4YNDA

The discovery of a-893, a new cell-active benzoxazinone inhibitor of lysine methyltransferase smyd2
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
428
structure length
428
Chain Sequence
b'AEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Discovery of A-893, A New Cell-Active Benzoxazinone Inhibitor of Lysine Methyltransferase SMYD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Tranferase/transferase inhibitor
total genus 132
structure length 428
sequence length 428
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4yndA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4yndA01
3MO5A 3KMAA 4WUYA 3LKUA 5CCLA 3M58A 3MV2B 5T0MA 2O8JA 3CBPA 4AY6A 2Y4TA 3TG5A 2Q7FA 5LCWC 4GCNA 1FCHA 4H7XA 3RU0A 5F5EA 4YNDA 2DBAA 4YNPA 3VTXA 3ZHEA 3SWCA 4QENA 4I2WA 3ASGA 5CCMA 3QWWA 3F9ZA 2XGOA 2PZIA 4ABNA 3MO0A 3RKVA 4H7YA 3GZ1A 3KD7A 1NZNA 2IFUA 3S8PA 4KXKB 5D0QD 4RG9A 3ESKA 4QEPA 3VV0A 4GA1A 4CGWA 3S7FA 4UI9J 4I1AA 1A17A 1OUVA 3MV3B 2JLBA 4KYOB 4XIFA 4KBQA 3S7BA 3NF1A 3OS5A 2PL2A 5G05C 4C1QA 4HOUA 1O9SA 4N39A 3WXXA 2XGMA 5FZRA 3E4BA 3IEGA 4WNDA 2XGSA 5LCWJ 3RIBA 1PC2A 2C0MA 1W3BA 4RZ0A 4IJ8A 1ELWA 5FTPA 4NJ5A 2PQNA 2XCCA 4BWRA 3LPZA 2HR2A 3GZ2A 3OPEA 3AS5A 4N3CA 4GYOA 4E47A 5DBKA 4J83A 5FT9A 3PE3A 5KJKA 4I2ZA 1TJCA 3OOIA 4IN3B 3TGOA 1H3IA 4N2QA 3S7DA 4B94A 3ZGQA 4GYYA 3N71A 3UPVA 5G05J 2JV0A 3BO5A 5EG2A 3ULQA 5EX3A 4GZ6A 4U0ZA 3AS4A 1ZBPA 2FF4A 3CKCA 1HXIA 2P58C 3LY7A 4UI9K 5EKQD 3K5KA 5JJTA 4AIFA 4J7IA 3AS8A 3RQ4A 1IYGA 5JJ6A 5AYFA 3FFLA 4G24A 4JL0A 3FPDA 3U3WA 5T0KA 4LDGA 3DALA 3SF4A 4U04A 2VGYA 4JHRA 2NC9A 3BEEA 2IGQA 4NVQA 2BUGA 2YHCA 2W5ZA 5HI7A 4I9CA 5G04C 4MI0A 5KJNA 3U4TA 5F6KC 4YPEA 4YVQC 4G2VA 2R5SA 3CEQA 2BQZA 2HO1A 4G26A 2KCVA 3OXGA 1NA3A 4O30A 3CVNA 3SZ7A 4AM9A 5ARGA 4NQ0A 3R9AB 1B89A 5LSXA 3CK8A 2PQRA 5T5GA 4BTBA 2VSNA 1E96B 3OXFA 4NRHB 3TG4A 3M57A 5DIZA 3ASFA 3EP0A 4CDRA 5G04J 3M55A 4YVOA 3F9WA 4I9EA 4IJDA 3TAXA 4N5CA 3ASHA 4UQYA 4CGVA 4LEUA 4H12A 3RJWA 3MKRA 4G1TA 3RJVA 3URZA 3CV0A 3LY8A 4MI5A 2QPWA 3IHXA 3KMJA 5FZSA 5EX0A 3KAEA 4BT8A 1XNFA 3MO2A 4J8EA 2KC7A 1HZ4A 3GYZA 5JHNA 4RG6A 3ZFWA 2RFIA 4Y6CA 2HYZA 3HNAA 3EDTB 4A1SA 4JA9A 3MEKA 3S7JA 4UQZA 4O6FA 4GCOA 2J9QA 3Q49B 1P5QA 5TTFA 3M53A 4N2SA 3F9YA 4GZ5A 5HQ8A 3MA5A 2VGXB 3PE4A 4N3BA 1ELRA 5LSZA 3CBOA 