  2P58 C;  4JHR A;  3M57 A;  2J9Q A;  5T0M A;  4UI9 C;  4J8F A;  3AS4 A;  3PE3 A;  4JLG A;  3RKV A;  3M54 A;  2R5S A;  5FT9 A;  4GCO A;  2G46 A;  3GYZ A;  2I6H A;  1MT6 A;  4WND A;  3U4T A;  4RG6 A;  1MVX A;  3CEQ A;  3CVP A;  3TGO A;  5JHN A;  3M5A A;  4YNM A;  3CKC A;  3CVN A;  3Q47 B;  4I9E A;  4KBQ A;  4E47 A;  4GZ3 A;  3LYA A;  4GPK A;  1WAO 1;  2OND A;  3ASD A;  4NJ5 A;  1P5Q A;  3UPV A;  3SZ7 A;  3RAY A;  3KD7 A;  5EX3 A;  2XPI A;  3QDN A;  1TJC A;  2KC7 A;  4J83 A;  3LPZ A;  1XNF A;  4QEO A;  4YND A;  2Y4U A;  2FI7 A;  3M53 A;  4HOT A;  4XI0 A;  3M55 A;  3MV3 B;  2YHC A;  4BT8 A;  3RQ4 A;  3BEE A;  4YPU A;  2IF4 A;  4I1A A;  2YQ8 A;  2VYI A;  2AVP A;  4KXK B;  2XCC A;  4BWR A;  5FZS A;  3QKY A;  2KCK A;  5EKQ D;  3M59 A;  2IGQ A;  1Y8M A;  2LNI A;  4HOQ A;  3MO5 A;  5KJK A;  4APO A;  5TTF A;  4Y6W A;  4NQ0 A;  2BQZ A;  2LSU A;  3CBP A;  3EDT B;  3S7D A;  1WM5 A;  4LDG A;  4JA7 A;  4N3B A;  4O6F A;  3ZHE B;  4MI5 A;  4NVQ A;  4U0Z A;  5ARG A;  4BUP A;  1MVH A;  3TG5 A;  3VTX A;  3URZ A;  4GA2 A;  1ZU2 A;  2W5Z A;  2GW1 A;  1W3B A;  4NRH B;  3ASF A;  2FO7 A;  3OXG A;  2OOE A;  3LCA A;  2DBA A;  4U04 A;  3MKR A;  4UI9 K;  2QPW A;  4U0S A;  2HR2 A;  3F9X A;  4WNE A;  2LSV A;  3FFL A;  3JYS A;  2L6J A;  2E2E A;  2Y4T A;  4GYO A;  1KT1 A;  3LKU A;  5BW8 C;  4ABN A;  3F9Y A;  4HOS A;  2FBN A;  3CVL A;  3CV0 A;  5JJ7 A;  5CPR B;  5ARF A;  2JV0 A;  4GYY A;  1PEG A;  4JA9 A;  4GZ5 A;  3CK9 A;  4N2S A;  1HH8 A;  4QEP A;  4WNF A;  3OPE A;  2PL2 A;  2WQH A;  1OUV A;  2PQN A;  3FPD A;  3WXX A;  2C2L A;  4UI9 J;  1N3J A;  3GZ2 A;  4BTA A;  4H7Y A;  4RZ0 A;  4N39 A;  2MHK A;  5CCL A;  5DIZ A;  1ML9 A;  1ELW A;  2VQ2 A;  2BUG A;  3F9W A;  4CDR A;  4J0U A;  3GW4 A;  3MA5 A;  5TH7 A;  3ZHE A;  2XGM A;  1NZN A;  3MO2 A;  2XEV A;  3N71 A;  3QWP A;  4N5C A;  4FMU A;  2C0L A;  3FP3 A;  4ME2 A;  5C1D A;  5A7D B;  1IHG A;  1KLX A;  4UQX A;  4AY6 A;  3RU0 A;  3E4B A;  3QOU A;  5JIN A;  3UQ3 A;  4A1S A;  4U07 A;  2W5Y A;  1MUF A;  5AYW D;  5A6C A;  3RJV A;  4AM9 A;  2KCL A;  3M58 A;  5DBK A;  4XIF A;  3QWV A;  4XI9 A;  3M56 A;  3Q4A B;  4YVO A;  3TG4 A;  3KMT A;  2VSN A;  4HOU A;  4F3V A;  3IHX A;  3AS8 A;  3IEG A;  4WUY A;  5FTP A;  4QEN A;  5G04 J;  3ASH A;  3NF1 A;  3CK8 A;  5G05 J;  3ZN3 A;  2XCB A;  4AY5 A;  2VSY A;  4GYW A;  5HQ8 A;  3VUZ A;  1IYG A;  3VV0 A;  4J8O A;  3MV2 B;  3MO0 A;  5LSZ A;  3RO3 A;  1ZKK A;  2WPV A;  2JLB A;  1QQE A;  2QFC A;  3RO2 A;  1E96 B;  4N2Q A;  4YPE A;  5JIY A;  4J8E A;  1NA0 A;  1KT0 A;  4IJ8 A;  3SW9 A;  4N3A A;  5D0O D;  3S7F A;  3KAE A;  4J8D A;  3BO5 A;  3LY8 A;  5LCW J;  4JL0 A;  4RG9 A;  2UY1 B;  5G04 C;  5TEG A;  3RJW A;  5G05 C;  5T5G A;  3CKB A;  5KJN A;  4KYO B;  2XGS A;  4I2W A;  2PZI A;  4G24 A;  4I2Z A;  4GA0 A;  4G1T A;  3ASG A;  3K9I A;  3PDN A;  4G2V A;  5BT1 A;  4HOR A;  5AYF A;  2IFU A;  3R9A B;  4YPA A;  3KMA A;  1XQH A;  5JJ6 A;  5HI7 A;  4N3C A;  3LY7 A;  3OS5 A;  5F59 A;  3CK7 A;  4J7I A;  3O48 A;  5CHE E;  3Q15 A;  2F69 A;  4C1Q A;  3AS5 A;  2VGX A;  1O9S A;  4H12 A;  3HNA A;  2FF4 A; 
#chains in the Genus database with same CATH topology