2G46A 1WAO1 1ZKKA 5TH7A 1HH8A 4BT9A 3FP3A 3LCAA 4GA0A 4N3AA 2XEVA 4G23A 4ME2A 2W5YA 3HYMB 2UY1B 5A7DB 1WM5A 2UWJG 5BT1A 4J8FA 4GA2A 3CKBA 5TEGA 3QKYA 2OOEA 3VTYA 1XQHA 2V5FA 5KJLA 1KT0A 3FWVA 3Q15A 2XPIA 2KCLA 3QOUA 4W9RA 5CHEE 3M56A 3LY9A 5M72A 3VUZA 5BNWA 4APOA 2LSUA 1N6AA 1MVXA 3UUXA 2LSVA 5A6CA 3ZPJA 3M54A 1NA0A 2FEZA 2FI7A 3GW4A 4GZ3A 5CPRB 1QZ2A 4UQXA 4J8OA 3K9IA 1IHGA 1KT1A 4I51A 2C2LA 3M5AA 5ARFA 1PEGA 1Y8MA 5KJMA 2WQHA 2QFCA 2E2EA 4HOTA 5JJ0A 5JIYA 1ZU2A 2VSYA 3ZN3A 3KMTA 4YNMA 1ML9A 2F69A 4AY5A 4GPKA 4FMUA 3F9XA 4U0UA 3CK9A 4JA7A 2VGXA 2R3AA 2XCBA 4G25A 5F59A 1KLXA 4Z4PA 3Q5MA 3PDNA 3UQ3A 5BW8C 5F6LA 4HORA 3CK7A 3ZHEB 4BUPA 3JYSA 4J7FA 3SW9A 2IF4A 4WNGA 4F3VA 1N6CA 2GW1A 3CVQA 2UY1A 2MHKA 4QEOA 3QWPA 3DB5A 4U07A 4HOSA 3O48A 4XI9A 2FBNA 2AVPA 3KS2A 4J8DA 3Q4AB 5C1DA 1QQEA 2ONDA 4GYWA 2C0LA 5FJYA 2LNIA 3QWVA 4YPUA 3CVPA 4JLGA 3ASDA 1N3JA 2WPVA 5JJ7A 4AU7A 5D0OD 2VQ2A 4WNEA 4HOQA 2FO7A 2KATA 3RO2A 4WNFA 3M59A 1YA0A 3OXLA 3QDNA 4Y6WA 3LYAA 3CVLA 1MUFA 4JDSA 1MT6A 4I17A 2L6JA 5JINA 5FZQA 4XI0A 3CBMA 4J0UA 4BTAA 5AYWD 1MVHA 4UI9C 2VYIA 3RO3A 2I6HA 2KCKA 4U0SA 4YPAA 3RAYA 2Y4UA 3Q47B 2YQ8A 4EQFA
chains in the Genus database with same CATH superfamily
4KVOA 1O5MA 2DZNA 3FUFA 2O8JA 3CBPA 1FCHA 3FHEA 5E76A 5G2NA 3MCXA 2XPYA 4YNPA 1JWFA 4QENA 2J09A 3UT4A 4FULA 2RFAA 4HBDA 2PZIA 3PUJA 3TWSA 3MO0A 5FWQA 3FEYA 3KD7A 2IFUA 4UWHA 5CBOA 4GA1A 3ENEA 2WXJA 2H6FA 1A17A 3UM1A 3MV3B 5AQ7A 2R02A 3ASNE 3FU6A 4LG6A 1BLXB 3OS5A 1OCRE 4JHKA 4HNAD 2WXFA 3MX3A 2X3MA 4N39A 5FZRA 4GZDA 1H2UA 2C0MA 3NBNB 5AENA 2DWZA 4DX1A 3PH0C 3QJZA 2PQNA 2XCCA 4BWRA 5HS0A 4UWFA 3FUDA 2HR2A 3VLFA 3L9TA 4GYOA 4LNGA 1UG3A 1TN7A 5DBKA 3QC1A 3NB2A 3FU5A 2J08A 3OOIA 4IN3B 3UIOC 3FU3A 3MZLB 1H3IA 4F53A 2MOWA 1D8DA 4F1PA 3IHVA 2A4ZA 3CHPA 3DEOA 1D8EA 3ZW3A 4TUUA 3AS4A 1UOHA 2FF4A 3CKCA 1HXIA 4DI4A 1YMPA 5JJTA 4AIFA 1SA5A 3RQ4A 5AYFA 4JL0A 3FPDA 1DCEA 3U3WA 3ISMC 4LDGA 2ETCA 4ACLA 3BEEA 2X6HA 4NVQA 2IOLA 2YHCA 3QAQA 1N94A 4O1OA 5KJNA 5HRYA 2QC9A 3T5XA 3CSFA 2J49A 3IXEA 2HO1A 1QBQA 3PRZA 3FDHA 2KCVA 2Y69E 3CVNA 5ANRA 3EIQC 4AM9A 3CSTA 3V2XA 2KXPC 3RAUA 4F7AA 4TXQA 1E96B 3OXFA 1UJJA 5DIZA 3EP0A 1LTXA 2V4LA 4YVOA 4AV7A 4I9EA 3TWUA 2AW6A 2RD0A 1N4QA 3U9WA 3DSTA 4TXPA 3EHQA 3MKRA 4GMLA 3HRAA 2BTDA 3URZA 3IHXA 4HFGA 2M63A 4LUNU 1U3DA 3B13A 3VLDA 1RW2A 2XENA 2X6IA 3Q73A 4Y6CA 3EDTB 4XX5A 3BUAA 3DPYA 4GCOA 1MX4A 2J9QA 1P5QA 5KNGA 1HS6A 1DCQA 4PS3A 3G2TA 2VGXB 3PE4A 4GTMA 2QYUA 1E90A 3UMVA 4U7EB 4GTVA 3CBOA 2VJ8A 3AU5A 3TJPA 1WAO1 5LP0A 1AP7A 3GZSA 4J8YA 3ML8A 1JCQA 3FUJA 3CQGB 4CT4A 1G3NB 3C5RA 4G23A 4JC8A 4A3VA 4AOFA 2W5YA 3HG0D 3SBSA 1JCRA 3G2UA 3VTYA 1BD8A 2V5FA 3TWVA 3ZVVA 5KJLA 2HM8A 3SQVA 2XPIA 1UJKA 5M72A 3R9MA 4APOA 3UXGA 2DCPA 3E32A 3FUNA 5A6CA 2B0OE 3ZPJA 4MLPA 2WXPA 3I4RB 3UM2A 4JVSA 2FI7A 5CPRB 1QZ2A 5BXOA 4HRNA 3DSXA 4UQXA 1K8KG 1KT1A 4I51A 1KZPA 5ARFA 5ENRD 2E2EA 3ABME 1OWNA 1ZU2A 2IU1A 1ML9A 3RRUA 4PH4B 1YYHA 2WQ7A 4FMUA 3F9XA 4IULA 2OV8A 4Q96A 2L0IA 2VGXA 2CHXA 2X6FA 2XCBA 1OWOA 1OXJA 3PS6A 2ZU6B 5F59A 1KLXA 3Q5MA 3CHMA 4LRZA 3PDNA 5BW8C 3JYSA 4YDEA 4J7FA 2IEJA 1SQMA 2BKKB 2IF4A 5AQAA 1N6CA 1TEZA 4QEOA 4V3IA 3SD5A 5C2YA 4U07A 2GGFA 2AVPA 4J8DA 3SO8A 3TXNA 1N4SA 2H6HA 4NACA 3S2AA 5ANLA 3ASDA 4KMOA 4AEZC 1LF8A 3SGHA 2P2CP 3DRAA 3MYVA 1ZB1A 2FO7A 3RO2A 3M59A 2F8YA 4P29A 4DJAA 3FH5A 3SY2A 1YA0A 3T5VA 2WXOA 3QDNA 5BUZA 3LYAA 1BI8B 4FU3A 4DLOA 4QQIA 1MUFA 4JDSA 4DX6D 3C72A 2XS1A 4OAVB 1UN9A 4FA6A 3TWXA 4HVBA 5JINA 4CT0A 3CBMA 3UINC 1MVHA 4UI9C 2VYIA 3R7RA 1H6KA 2Y4UA 1O1RA 3Q47B 3SFXA 1IHBA 3L13A 5ENQD 1AWCB 3CGHA 4PDXA 5CCLA 3MV2B 5T0MA 4BSZB 3HXFA 2Q7FA 3JCKC 1E8WA 3UX4A 4RLYA 3TWTA 1JPLA 3HDXA 4GCNA 4G11A 4H7XA 3RU0A 2CG2A 4NIKA 3DSUA 3SWCA 5CCMA 4FLBA 2XGOA 2NXPA 4H7YA 5AQ9A 5J90A 1X81A 3S8PA 4KXKB 5D0QD 4C9BB 3ESKA 3CVVA 5ENOD 3S7FA 3SHFA 4UI9J 4I1AA 1OUVA 5KNHD 2OEVA 1OCZE 3B7TA 3KSLA 3S7BA 5CECB 1U3CA 3D9JA 5HKPA 3HIZA 5EN5D 4ANVA 2WVIA 4DX7D 2KZTB 2WXQA 2CHZA 3E4BA 3IEGA 1HFAA 1EPUA 2J07A 4IJ8A 2J8SD 1V55E 2XEHA 5FTPA 4NJ5A 3U66A 2LO6A 2HE0A 1DVPA 5T8IA 5JA4D 3ZXPA 4J83A 5FT9A 3PE3A 5KJKA 1QYMA 5EILA 4I2ZA 3MGBA 2YHEA 3TGOA 2FULA 4A3TA 1XGWA 2JV0A 3LVRE 5EG2A 5EX3A 4GZ6A 3QNKA 1ZBPA 2PM7A 4F6RD 2H6GA 2P58C 4GTOA 3LY7A 4MKTA 4MS6A 3K5KA 3FTWA 2GRQB 2P9KG 3ZU7B 4CEMA 3FUKA 5CEAA 4OYSA 5D2MC 4JEUA 4C48B 1WY6A 4G24A 3MJWA 4DLQA 4NURA 3DALA 3SF4A 4JD2G 1BPOA 3BQOA 2CHWA 3EHRA 5JMND 3I5PA 5JHAA 3ONLA 3KEAA 2W5ZA 3J5PA 3UT7A 1JWGA 5G04C 3FTXA 5F6KC 1N9AA 4YVQC 2KZTA 3LEWA 3L82A 3UKUG 4C0MA 3G2SA 3DEPA 4MRUA 3HXCA 3FEXA 3OXGA 4O30A 3PZ1A 2L9BA 3RRMB 4GTSA 1E8ZA 3D9KA 1MX2A 5ARGA 1B89A 3CK8A 2PQRA 2XEEA 