 4HNA D;  3ISM C;  4JC8 A;  1G3N B;  5F6K C;  1L5J A;  3LDZ A;  1YYH A;  3ZEF A;  4K5A B;  2WXO A;  4HI8 A;  4BX8 A;  5T4Y A;  3C3O A;  1UJJ A;  4G25 A;  2F8Y A;  4FLH A;  3TWT A;  3DSU A;  3QJZ A;  3MZL B;  2RKK A;  2L6B A;  5LOZ A;  4I43 A;  3GZ1 A;  3PUJ A;  4AIF A;  4WNG A;  4Q96 A;  2QYU A;  2CG2 A;  1IQR A;  1QZ2 A;  3S7B A;  3TL5 A;  3S2A A;  3QWW A;  4CGW A;  4I51 A;  4UQZ A;  3R7Q A;  3IHV A;  3E30 A;  3PH0 C;  5AJD A;  4DX6 D;  2DCP A;  2NC9 A;  3LEW A;  2KBX A;  4I9C A;  4PS3 A;  2WQ6 A;  2CG3 A;  1KZP A;  5T0K A;  2O8J A;  1X5B A;  4BY6 A;  2X6H A;  4GTP A;  2R02 A;  1N0Q A;  1N4Q A;  3U3W A;  5EX0 A;  1HZ4 A;  3Q5M A;  2EQX A;  2I2O A;  4BT9 A;  1N6C A;  1KPS B;  2UWJ G;  3AU4 A;  1NA3 A;  2NYJ A;  5ENN A;  1E8W A;  4O1O A;  3VLE A;  4UWH A;  4MLP A;  5CEC B;  1N94 A;  5G2N A;  1V55 E;  3SI5 A;  4JHJ A;  4A3T A;  4FJY A;  1N4S A;  3KEZ A;  3OXL A;  3UUX A;  1WY6 A;  3CVQ A;  5T3R A;  5D0Q D;  1TN7 A;  4JHR A;  3MGB A;  3PE3 A;  2J4D A;  2R5S A;  4GCO A;  4GML A;  3MCX A;  2WMO A;  2XEE A;  2ZU6 B;  4RG6 A;  1MVX A;  1V54 E;  1UN9 A;  2WVI A;  3CVP A;  3FH5 A;  1INZ A;  1OCZ E;  4DUI A;  1SA4 A;  1HE8 A;  4F53 A;  4KMO A;  3CKC A;  3CVN A;  3DPY A;  1HG5 A;  4B8A A;  4D10 C;  4GPK A;  3CHR A;  1EYH A;  1MHQ A;  3ZVV A;  2AJA A;  1Q2Z A;  1P5Q A;  3HDX A;  2GRR B;  3UPV A;  3SZ7 A;  3IV0 A;  3EHN A;  2H6I A;  1LD8 A;  3QDN A;  3CVX A;  3FH7 A;  4QEO A;  3U9W A;  2B6C A;  2YHC A;  5JHA A;  3ZYM A;  3BEE A;  4YPU A;  2IF4 A;  3L08 A;  3PZ3 A;  1N95 A;  1U3C A;  2I9C A;  2XCC A;  4HQD A;  3V2O A;  4U8H A;  1OWO A;  3M59 A;  2IGQ A;  2KZT B;  2OCC E;  1Y8M A;  1H19 A;  5KJK A;  5TTF A;  2XPZ A;  4GAA A;  4HB5 A;  1RZ4 A;  4XE0 A;  4GTQ A;  3CBP A;  4K5B A;  3UTM A;  1Z3Y A;  1QYM A;  5EYL A;  3UM2 A;  1WM5 A;  4CCA A;  3ZHE B;  2ILR A;  4MI5 A;  3SNX A;  1KZO A;  4BES A;  4NVQ A;  4EZJ A;  4U0Z A;  5ARG A;  1MVH A;  3TG5 A;  3FUK A;  4DK5 A;  1SVX A;  1W3B A;  3ASF A;  3OXG A;  3SY2 A;  3MKR A;  5CER B;  3CHO A;  3HVE A;  4UI9 K;  2QPW A;  2YNQ A;  3F9X A;  3CHM A;  3G2W A;  2E2E A;  4I1M A;  2Y4T A;  4GYO A;  3SD5 A;  4IYP A;  4GTT A;  1FT2 A;  5KWD A;  1PEG A;  2GRL A;  4JEH A;  3CK9 A;  2ZIR A;  1HH8 A;  1S0P A;  4JW1 A;  4WNF A;  1OUV A;  3WXX A;  3PZ4 A;  3PEV B;  3LJN A;  3LJ3 A;  3Q7A A;  2MHK A;  1JWG A;  3EHQ A;  4QFV A;  1ELW A;  3UT7 A;  2BUG A;  1QNF A;  4BSZ B;  2PNN A;  2A5U A;  3GW4 A;  5TH7 A;  1Z6T A;  2JEK A;  5AQB A;  2WM9 A;  3BG0 B;  3CST A;  5KBA A;  3MO2 A;  3N71 A;  4C9B B;  1H6P A;  3NQP A;  5HS0 A;  5A7D B;  4I6G A;  1KLX A;  4UQX A;  1BPO A;  3D9M A;  2J09 A;  3L16 A;  4A1S A;  2H6G A;  2W5Y A;  3C72 A;  5FWQ A;  4EHM A;  4AM9 A;  1DVP A;  4GZD A;  3Q78 A;  2XS8 A;  4HFG A;  3HRA A;  4CT0 A;  4XZ4 A;  5BV0 A;  3M58 A;  2H6F A;  2XZD G;  4TUU A;  4CT4 A;  3QWV A;  4Q69 A;  1JCR A;  2Y0B G;  3Q4A B;  3NOC D;  4YVO A;  4ZHB A;  3EIQ C;  2VSN A;  4HOU A;  4PS7 A;  3CSF A;  3QC1 A;  3IHX A;  3AS8 A;  3DSW A;  4RLY A;  3I5P A;  5FTP A;  2AWI A;  5G04 J;  2P9I G;  3DST A;  3BG1 B;  2DWZ A;  4AY5 A;  5EID A;  4DX2 A;  1IQU A;  2GGF A;  4GYW A;  4A55 A;  1IYG A;  3RO3 A;  2WPV A;  5ENT D;  2QFC A;  3RO2 A;  5JIY A;  1NA0 A;  3APF A;  3EUV A;  1MYO A;  1LD7 A;  4OAU C;  4IJ8 A;  3LVR E;  4FJZ A;  3S7F A;  3BQO A;  4BSX A;  2P9L G;  4J8D A;  3RAU A;  3LY8 A;  5LCW J;  1K1A A;  3ASN E;  3L13 A;  1HU3 A;  3TWV A;  4C0E A;  1UN8 A;  3CKB A;  2ZIS A;  1NP7 A;  3PVL A;  3T8M A;  3U66 A;  4ILI A;  4LCT A;  3Q7F A;  2GRN B;  3ZNG A;  4FLB A;  3PDN A;  5BT1 A;  2DIW A;  1XQH A;  4B8C B;  2RG8 A;  1WG0 A;  3OS5 A;  