4BTBA 1H6OA 5CRUA 2ZGGA 3SFYA 4NRHB 3V79K 1SVXA 3CHSA 4K5CA 1EF1C 5G04J 3F9WA 3SNXA 3Q75A 1INZA 4RSYA 4RVBA 3QK0A 4Q94A 2I9CA 3L54A 3RJWA 4OVVA 4G1TA 3RJVA 3CV0A 2J4BA 3QARA 2QPWA 4FJZA 2MYOA 4B8AA 2LXMA 3KAEA 1K1AA 1XNFA 1FT1A 2KC7A 3GYZA 5JHNA 3CVYA 2RKKA 3ZFWA 4FP7A 2RFIA 2HYZA 3HNAA 2IO3C 1HU3A 4O6FA 3C3RA 2OCCE 4BFRA 4FC8A 2ZGDA 4GZ5A 3LDZA 3CVUA 4DK5A 3PREA 4J8SA 1H6PA 1Q2ZA 1FVFA 4HRMB 2G46A 4LNBA 3UI2A 1ZKKA 2YINA 3BG1B 3LCAA 4BY6A 4N3AA 2A5UA 5ENPD 1TN8A 4ME2A 3CVXA 2FO1E 2UWJG 4BX8A 4J8FA 5ENTD 3EU5A 4L9PA 5TEGA 2BEDA 1PY1A 3B7UX 1KT0A 2R05A 3QOUA 3VUZA 2P9UG 3T9KA 4K03A 2LSUA 3ZEFA 3BU8A 2V4HC 5H7PA 2IOSA 1NA0A 4UWLA 4ATGA 4GZ3A 2ETAA 3IHYA 4A1GA 3DBSA 4J8OA 5KBAA 5T4YA 1IHGA 1TJFA 3UM3A 2WB2A 1PEGA 2I2OA 2WQHA 1S70B 3P1UA 5JIYA 3KSQA 1SZ9A 3KMTA 4ILGA 2F69A 4AY5A 3AG3E 3TWRA 4R7LA 2V5QC 4JA7A 4MBGA 3JXIA 4G25A 1SW6A 1MX6A 4EHMA 5F6LA 3CK7A 3ZHEB 1MQSA 3AG4E 2QY7A 4B8CB 4F3VA 4CDMA 1OCOE 3CVQA 2MHKA 4JZYA 4HOSA 4RQIA 3D9OA 5D66A 2L6BA 2EIME 3Q4AB 5C1DA 3HVEB 4HS2A 2ONDA 2AJAA 4GYWA 2C0LA 5FJYA 4YPUA 4JLGA 2VSXE 4O60A 5CBNA 3DXMG 4AU7A 4B89A 4WAFA 4WNEA 4M7CA 3DWLG 1OT8A 3OXLA 4M3OA 4Y6WA 4J6IA 1MT6A 2WXLA 4I17A 2L6JA 3FUMA 4J0UA 2WMOA 4BTAA 4BX9A 1TNYA 4CZ2D 3OAWA 2KCKA 4YPAA 4XKBA 2R59A 2V0PA 3RAYA 2YQ8A 5EIDA 3EHMA 4KZ0A 4EZKA 2WXRA 3KMAA 4UWGA 3LKUA 3M58A 4KVMA 3W9FA 3DSWA 4L7TA 1FT2A 4I6JA 4EBAA 4GPMA 5BV0A 3ZHEA 4CYMD 4I2WA 3ASGA 2RFMA 3QWWA 4L2LA 4AP2A 5AAOA 2MRIA 4ATZD 3EHNA 3AG2E 3EJNA 3D3MA 1TN6A 1HG5A 1BU9A 2WXKA 2V8SE 3HVEA 2JLBA 4KYOB 2DYSE 1IKND 3IBEA 3FU0A 4ILIA 5E75A 4CCAA 1Z3XA 4ILHB 4KBQA 4L1BA 3NF1A 3UT8A 3T8KA 2XRYA 5G05C 5CEDB 4C1QA 1O9SA 3WXXA 2XGMA 2XGSA 3RIBA 3TWQA 2P9LG 3JUEA 3LVQE 4OAUC 4RZ0A 3B7RL 4DRXE 1MYOA 4FADA 3LPZA 2IJGX 4ZHBA 3OPEA 2JEKA 2WM9A 3APFA 2NYJA 1H0AA 2GRLA 4EZLA 1OWLA 4N2QA 3ZNGA 1S63A 3S7DA 3ZGQA 4GYYA 5G05J 4JPSA 4QFVA 2CG3A 4HLLA 4U0ZA 1HX8A 3ESLA 2A5EA 4UI9K 3PZDA 3B7SA 2B6CA 4J7WA 4J7IA 3Q78A 4A55A 1IYGA 4AJWA 3D9MA 2VGYA 2NC9A 2IGQA 3CIAA 4ANXA 4GAAA 3DSVA 5CMYA 4E6HA 3U4TA 2JABA 3W9GA 3V2OA 4G2VA 4U95D 2R5SA 4G8LA 3CEQA 5BXUA 4G26A 1NA3A 2OVFA 3FTUA 3SZ7A 3HXEA 2DIWA 1KZOA 1YCSB 3CQCB 1OWPA 4UWKA 3JXJA 4HQDA 5LSXA 3OTNA 4GTPA 5T5GA 2WXGA 4ANWA 3TG4A 4N5QA 2NSZA 2LUHA 3PNLB 3EU9A 3ASFA 4CDRA 1JCSA 3T8MA 3M55A 4B93B 