1TEZ A;  5C2Y A;  3JCK C;  4J8Y A;  5CHE E;  4BFR A;  3Q15 A;  5EIB E;  3WG7 E;  4H12 A;  2WXL A;  1RW2 A;  3LVQ E;  5BXU A;  2FEZ A;  5KNH D;  2KAT A;  1AP7 A;  2OV8 A;  2X6F A;  4W9R A;  4HRN A;  5FZR A;  5LCW C;  4U95 D;  3I4R B;  4JHK A;  1H3I A;  5FJY A;  1O5M A;  2C0M A;  1UOH A;  3SWC A;  3RIB A;  3RSE G;  2BF0 X;  3TXN A;  1YA0 A;  4O60 A;  3BU8 A;  1MQS A;  3FUF A;  4HRM B;  1FPP A;  5B1B E;  1JCQ A;  5CMW A;  4QQI A;  2QC9 A;  2JAB A;  3OAW A;  5FQ6 A;  3ZYK A;  4UWG A;  4G26 A;  2WXH A;  3DB5 A;  2X6K A;  4WWN A;  3T8K A;  1WDY A;  4PDX A;  3R9M A;  3CBO A;  4FU3 A;  1JWF A;  2E0I A;  3S8P A;  1ZBP A;  1OWL A;  3MKQ A;  3FWV A;  2WMN A;  3DWL G;  2IOS A;  4WWO A;  2X6J A;  4JPS A;  3HXE A;  4GCN A;  4WWP A;  4UWF A;  2BKG A;  2VGY A;  4U96 D;  4U0U A;  2L0T B;  3S7J A;  4U8Y D;  2RD0 A;  3VTY A;  3RRU A;  3MEK A;  5J90 A;  2VGX B;  4EBA A;  2OEW A;  3KSQ A;  2DZN A;  4DPR A;  4GB9 A;  2F8X K;  3CHS A;  3CVU A;  3PNL B;  4EQF A;  4F7A A;  2V0P A;  3ESK A;  3IKO B;  2V5F A;  2UY1 A;  4PUC A;  4HBD A;  1ELR A;  4MRU A;  5JJT A;  2CHX A;  4RSY A;  1SQM A;  3Q49 B;  3K5K A;  5J08 A;  3EIJ A;  4KVO A;  3ZFW A;  3ZIM A;  2J9Q A;  3ASO E;  3FUI A;  4NUR A;  4GZC A;  3RKV A;  3M54 A;  4M7C A;  2P9K G;  1LTX A;  3GYZ A;  5KCM A;  3V30 A;  3ZU7 B;  3D9K A;  5AJL A;  3VLD A;  4YNM A;  4I9E A;  5CED B;  4L7T A;  1GW6 A;  4EZL A;  1IHB A;  1WAO 1;  2OND A;  1NFI E;  1D8E A;  1U2V G;  3KD7 A;  3UKR G;  2KC7 A;  3D9I A;  1DCQ A;  2J49 A;  2Y4U A;  2FI7 A;  3M53 A;  3X2Q E;  4GTM A;  4XEI G;  3M55 A;  3IXE A;  3APC A;  3RQ4 A;  1JCS A;  4LNU D;  4FC8 A;  5E76 A;  4MS6 A;  3ZXS A;  5JA4 D;  4EPZ A;  2P9U G;  5CMY A;  4A3V A;  5EKQ D;  3QAQ A;  1O1R A;  4LUN U;  4IUL A;  4DRX E;  3I3N A;  2R03 A;  4HOQ A;  4FUL A;  2XZT G;  3ESL A;  3HXD A;  4CDN A;  3QAR A;  2BQZ A;  2R59 A;  3FU0 A;  4JZY A;  3S7D A;  4LDG A;  3ENE A;  4IRU A;  4JA7 A;  3D9J A;  4N3B A;  3URZ A;  2GW1 A;  4Q94 A;  5BPP A;  4G8L A;  2DBA A;  2DZO A;  3PUK A;  3ZYL A;  4TXR A;  4U0S A;  3UIP C;  4BET A;  5JHB A;  1E8Y A;  5CRU A;  1OCC E;  4WNE A;  5ENS D;  3JUE A;  1KT1 A;  3LKU A;  2FBN A;  3CVL A;  3CV0 A;  5ARF A;  3Q9N C;  2I1K A;  4EZK A;  3B7S A;  4HXI A;  3W9G A;  2PL2 A;  3SFZ A;  2WQH A;  3W9F A;  3CVW A;  4AVX A;  2C2L A;  1N3J A;  3GZ2 A;  4AV7 A;  2LXM A;  3HVE B;  1IXV A;  4H7Y A;  1PY1 A;  1BD8 A;  1H0A A;  1MZC A;  2WXK A;  2VQ2 A;  4TUM A;  3F9W A;  1TNZ A;  3PS6 A;  4CDR A;  2WXG A;  3UI2 A;  3FUH A;  3TJP A;  2NXP A;  5AN8 A;  3MA5 A;  3ZHE A;  2XGM A;  1NZN A;  4PS8 A;  3SO8 A;  4FMU A;  4N5C A;  2C0L A;  3ML9 A;  1Z5S C;  2XRY A;  5C1D A;  1TNU A;  4AY6 A;  3RU0 A;  3E4B A;  4TXP A;  3Q79 A;  2DVW A;  3HHM A;  5AAO A;  3Q73 A;  3G2U A;  3G2V A;  5IY5 E;  3RRM B;  2XS1 A;  4ATG A;  5AIJ A;  3V31 A;  4J6I A;  5ENR D;  3RJV A;  5LX8 A;  3UM1 A;  3PRZ A;  4DI4 A;  4Z68 A;  5DBK A;  4AP2 A;  4ANX A;  4FP7 A;  3JQ0 A;  3G2S A;  3DEP A;  1IKN D;  3L17 A;  1TJF A;  4HRL A;  3FTW A;  2KM4 A;  3D9H A;  3ULY A;  3KEA A;  3NF1 A;  1YCS B;  3ZN3 A;  2RFA A;  5G55 A;  2QY7 A;  3VV0 A;  4J8O A;  2WXN A;  1EF1 C;  5LSZ A;  1ZKK A;  3UIN C;  4N2Q A;  4YPE A;  4J8E A;  2X6I A;  4LNG A;  4YDY A;  5CRV A;  2J08 A;  3MX3 A;  2WQ7 A;  4RQI A;  3AG2 E;  4JL0 A;  5BV1 A;  3FTZ A;  2UY1 B;  2WB2 A;  5T8I A;  4FA6 A;  3P1U A;  3RJW A;  5G05 C;  4KYO B;  