3CR3A 4GZCA 3TAXA 3ZIMA 1TYQG 2VGEA 4UQYA 4LEUA 3TL5A 4EPZA 3LY8A 4MI5A 5FQ8A 3SFZA 4AXHA 3KMJA 2AXVA 5FZSA 1RZ4A 1BI7B 4BT8A 2XRZA 3MO2A 4J8EA 4O1PA 1HZ4A 4RG6A 4URKA 3PZ4A 5EYPF 2F0YA 5FQ7A 4U8YD 3EUVA 3RRNB 1NFIE 2R03A 5AJDA 1VDYA 3D9PA 4JA9A 3MEKA 4OVUA 4JW1A 3S7JA 4Z68A 1N0RA 4WWNA 2QZAA 1FPPA 3PZ3A 5HQ8A 3MA5A 3PVLA 4N3BA 1ELRA 5LSZA 2XS8A 3JQ1A 4YDOA 5TH7A 1HH8A 1LD8A 4BT9A 3ZKJA 4K5BA 4K5AB 1Z3YA 4A63B 3D9LA 5BPPA 3HYMB 5A7DB 3PZ2A 1WM5A 5KWDA 3NZSA 3C3OA 3ZYQA 3APCA 1EYHA 3EIJA 4ZFHA 3QKYA 1UW4B 2GROB 4JXTA 4W9RA 3ZYLA 3M56A 3LY9A 2WXHA 5EYLA 3UKRG 5BNWA 4ANUA 4TV3A 2EQXA 1MVXA 1TNBA 2LSVA 1NP7A 3M54A 3HHMA 2FEZA 4X8QA 4WWPA 3GW4A 5FQ4A 2XZDG 1V54E 1OWMA 2C2LA 3M5AA 3B95A 2RG8A 5KJMA 1L5JA 1HE8A 2GRRB 3DXKG 2VSYA 3PNTB 4FJYA 5FIOA 4DI3A 3L08A 5B3SE 4GPKA 4TRQA 3J5QB 4U0UA 4BSXA 2R3AA 2YNQA 5LFAA 4EBAG 1DC2A 4JB8P 1H2TC 3E33A 1HF8A 4HORA 4BUPA 3E34A 3SW9A 2ZISA 4WNGA 5AIJA 2GW1A 1N11A 2F8XK 4HB5A 3DB5A 5ITZF 4AVXA 2X38A 1S0PA 2R17C 3KS2A 3L17A 3TWWA 5LX8A 3QWVA 4PS8A 1IQUA 3CVPA 2WPVA 1NI1A 2AXZA 3PEVB 1PAQA 5D0OD 3FTYA 1E7UA 2P9IG 2BF0X 2KATA 4WNFA 4K0RA 4U63A 4BEPA 4HI9A 2X6JA 4DX5D 2E0IA 5AN8A 3CVLA 3MKQB 4L23A 4XEIG 3BG0B 5KCMA 5AQBA 4JEHA 4I6GA 2KBXA 4PUCA 1S64A 2AWIA 5IY5E 3PUKA 4HI8A 2XHEA 3MO5A 5T3RA 4WUYA 3V30A 1QNFA 1IXVA 4GU5A 4EZJA 4IRUA 4AY6A 2AXUA 2Y4TA 3TG5A 4ACKA 5LCWC 4GTQA 5F5EA 3FUEA 4YDWA 4YNDA 2DBAA 4E85A 3VTXA 2XPZA 3F9ZA 3FULA 4ABNA 4YDYA 3FY4A 4U96D 3RKVA 3GZ1A 1N54A 2WXNA 2OEWA 1NZNA 3APDA 4RG9A 4QEPA 2IO2C 3VV0A 4CGWA 3UIPC 3L6AA 1WG0A 3HXDA 4XIFA 3UM0A 2KM4A 2P9NG 3ZUVB 3Q79A 3IV0A 2L0TB 4GB9A 2PL2A 2GRNB 3I4GA 4HOUA 2PNNA 4WNDA 5LCWJ 1PC2A 2LAHA 1W3BA 4XE0A 5JHBA 5ENSD 2Y1LE 3D9HA 1N95A 1N0QA 3F6QA 1ELWA 3MKQA 4IYPA 2DZOA 3DSSA 3GZ2A 3ML9A 3SI5A 2I1KA 3AS5A 4N3CA 4GTRA 3DPDA 4E47A 2ZIRA 2H6IA 2GRPB 1TJCA 3RSEG 3X2QE 1UN8A 2EINE 4U8VD 4LCTA 4B94A 2LAIA 4TXRA 2GRMA 3N71A 4GMJA 4EECA 3UPVA 1ELKA 3BO5A 3ULQA 3P2BA 3B7BA 3ZRHA 3C98A 4B0ZA 5EKQD 4HXIA 3ZYMA 4LNUD 3JUIA 3AS8A 1K1BA 4FHJA 5JJ6A 3FFLA 2WXMA 1Z5SC 2XQ0A 5T0KA 1TNZA 4U04A 4CRWA 4JHRA 3L22A 4FHKA 2ZXWE 5BV1A 3SBTB 3WG7E 2BUGA 5HI7A 4I9CA 1OCCE 4I1OB 3KEZA 1H19A 4MI0A 5B1BE 3CHOA 2ETBA 2Y3AA 3AAAC 4YPEA 4LSZE 2BQZA 1O1TA 4JHJA 3FUIA 1D9SA 2PM6A 2WXIA 1GW6A 4F1SA 1MHQA 2CFUA 3V31A 3AU4A 4NQ0A 