2XGS A;  4I2W A;  5D66 A;  4G24 A;  4I2Z A;  3U64 A;  2LAI A;  2NSZ A;  1Y6I A;  4ATZ D;  3FDH A;  3TWQ A;  2MOW A;  3ABK E;  4G2V A;  1U3D A;  2GRP B;  4CRW A;  3ULE G;  2J8S D;  3UM3 A;  3LY7 A;  4KZC A;  3CVV A;  3QK0 A;  3FHE A;  3DSV A;  4FAD A;  3AG4 E;  1QBQ A;  3E37 A;  3AS5 A;  3HNA A;  2FF4 A;  1E8Z A;  5JJ0 A;  3ONL A;  4CGV A;  2ETA A;  1B89 A;  3F6Q A;  2F0Y A;  4J7F A;  1ZB1 A;  1AWC B;  3CQC B;  2CHZ A;  1LF8 A;  4E85 A;  2X3M A;  2AXV A;  5F6L A;  2YHE A;  2R3A A;  3PZ1 A;  3SF4 A;  3LS8 A;  1N6A A;  3RRN B;  1H6K A;  5FZQ A;  3J5P A;  3TAX A;  3L82 A;  4HLL A;  2QZA A;  2V8S E;  2P9P G;  3ABM E;  1N0R A;  2BTD A;  2Q7F A;  4L2L A;  3FUD A;  3DXM G;  4B94 A;  3JXJ A;  4NIK A;  2J07 A;  3NOG D;  2BED A;  4JD2 G;  5M72 A;  3OXF A;  3ZUV B;  3D9P A;  3CBM A;  4YNP A;  4B0Z A;  4MI0 A;  3L54 A;  3T5X A;  3SBS A;  1FCH A;  4JDS A;  3KMJ A;  3FUL A;  5AEN A;  3SGH A;  2KCV A;  4NAC A;  1H6O A;  3G2T A;  4TRQ A;  2EIJ E;  2VGE A;  1HO8 A;  3CGH A;  3UMV A;  5LFA A;  4I1O B;  3C98 A;  3B7R L;  1S64 A;  4TXQ A;  5KJL A;  5H7P A;  3FTY A;  2LUH A;  3FU3 A;  3LY9 A;  4IN3 B;  4U7E B;  5F5E A;  4O1P A;  4OAV B;  4GZ6 A;  2PQR A;  1H2U A;  3M57 A;  2VSO E;  1BU9 A;  5ANR A;  3AS4 A;  3T9K A;  3PZD A;  4JLG A;  5B3S E;  5FT9 A;  4MBG A;  3SHF A;  1MT6 A;  3U4T A;  3TGO A;  4JXT A;  5HKP A;  1TN6 A;  3M5A A;  4OVV A;  4G11 A;  5BUZ A;  4KBQ A;  4E47 A;  2GRO B;  3LYA A;  5B1A E;  2A5E A;  4DX1 A;  2ZXW E;  4YDO A;  2OVF A;  3B7T A;  2P2C P;  3RAY A;  5EX3 A;  2XPI A;  4J83 A;  3LPZ A;  1XNF A;  3CHP A;  3GZS A;  2A4Z A;  4YND A;  4JB8 P;  3IBE A;  3TWX A;  4HOT A;  1NI1 A;  5AAR A;  3MV3 B;  4DX7 D;  4BT8 A;  3DSX A;  2V4L A;  2YQ8 A;  3UM0 A;  2VYI A;  2AVP A;  2P9N G;  3ZRH A;  3Q75 A;  3HG0 D;  1TR4 A;  4GTR A;  4V3I A;  1A5E A;  2IJG X;  4HS2 A;  1OY3 D;  4I6J A;  3LXU X;  3I4G A;  2LNI A;  3MO5 A;  5JMN D;  4LG6 A;  3E32 A;  3CQG B;  4AXH A;  1VDY A;  2GRQ B;  4NQ0 A;  4DX5 D;  1O1S A;  2LSU A;  2AW6 A;  2FUL A;  1UJK A;  1HF8 A;  2YIN A;  1OT8 A;  2KZT A;  5CBN A;  3CR3 A;  1TNB A;  3D9N A;  2WXP A;  1TN8 A;  3VTX A;  3O4Z A;  1ZU2 A;  3APD A;  1NL4 A;  4NRH B;  2OOE A;  2IY0 C;  3L9T A;  1TNY A;  3HXC A;  3AJI A;  2X38 A;  2LSV A;  3FFL A;  3JYS A;  4HLE A;  3DRA A;  5BW8 C;  3ZXP A;  4BER A;  3EU5 A;  4GMJ A;  5EN5 D;  4HOS A;  3B7B A;  5CPR B;  1K8K G;  2JV0 A;  1D8D A;  4HI9 A;  2LO6 A;  3AAA C;  4JVS A;  4GZ5 A;  4N2S A;  1MX2 A;  4QEP A;  3OPE A;  3ZKJ A;  2R17 C;  3FUN A;  3FPD A;  3CLJ A;  3FTV A;  4RVB A;  4BTA A;  1XGW A;  3FTU A;  5CCL A;  5DIZ A;  1JUQ A;  5D2M C;  3JXI A;  5AQ9 A;  5ENP D;  4GMR A;  2OEV A;  1OCR E;  3QWP A;  3FP3 A;  4UWL A;  2CHW A;  4ME2 A;  2WXF A;  5LP0 A;  3FUM A;  5E75 A;  5JIN A;  1N4P A;  3UQ3 A;  4U07 A;  2ZGD A;  4GTS A;  2ION A;  2IQC A;  3EU9 A;  2GRM A;  5A6C A;  1SW6 A;  4OVU A;  4CYM D;  4JEU A;  3CIA A;  3KSL A;  4WAF A;  1E7U A;  1HS6 A;  2L9B A;  2VTB B;  3R7R A;  5KNG A;  3KMT A;  1DCE A;  1E8X A;  4URK A;  3IEG A;  4ILH B;  4WUY A;  3ASH A;  3CK8 A;  5G05 J;  5HQ8 A;  3VUZ A;  2IOL A;  1N54 A;  1MX6 A;  1E96 B;  3FY4 A;  1TYQ G;  1KT0 A;  3SW9 A;  4GU5 A;  4N3A A;  3DPD A;  4LRZ A;  5D0O D;  1O1T A;  1OXJ A;  2V5Q C;  2XHE A;  2L0I A;  3RK6 A;  4B89 A;  3D9O A;  5T5G A;  4GA0 A;  3DSS A;  4K0R A;  4G1T A;  3ASG A;  3FTS A;  3K9I A;  2BKK B;  3VLF