3R9AB 4GTTA 4BESA 3NZUA 3LXUX 3NOGD 3CVWA 3FH8A 4I43A 2VSNA 3M57A 4WWOA 2EIJE 5EIBE 4IJDA 1Z6TA 4HLEA 4N5CA 3ASHA 3ONKA 4CGVA 4H12A 3G2WA 3AJIA 1N52A 4U8HA 1A5EA 5EX0A 3ABLE 4UUCA 2WQ6A 3FTVA 3LS8A 4KZCA 1O1SA 2WMNA 3PEUB 1SZAA 3Q9NC 1JUQA 2VSOE 4G8KA 2BKGA 1TNUA 4A1SA 3D9NA 5EDSA 3NAWA 4UQZA 2P9PG 3FTSA 3ABKE 3Q49B 4XKCA 4BERA 1TNOA 3FH7A 5TTFA 3M53A 1HO8A 5A23A 4N2SA 3JQ0A 3F9YA 5AJLA 3ULEG 5J08A 1X5BA 2QYJA 4HRLA 3CHQA 2OVBA 3NQPA 4DX2A 3G2VA 3FP3A 3CHRA 3LJ3A 4GA0A 2XEVA 2DVWA 3ULYA 3C3QA 2UY1B 4BETA 5BT1A 3FTZA 4GA2A 1Y6IA 3CKBA 2I1JA 2OOEA 1XQHA 1EDUA 1WDYA 5FINA 3FWVA 3Q15A 3Q7FA 2KCLA 4LERA 5CHEE 1OY3D 1LD7A 4DPRA 1N6AA 4APFA 3IKOB 3UUXA 3L16A 5B1AE 2EILE 2Y0BG 3E37A 2EIKE 1E7VA 2P9SG 3K9IA 1HG2A 3UTMA 4C0EA 1E8XA 2VTBB 3NOCD 1Y8MA 2QFCA 1DNPA 4HOTA 5JJ0A 4XZ4A 1K3ZD 3R7QA 4KT6B 3ZN3A 3ASOE 4YNMA 4PS7A 3VLEA 5LOZA 3HXBA 4I1MA 1MJ0A 2DYRE 3CK9A 5CMWA 1KPSB 3U64A 4Z4PA 2J4DA 3UQ3A 3O4ZA 3ZXSA 1IQRA 2LXLA 2CFZA 5G55A 4CDNA 1FVHA 2UY1A 1U2VG 1SA4A 3QWPA 4DUIA 1N4RA 5FQ6A 3O48A 4XI9A 1E8YA 2FBNA 1N4PA 5CRVA 4FLHA 1QQEA 4L2YA 1TR4A 2IONA 2LNIA 2IQCA 1N3JA 5JJ7A 3AG1E 1H2VC 2VQ2A 4HOQA 3Q7AA 3RK6A 3I3NA 3QB2A 1MZCA 2ILRA 3CLJA 2IY0C 4GMRA 4D10C 3TXMA 2F37A 1NL4A 2VTBA 5FZQA 4XI0A 3D9IA 3E30A 4TUMA 5AYWD 3ZYKA 3FUHA 3RO3A 2I6HA 4U0SA 2X6KA 5ENNA 2XZTG 3LJNA 3Q9UC 4I6EA 5CERB 5AARA 4Q69A 4EQFA 2R2LA
chains in the Genus database with same CATH topology
3L13A 4KVOA 2XHEA 4EZKA 3MO5A 2WXRA 3CGHA 3KMAA 4PDXA 5T3RA 4UWGA 3FUFA 3LKUA 4WUYA 5CCLA 1QNFA 3MV2B 3M58A 2O8JA 4GU5A 5T0MA 3CBPA 4EZJA 4IRUA 4AY6A 2AXUA 2Y4TA 4KVMA 2Q7FA 3TG5A 3JCKC 1E8WA 3UX4A 4ACKA 5LCWC 1JPLA 3HDXA 4GCNA 1FCHA 3FHEA 4G11A 4H7XA 4I6JA 2CG2A 4L7TA 3RU0A 3FUEA 4EBAA 5F5EA 5E76A 4YNDA 5G2NA 2DBAA 4E85A 3MCXA 5BV0A 2XPYA 4YNPA 1JWFA 3VTXA 3ZHEA 2XPZA 3SWCA 4QENA 4I2WA 3ASGA 5CCMA 4FLBA 2J09A 3UT4A 3QWWA 4L2LA 4FULA 4AP2A 3F9ZA 2XGOA 2MRIA 3FULA 2PZIA 3PUJA 4ABNA 2NXPA 3FY4A 3MO0A 3RKVA 4H7YA 3GZ1A 3EHNA 5FWQA 5J90A 3FEYA 1N54A 2WXNA 3D3MA 1NZNA 2IFUA 3EJNA 3KD7A 3S8PA 4KXKB 3APDA 4UWHA 5D0QD 4RG9A 4C9BB 3ESKA 4QEPA 3CVVA 3VV0A 1HG5A 4GA1A 2WXKA 4CGWA 3ENEA 2V8SE 2WXJA 3S7FA 4UI9J 3HVEA 4I1AA 1A17A 1OUVA 3MV3B 3SHFA 2JLBA 4KYOB 3L6AA 3IBEA 3FU6A 3FU0A 4XIFA 3B7TA 4ILIA 5E75A 4CCAA 1Z3XA 4ILHB 4KBQA 4L1BA 3NF1A 2KM4A 