A;  4J8S A;  5AYF A;  2MRI A;  4CDM A;  1FVF A;  4KZ0 A;  3R9A B;  5JJ6 A;  4UUC A;  4N3C A;  4P29 A;  5F59 A;  4J7I A;  4DI3 A;  4YDW A;  4C1Q A;  1DC2 A;  2VGX A;  1O9S A;  4ZFH A;  3D3M A;  2XQ0 A;  2Y69 E;  4O30 A;  3UT8 A;  2RFI A;  3ZPJ A;  4C0M A;  2XGO A;  3ULQ A;  5FQ8 A;  2Y1L E;  3EHM A;  4IJD A;  1MJ0 A;  1S63 A;  3ABL E;  4UQY A;  4ACK A;  1N4R A;  3FUJ A;  4ANU A;  4DJA A;  4A63 B;  2ZGG A;  2AXU A;  2EIK E;  2J4B A;  3ZGQ A;  2H6H A;  2HO1 A;  1UG3 A;  5EIL A;  5KJM A;  1HXI A;  2QYJ A;  3EP0 A;  4DLO A;  4ILG A;  3PNT B;  5CBO A;  3PE4 A;  3TWW A;  3PZ2 A;  1PAQ A;  5CCM A;  3UXG A;  3FEY A;  4Z4P A;  3AU5 A;  3KS2 A;  1MX4 A;  5AQ7 A;  4GA1 A;  4LEU A;  5EG2 A;  4A1G A;  4L2Y A;  2WXM A;  4TV3 A;  4Y6C A;  1E7V A;  4BX9 A;  2WXJ A;  3HYM B;  4YVQ C;  3DAL A;  4G23 A;  3C3R A;  5BNW A;  4LER A;  3JQ1 A;  1HX8 A;  4K03 A;  2HYZ A;  2F37 A;  4U8V D;  4H7X A;  4ACL A;  2EIN E;  2CFZ A;  2FO1 E;  1PC2 A;  3F9Z A;  4G8K A;  4ANV A;  1K1B A;  2HE0 A;  2M63 A;  4BEP A;  3EJN A;  1EDU A;  4AU7 A;  3ZW3 A;  2KXP C;  4YDE A;  1JPL A;  3FEX A;  5LSX A;  3OOI A;  4GTO A;  5A23 A;  1A17 A;  2IU1 A;  4BTB A;  3MKQ B;  4I17 A;  3QB2 A;  3TWU A;  3SFY A;  3AG1 E;  2P58 C;  4AOF A;  1D9S A;  5T0M A;  5FIO A;  3HXB A;  4UI9 C;  4J8F A;  4AEZ C;  2G46 A;  3DEO A;  2I6H A;  5AQA A;  4WND A;  3J5Q B;  3CEQ A;  3E34 A;  4FHJ A;  5JHN A;  2PM6 A;  1OWN A;  3FUE A;  3Q47 B;  4HVB A;  4GZ3 A;  4F1S A;  2ETB A;  4PH4 B;  3NZS A;  3HXF A;  5ITZ F;  4FHK A;  3ASD A;  2IO2 C;  2IEJ A;  4NJ5 A;  2V4H C;  3DBS A;  2AXZ A;  1TJC A;  4M3O A;  3FU6 A;  3UX4 A;  4C48 B;  1HG2 A;  3B7U X;  4XI0 A;  2I1J A;  5BXO A;  4GTV A;  4XKB A;  4I1A A;  3TWS A;  1SA5 A;  1BI7 B;  1K3Z D;  2IO3 C;  2VTB A;  1EPU A;  4KXK B;  4BWR A;  2WXI A;  5FZS A;  3QKY A;  2KCK A;  5EDS A;  3NB2 A;  4L23 A;  4OYS A;  4U63 A;  1DNP A;  4KT6 B;  4MKT A;  4APO A;  4Y6W A;  1OWP A;  1N52 A;  3FH8 A;  4APF A;  3IHY A;  3EDT B;  3CVY A;  5FQ4 A;  2VJ8 A;  3HIZ A;  4UWK A;  2DYS E;  4GPM A;  2XPY A;  4O6F A;  1OCO E;  5FQ7 A;  3FU5 A;  4F1P A;  1Z3X A;  3ZYQ A;  4BUP A;  2XEN A;  5HRY A;  4GA2 A;  2W5Z A;  4R7L A;  2FO7 A;  3LCA A;  3E33 A;  4U04 A;  2WXR A;  2PM7 A;  5EYP F;  2WXQ A;  2P9S G;  1FT1 A;  2HR2 A;  1TNO A;  4XX5 A;  2L6J A;  3BUA A;  3SQV A;  2B0O E;  4L9P A;  4L1B A;  4ABN A;  3F9Y A;  4DLQ A;  3OTN A;  3C5R A;  3MYV A;  5JJ7 A;  1E90 A;  4GYY A;  4JA9 A;  2R2L A;  3EHR A;  3B95 A;  2MYO A;  3FTX A;  2PQN A;  3AG3 E;  1HFA A;  2CFU A;  2ETC A;  4UI9 J;  3PEU B;  4RZ0 A;  3MJW A;  4N39 A;  5ENO D;  1ML9 A;  1SZA A;  3NZU A;  3SFX A;  3CHQ A;  3PRE A;  3ONK A;  4J0U A;  4B93 B;  1OWM A;  2XEV A;  2LAH A;  1UW4 B;  1FVH A;  1IHG A;  2XEH A;  3B13 A;  3DXK G;  3QNK A;  2EIL E;  2RFM A;  3QOU A;  3T5V A;  4J7W A;  1BLX B;  1MUF A;  5CEA A;  1S70 B;  4F6R D;  5AYW D;  3UT4 A;  1N9A A;  2KCL A;  4XIF A;  4N5Q A;  3L22 A;  4XI9 A;  3M56 A;  1ELK A;  3TG4 A;  2VSX E;  3D9L A;  5FIN A;  4F3V A;  3JUI A;  1SZ9 A;  4QEN A;  4I6E A;  4EEC A;  2XCB A;  2VSY A;  3MV2 B;  3MO0 A;  2JLB A;  1H2V C;  1QQE A;  4XKC A;  4ANW A;  4E6H A;  3P2B A;  3TXM A;  3UKU G;  2LXL A;  4AJW A;  2XRZ A;  1BI8 B;  2DYR E;  3NAW A;  3KAE A;  3C3Q A;  3Q9U C;  3ML8 A;  3BO5 A;  4RG9 A;  4CZ2 D;  4X8Q A;  1YMP A;  3SBT B;  4EBA G;  5G04 C;  5TEG A;  3V79 K;  3NBN B;  5KJN A;  3UIO C;  5ANL A;  1H2T C;  2PZI A;  4LSZ E;  2R05 A;  3TWR A;  2HM8 A;  4CEM A;  4HOR A;  2IFU A;  2Y3A A;  4LNB A;  4YPA A;  3KMA A;  5HI7 A;  1X81 A;  1N11 A;  3CK7 A;  3O48 A;  5ENQ D;  3L6A A;  2OVB A;  4K5C A;  4KVM A;  2F69 A;  3V2X A;  2EIM E; 