1U3CA 3D9JA 4JHKA 3S7BA 3UT8A 3OS5A 2WXFA 3IV0A 2L0TB 4GB9A 2XRYA 2PL2A 3HIZA 5G05C 4ANVA 4C1QA 3MX3A 2WVIA 2X3MA 3I4GA 4HOUA 1O9SA 4N39A 3WXXA 2XGMA 2KZTB 2WXQA 5FZRA 2CHZA 3E4BA 3IEGA 4WNDA 4GZDA 1HFAA 2XGSA 3RIBA 5LCWJ 1PC2A 1H2UA 2C0MA 2LAHA 1EPUA 1W3BA 3LVQE 4XE0A 5AENA 5JHBA 4RZ0A 3PH0C 3B7RL 2J07A 3QJZA 4IJ8A 1ELWA 5FTPA 4NJ5A 2PQNA 2XCCA 3MKQA 4BWRA 4IYPA 4FADA 3U66A 2LO6A 3FUDA 3LPZA 2HR2A 3GZ2A 4UWFA 3VLFA 2IJGX 3OPEA 3ML9A 1DVPA 3SI5A 2I1KA 2JEKA 5T8IA 3AS5A 4N3CA 4GYOA 1UG3A 2WM9A 3DPDA 4E47A 5DBKA 3APFA 3QC1A 1H0AA 2GRLA 4J83A 5FT9A 3PE3A 5KJKA 4I2ZA 3FU5A 4EZLA 1TJCA 2J08A 3MGBA 3OOIA 2YHEA 4IN3B 1OWLA 3FU3A 3TGOA 3MZLB 2FULA 1H3IA 4F53A 1UN8A 2MOWA 4N2QA 3S7DA 4LCTA 3ZGQA 4A3TA 1XGWA 2LAIA 4B94A 3IHVA 2GRMA 3N71A 4GMJA 2A4ZA 4GYYA 4EECA 3UPVA 5G05J 1ELKA 2JV0A 3BO5A 4JPSA 4QFVA 3CHPA 3LVRE 2CG3A 3ULQA 5EG2A 5EX3A 3P2BA 4GZ6A 3ZW3A 3QNKA 1HX8A 4U0ZA 3AS4A 4TUUA 1ZBPA 2FF4A 3CKCA 3ESLA 2PM7A 3ZRHA 1HXIA 2P58C 3C98A 3LY7A 4MKTA 3PZDA 4MS6A 3FTWA 4UI9K 5EKQD 4B0ZA 4DI4A 4HXIA 3B7SA 3ZYMA 4CEMA 5JJTA 3JUIA 4AIFA 4J7IA 4A55A 3FUKA 3AS8A 3RQ4A 4OYSA 4FHJA 1IYGA 4JEUA 5JJ6A 4AJWA 5AYFA 1WY6A 3FFLA 2WXMA 4G24A 4JL0A 3D9MA 2XQ0A 3MJWA 3FPDA 4DLQA 4NURA 3U3WA 5T0KA 4LDGA 3DALA 3SF4A 4U04A 4CRWA 2VGYA 4ACLA 4JHRA 2NC9A 3L22A 1BPOA 4FHKA 3BEEA 2IGQA 5BV1A 2CHWA 2X6HA 3SBTB 3CIAA 4NVQA 3I5PA 2BUGA 4ANXA 2IOLA 2YHCA 5JHAA 3ONLA 4GAAA 2W5ZA 5HI7A 1JWGA 4I9CA 3QAQA 4I1OB 5G04C 3UT7A 3KEZA 1H19A 4MI0A 5KJNA 5CMYA 4E6HA 3FTXA 3U4TA 5F6KC 3CHOA 2Y3AA 3T5XA 3CSFA 4YPEA 2J49A 4YVQC 4G2VA 2KZTA 2R5SA 3CEQA 3LEWA 4Q69A 2BQZA 4JHJA 3FUIA 2HO1A 4C0MA 4YPAA 2PM6A 4G26A 2WXIA 3G2SA 1GW6A 3PRZA 4F1SA 3FDHA 4MRUA 1MHQA 3FEXA 2KCVA 3OXGA 1NA3A 2OVFA 4O30A 3FTUA 3CVNA 2L9BA 5ANRA 3EIQC 3SZ7A 2CFUA 4AM9A 2DIWA 3CSTA 3RRMB 3AU4A 1E8ZA 3D9KA 5ARGA 3CQCB 4NQ0A 1OWPA 3R9AB 4UWKA 1B89A 3NZUA 3LXUX 5LSXA 3OTNA 3CK8A 3CVWA 2PQRA 3FH8A 5T5GA 4F7AA 2WXGA 4I43A 4BTBA 2VSNA 4ANWA 1E96B 3OXFA 4NRHB 3TG4A 2NSZA 3M57A 3PNLB 4WWOA 1UJJA 1MVHA 3CHSA 3ASFA 5DIZA 4CDRA 3EP0A 3T8MA 1EF1C 5G04J 3M55A 2V4LA 4YVOA 3SNXA 4AV7A 3F9WA 4I9EA 3CR3A 4GZCA 4IJDA 1INZA 2AW6A 4RSYA 4RVBA 1Z6TA 3TAXA 3ZIMA 4HLEA 2RD0A 3K5KA 4N5CA 3QK0A 4Q94A 3ASHA 3ONKA 2I9CA 4UQYA 3U9WA 3L54A 4CGVA 4LEUA 4H12A 3RJWA 3MKRA 4GMLA 4OVVA 4G1TA 3G2WA 