#chains in the Genus database with same CATH homology
 5JJ0 A;  2XQ0 A;  2FEZ A;  4JC8 A;  4O30 A;  3UT8 A;  3ONL A;  2RFI A;  3ZPJ A;  4C0M A;  2KAT A;  5F6K C;  1L5J A;  3LDZ A;  2OV8 A;  4CGV A;  2X6F A;  2XGO A;  4W9R A;  3ULQ A;  3ZEF A;  1B89 A;  5FQ8 A;  5FZR A;  2WXO A;  5LCW C;  3EHM A;  4J7F A;  4BX8 A;  3I4R B;  5T4Y A;  4IJD A;  4JHK A;  1UJJ A;  4G25 A;  1H3I A;  4FLH A;  4UQY A;  4ACK A;  3CQC B;  3QJZ A;  3FUJ A;  2CHZ A;  1LF8 A;  3MZL B;  4ANU A;  5FJY A;  4DJA A;  2C0M A;  4E85 A;  2X3M A;  3SWC A;  2AXU A;  2AXV A;  5F6L A;  2YHE A;  5LOZ A;  4I43 A;  3GZ1 A;  2R3A A;  2J4B A;  3RIB A;  3SF4 A;  3PUJ A;  4AIF A;  3LS8 A;  2BF0 X;  1N6A A;  3ZGQ A;  3TXN A;  4WNG A;  1YA0 A;  3RRN B;  2HO1 A;  4Q96 A;  1UG3 A;  1H6K A;  2CG2 A;  5FZQ A;  1IQR A;  5KJM A;  3TAX A;  1QZ2 A;  1HXI A;  1MQS A;  3FUF A;  3EP0 A;  5CMW A;  4DLO A;  4ILG A;  2V8S E;  3PNT B;  3S7B A;  3TL5 A;  3OAW A;  5FQ6 A;  3ZYK A;  3S2A A;  4UWG A;  3PE4 A;  3QWW A;  4CGW A;  4I51 A;  4G26 A;  1PAQ A;  5CCM A;  2BTD A;  2WXH A;  3DB5 A;  4UQZ A;  2X6K A;  4WWN A;  3R7Q A;  2Q7F A;  4L2L A;  3FEY A;  4Z4P A;  3AU5 A;  3FUD A;  3IHV A;  3KS2 A;  4PDX A;  4B94 A;  3CBO A;  4FU3 A;  3PH0 C;  5AJD A;  1JWF A;  4GA1 A;  4LEU A;  2DCP A;  2E0I A;  2J07 A;  2NC9 A;  5EG2 A;  3S8P A;  4A1G A;  1ZBP A;  3LEW A;  1OWL A;  3MKQ A;  2WXM A;  4L2Y A;  4TV3 A;  4Y6C A;  1E7V A;  4BX9 A;  2WXJ A;  4I9C A;  4PS3 A;  2WQ6 A;  3FWV A;  2CG3 A;  5M72 A;  2WMN A;  3OXF A;  5T0K A;  3HYM B;  3D9P A;  3CBM A;  4YNP A;  4YVQ C;  4B0Z A;  3DAL A;  2IOS A;  4WWO A;  4G23 A;  2O8J A;  4MI0 A;  5BNW A;  3L54 A;  2X6J A;  3T5X A;  4LER A;  1X5B A;  4BY6 A;  2X6H A;  3JQ1 A;  1HX8 A;  4JPS A;  3SBS A;  4K03 A;  1FCH A;  4JDS A;  3KMJ A;  3U3W A;  4GCN A;  3FUL A;  4WWP A;  4UWF A;  5EX0 A;  5AEN A;  3SGH A;  2VGY A;  1HZ4 A;  2HYZ A;  2KCV A;  2EQX A;  2I2O A;  3Q5M A;  4U0U A;  4BT9 A;  1N6C A;  4H7X A;  4ACL A;  2L0T B;  4NAC A;  2UWJ G;  3G2T A;  2CFZ A;  3S7J A;  4TRQ A;  3AU4 A;  1NA3 A;  2RD0 A;  5ENN A;  1E8W A;  3RRU A;  3MEK A;  3VLE A;  3VTY A;  2VGX B;  4UWH A;  5J90 A;  1PC2 A;  3F9Z A;  1HO8 A;  4MLP A;  4EBA A;  3CGH A;  3UMV A;  4ANV A;  5LFA A;  4I1O B;  5G2N A;  4DPR A;  3C98 A;  3SI5 A;  2M63 A;  4GB9 A;  3B7R L;  3CHS A;  3EJN A;  4JHJ A;  4A3T A;  3CVU A;  3PNL B;  4FJY A;  4EQF A;  1EDU A;  4F7A A;  4AU7 A;  3ZW3 A;  2V0P A;  3ESK A;  3IKO B;  3KEZ A;  1JPL A;  5KJL A;  2V5F A;  3FEX A;  3FTY A;  5LSX A;  3OXL A;  3OOI A;  2UY1 A;  3UUX A;  5A23 A;  1A17 A;  3FU3 A;  3LY9 A;  4IN3 B;  4PUC A;  2IU1 A;  4BTB A;  1WY6 A;  3CVQ A;  3MKQ B;  1ELR A;  4MRU A;  5F5E A;  5JJT A;  5T3R A;  2CHX A;  4RSY A;  1SQM A;  3Q49 B;  3K5K A;  4I17 A;  5D0Q D;  3QB2 A;  5J08 A;  3EIJ A;  4KVO A;  3ZFW A;  4GZ6 A;  2PQR A;  1H2U A;  2P58 C;  4JHR A;  3ZIM A;  3M57 A;  4AOF A;  2J9Q A;  2VSO E;  5T0M A;  3FUI A;  3MGB A;  4UI9 C;  3LVQ E;  4J8F A;  4GZC A;  4NUR A;  5ANR A;  3AS4 A;  3PE3 A;  3PZD A;  4JLG A;  3RKV A;  2J4D A;  3M54 A;  4AEZ C;  2R5S A;  5FT9 A;  4GCO A;  4GML A;  3MCX A;  2WMO A;  2G46 A;  3GYZ A;  5KCM A;  2I6H A;  3SHF A;  1MT6 A;  4WND A;  3U4T A;  3D9K A;  2ZU6 B;  4RG6 A;  1MVX A;  3CEQ A;  5AJL A;  3VLD A;  1UN9 A;  2WVI A;  3CVP A;  3TGO A;  4JXT A;  3FH5 A;  4FHJ A;  1INZ A;  2PM6 A;  5JHN A;  3M5A A;  1OWN A;  4OVV A;  1HE8 A;  4F53 A;  4KMO A;  4G11 A;  3FUE A;  3CKC A;  3CVN A;  3Q47 B;  4I9E A;  4YNM A;  5BUZ A;  4KBQ A;  4E47 A;  4L7T A;  4HVB A;  4GZ3 A;  1GW6 A;  4F1S A;  4EZL A;  1HG5 A;  3LYA A;  4PH4 B;  4B8A A;  4D10 C;  4GPK A;  1WAO 1;  3NZS A;  3CHR A;  1EYH A;  1MHQ A;  4FHK A;  2OND A;  3ASD A;  3ZVV A;  4NJ5 A;  2OVF A;  1P5Q A;  3HDX A;  3UPV A;  3SZ7 A;  3IV0 A;  3EHN A;  3B7T A;  3RAY A;  3DBS A;  3KD7 A;  5EX3 A;  2XPI A;  2AXZ A;  1TJC A;  2KC7 A;  3QDN A;  3LPZ A;  4M3O A;  3CVX A;  1XNF A;  3D9I A;  3FH7 A;  3FU6 A;  4J83 A;  3UX4 A;  4QEO A;  3U9W A;  3CHP A;  3GZS A;  2A4Z A;  4YND A;  2J49 A;  1HG2 A;  2FI7 A;  2Y4U A;  3M53 A;  3IBE A;  4HOT A;  3B7U X;  4XI0 A;  3M55 A;  3MV3 B;  2I1J A;  2YHC A;  4BT8 A;  5JHA A;  3ZYM A;  3APC A;  3RQ4 A;  3BEE A;  4XKB A;  4YPU A;  2IF4 A;  3L08 A;  4I1A A;  4FC8 A;  2V4L A;  5E76 A;  4MS6 A;  2VTB A;  2YQ8 A;  1U3C A;  1EPU A;  2VYI A;  2AVP A;  4KXK B;  3ZXS A;  4EPZ A;  2I9C A;  2XCC A;  3ZRH A;  2WXI A;  4BWR A;  5FZS A;  5CMY A;  3QKY A;  4A3V A;  2KCK A;  4V3I A;  5EKQ D;  3QAQ A;  5EDS A;  2IJG X;  4U8H A;  1OWO A;  4LUN U;  4HS2 A;  4IUL A;  4L23 A;  4I6J A;  4OYS A;  4U63 A;  3M59 A;  1DNP A;  2IGQ A;  2KZT B;  3LXU X;  1Y8M A;  3I4G A;  3I3N A;  2LNI A;  1H19 A;  4HOQ A;  3MO5 A;  4KT6 B;  4FUL A;  5KJK A;  4MKT A;  4APO A;  5TTF A;  2XPZ A;  3CQG B;  4AXH A;  1VDY A;  4Y6W A;  3ESL A;  1OWP A;  4GAA A;  4NQ0 A;  4CDN A;  1N52 A;  3FH8 A;  3QAR A;  4XE0 A;  2BQZ A;  4APF A;  2LSU A;  3IHY A;  3CBP A;  2R59 A;  2AW6 A;  3EDT B;  2FUL A;  3CVY A;  1UJK A;  1HF8 A;  1Z3Y A;  2YIN A;  3FU0 A;  2KZT A;  4JZY A;  3S7D A;  1WM5 A;  5FQ4 A;  4LDG A;  3CR3 A;  2VJ8 A;  3ENE A;  4IRU A;  3HIZ A;  4JA7 A;  4UWK A;  3D9J A;  2XPY A;  3D9N A;  4CCA A;  4N3B A;  4O6F A;  2ILR A;  3ZHE B;  3SNX A;  4MI5 A;  4NVQ A;  4EZJ A;  5FQ7 A;  2WXP A;  3FU5 A;  4U0Z A;  1Z3X A;  3ZYQ A;  5ARG A;  4BUP A;  1MVH A;  3TG5 A;  3VTX A;  3URZ A;  3O4Z A;  3FUK A;  4GA2 A;  1ZU2 A;  3APD A;  2W5Z A;  4DK5 A;  2GW1 A;  4R7L A;  1W3B A;  4NRH B;  3ASF A;  2FO7 A;  4Q94 A;  3OXG A;  2OOE A;  3LCA A;  5BPP A;  2DBA A;  4U04 A;  3PUK A;  2WXR A;  2PM7 A;  3MKR A;  3CHO A;  2WXQ A;  3HVE A;  4UI9 K;  4U0S A;  2YNQ A;  3ZYL A;  2HR2 A;  2QPW A;  2X38 A;  5JHB A;  1E8Y A;  3F9X A;  3CHM A;  4WNE A;  2LSV A;  3FFL A;  3G2W A;  3JYS A;  4XX5 A;  2L6J A;  2E2E A;  4I1M A;  4HLE A;  2Y4T A;  4GYO A;  3SD5 A;  1KT1 A;  4IYP A;  3LKU A;  5BW8 C;  4L1B A;  4ABN A;  3F9Y A;  4GMJ A;  4DLQ A;  4HOS A;  3OTN A;  2FBN A;  3CVL A;  3CV0 A;  3MYV A;  5JJ7 A;  5ARF A;  2JV0 A;  5CPR B;  1E90 A;  4GYY A;  1PEG A;  2GRL A;  4JA9 A;  4JEH A;  2LO6 A;  4JVS A;  4GZ5 A;  3CK9 A;  2I1K A;  4N2S A;  1HH8 A;  1S0P A;  4JW1 A;  4EZK A;  4QEP A;  4WNF A;  3B7S A;  3OPE A;  4HXI A;  3FTX A;  2PL2 A;  3SFZ A;  2R17 C;  2WQH A;  3FUN A;  1OUV A;  2PQN A;  3CVW A;  3FPD A;  3WXX A;  3CLJ A;  1HFA A;  2CFU A;  3FTV A;  4AVX A;  2C2L A;  4UI9 J;  1N3J A;  3GZ2 A;  4RVB A;  4AV7 A;  3HVE B;  4BTA A;  1XGW A;  3FTU A;  3PEV B;  4H7Y A;  3LJ3 A;  3PEU B;  4RZ0 A;  3MJW A;  1PY1 A;  4N39 A;  2MHK A;  1JWG A;  4QFV A;  5DIZ A;  5CCL A;  1ML9 A;  1H0A A;  1JUQ A;  1ELW A;  2WXK A;  2VQ2 A;  3UT7 A;  1SZA A;  3NZU A;  2BUG A;  3F9W A;  3PS6 A;  4CDR A;  1QNF A;  2WXG A;  3CHQ A;  3PRE A;  3FUH A;  3ONK A;  4J0U A;  3TJP A;  2NXP A;  2A5U A;  3GW4 A;  3MA5 A;  5TH7 A;  3ZHE A;  1Z6T A;  2JEK A;  2XGM A;  2WM9 A;  3BG0 B;  1NZN A;  4PS8 A;  3CST A;  1OWM A;  3MO2 A;  2XEV A;  2LAH A;  1UW4 B;  3N71 A;  3QWP A;  1FVH A;  4N5C A;  4C9B B;  2C0L A;  4FMU A;  3FP3 A;  3NQP A;  4UWL A;  2CHW A;  3ML9 A;  2XRY A;  4ME2 A;  2WXF A;  5C1D A;  5A7D B;  1IHG A;  3B13 A;  4I6G A;  1KLX A;  4UQX A;  5LP0 A;  1BPO A;  3QNK A;  3D9M A;  3RU0 A;  4AY6 A;  3E4B A;  3FUM A;  2J09 A;  5E75 A;  3QOU A;  5JIN A;  3HHM A;  3L16 A;  3UQ3 A;  4A1S A;  4U07 A;  3G2U A;  3T5V A;  3G2V A;  2W5Y A;  3RRM B;  1MUF A;  2ION A;  2IQC A;  4ATG A;  5AIJ A;  5FWQ A;  2GRM A;  5AYW D;  5A6C A;  4J6I A;  3RJV A;  1DVP A;  4GZD A;  4OVU A;  3UT4 A;  4AM9 A;  5LX8 A;  4HFG A;  3PRZ A;  4CT0 A;  4DI4 A;  4JEU A;  3CIA A;  4XZ4 A;  2KCL A;  5BV0 A;  3M58 A;  5DBK A;  4AP2 A;  4TUU A;  4WAF A;  4XIF A;  4CT4 A;  3QWV A;  1E7U A;  1HS6 A;  2L9B A;  3L22 A;  4XI9 A;  4Q69 A;  3R7R A;  2VTB B;  3M56 A;  4ANX A;  3Q4A B;  4FP7 A;  1ELK A;  4YVO A;  3TG4 A;  2VSX E;  3JQ0 A;  3KMT A;  3D9L A;  3EIQ C;  2VSN A;  3G2S A;  4HOU A;  4PS7 A;  4F3V A;  3CSF A;  3L17 A;  3QC1 A;  3IHX A;  3AS8 A;  1TJF A;  1E8X A;  4URK A;  3IEG A;  4ILH B;  3FTW A;  1SZ9 A;  2KM4 A;  3I5P A;  3JUI A;  4WUY A;  5FTP A;  4QEN A;  2AWI A;  5G04 J;  3ASH A;  3NF1 A;  4I6E A;  3CK8 A;  5G05 J;  3ZN3 A;  4EEC A;  2XCB A;  3BG1 B;  4AY5 A;  2VSY A;  5G55 A;  1IQU A;  2QY7 A;  2GGF A;  4GYW A;  4A55 A;  5HQ8 A;  3VUZ A;  1IYG A;  2IOL A;  3VV0 A;  4J8O A;  2WXN A;  3MV2 B;  1N54 A;  3MO0 A;  1EF1 C;  5LSZ A;  3RO3 A;  1ZKK A;  2WPV A;  2JLB A;  1H2V C;  1QQE A;  2QFC A;  4XKC A;  3RO2 A;  1E96 B;  3P2B A;  4ANW A;  3FY4 A;  4E6H A;  4J8E A;  4N2Q A;  1NA0 A;  3APF A;  4YPE A;  5JIY A;  3TXM A;  2X6I A;  4AJW A;  2XRZ A;  1KT0 A;  4IJ8 A;  3SW9 A;  4GU5 A;  4N3A A;  3DPD A;  3LVR E;  2J08 A;  4LRZ A;  3MX3 A;  4FJZ A;  5D0O D;  3S7F A;  2XHE A;  3KAE A;  4BSX A;  2WQ7 A;  3ML8 A;  4J8D A;  3BO5 A;  3LY8 A;  5LCW J;  4JL0 A;  4RG9 A;  2L0I A;  5BV1 A;  3L13 A;  1HU3 A;  3FTZ A;  2UY1 B;  3RK6 A;  3SBT B;  4B89 A;  4C0E A;  4EBA G;  5G04 C;  2WB2 A;  5TEG A;  5T8I A;  3D9O A;  4FA6 A;  3P1U A;  3RJW A;  5G05 C;  1UN8 A;  5T5G A;  3CKB A;  5KJN A;  4KYO B;  2XGS A;  5ANL A;  1H2T C;  2PZI A;  4I2W A;  4G24 A;  4I2Z A;  4GA0 A;  3U64 A;  2LAI A;  1NP7 A;  2NSZ A;  1Y6I A;  3PVL A;  3T8M A;  3U66 A;  4K0R A;  4ILI A;  3FDH A;  4G1T A;  3ASG A;  4LCT A;  3FTS A;  2MOW A;  3K9I A;  4FLB A;  3PDN A;  4G2V A;  2HM8 A;  3VLF A;  4J8S A;  4CEM A;  2IFU A;  5BT1 A;  4HOR A;  5AYF A;  2MRI A;  2Y3A A;  4CDM A;  2DIW A;  1U3D A;  1FVF A;  4KZ0 A;  3R9A B;  4YPA A;  3KMA A;  4CRW A;  1XQH A;  4B8C B;  5JJ6 A;  5HI7 A;  2RG8 A;  4N3C A;  3LY7 A;  4P29 A;  3OS5 A;  5F59 A;  4KZC A;  3CVV A;  3QK0 A;  3CK7 A;  1TEZ A;  4J7I A;  3FHE A;  3O48 A;  5C2Y A;  4DI3 A;  4FAD A;  3JCK C;  5CHE E;  4BFR A;  3L6A A;  2OVB A;  3Q15 A;  4KVM A;  2F69 A;  4C1Q A;  3AS5 A;  2VGX A;  1O9S A;  4H12 A;  2WXL A;  3HNA A;  2FF4 A;  3D3M A;  1E8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...