3RJVA 3TL5A 4EPZA 2BTDA 3URZA 3CV0A 3LY8A 2J4BA 4MI5A 3QARA 5FQ8A 2QPWA 1N52A 3SFZA 4FJZA 3IHXA 4U8HA 4AXHA 2AXVA 3KMJA 5FZSA 4HFGA 5EX0A 4B8AA 2WQ6A 2M63A 3KAEA 4BT8A 4LUNU 1XNFA 2XRZA 1U3DA 3MO2A 3FTVA 3B13A 4J8EA 2KC7A 1HZ4A 3GYZA 3LS8A 4KZCA 3VLDA 3CVYA 4RG6A 5JHNA 4URKA 2WMNA 3PEUB 5FQ7A 1SZAA 2X6IA 3ZFWA 3RRNB 4FP7A 1JUQA 2VSOE 2RFIA 4Y6CA 2HYZA 3HNAA 5AJDA 3EDTB 1VDYA 1HU3A 3D9PA 4A1SA 3D9NA 4JA9A 3MEKA 4OVUA 4XX5A 4JW1A 3S7JA 5EDSA 4UQZA 3FTSA 4O6FA 4GCOA 2J9QA 3Q49B 1P5QA 4WWNA 1HS6A 4XKCA 4BFRA 3FH7A 4FC8A 5TTFA 3M53A 1HO8A 4PS3A 5A23A 4N2SA 3G2TA 3JQ0A 3F9YA 4GZ5A 5AJLA 3LDZA 5HQ8A 3CVUA 3MA5A 3PVLA 4DK5A 2VGXB 3PE4A 3PREA 4N3BA 1ELRA 4J8SA 5LSZA 5J08A 1X5BA 1E90A 3UMVA 1FVFA 3CHQA 3CBOA 2VJ8A 3AU5A 2G46A 3JQ1A 3TJPA 1WAO1 5LP0A 1ZKKA 5TH7A 1HH8A 2OVBA 2YINA 3GZSA 3NQPA 4BT9A 3BG1B 3ML8A 3G2VA 3FUJA 3FP3A 3LCAA 4BY6A 1Z3YA 3CHRA 3LJ3A 3CQGB 4GA0A 4CT4A 3D9LA 4N3AA 2A5UA 2XEVA 5BPPA 4G23A 4JC8A 4ME2A 4A3VA 4AOFA 3CVXA 3HYMB 2W5YA 2UY1B 5A7DB 3SBSA 1WM5A 2UWJG 3NZSA 3ZYQA 4BX8A 5BT1A 4J8FA 3APCA 3FTZA 3G2UA 4GA2A 1EYHA 1Y6IA 3EIJA 3CKBA 2I1JA 5TEGA 3QKYA 2OOEA 3VTYA 1XQHA 1UW4B 1EDUA 2V5FA 3ZVVA 1PY1A 3B7UX 2HM8A 5KJLA 1KT0A 3FWVA 3Q15A 2XPIA 2KCLA 4JXTA 1UJKA 4LERA 3QOUA 4W9RA 5CHEE 3ZYLA 3M56A 3LY9A 5M72A 3VUZA 2WXHA 5BNWA 4APOA 4ANUA 4K03A 2DCPA 2LSUA 4TV3A 4DPRA 1N6AA 4APFA 2EQXA 1MVXA 3IKOB 3UUXA 3ZEFA 3L16A 2LSVA 3FUNA 1NP7A 5A6CA 3ZPJA 3M54A 4MLPA 2IOSA 3HHMA 1NA0A 2FEZA 2WXPA 4UWLA 3I4RB 4JVSA 4WWPA 4ATGA 2FI7A 3GW4A 5FQ4A 4GZ3A 5CPRB 1QZ2A 3IHYA 4A1GA 1E7VA 3DBSA 4UQXA 4J8OA 3K9IA 5T4YA 1OWMA 1IHGA 1KT1A 1HG2A 1TJFA 4I51A 2C2LA 4C0EA 1E8XA 2WB2A 3M5AA 2VTBB 2RG8A 5ARFA 1PEGA 1Y8MA 2I2OA 2WQHA 5KJMA 1L5JA 2QFCA 2E2EA 1DNPA 1OWNA 3P1UA 4HOTA 5JJ0A 5JIYA 1HE8A 1ZU2A 4XZ4A 2VSYA 3R7QA 4KT6B 3ZN3A 1SZ9A 3PNTB 3KMTA 4ILGA 4YNMA 4FJYA 2IU1A 1ML9A 4PS7A 3RRUA 3VLEA 4PH4B 2F69A 4DI3A 4AY5A 3L08A 4GPKA 4TRQA 5LOZA 2WQ7A 4I1MA 4FMUA 3F9XA 4R7LA 4U0UA 4IULA 2OV8A 4BSXA 3CK9A 4JA7A 4Q96A 2L0IA 2VGXA 2CHXA 2X6FA 2R3AA 2XCBA 2YNQA 5CMWA 1OWOA 5LFAA 4EBAG 4G25A 3PS6A 2ZU6B 5F59A 3U64A 1KLXA 4Z4PA 3Q5MA 2J4DA 3CHMA 4LRZA 1H2TC 3PDNA 1HF8A 3O4ZA 5BW8C 3UQ3A 3ZXSA 4HORA 3CK7A 3ZHEB 5F6LA 4BUPA 1IQRA 3JYSA 1MQSA 2QY7A 4J7FA 2CFZA 1SQMA 3SW9A 5G55A 2IF4A 4WNGA 5AIJA 4CDNA 4B8CB 4F3VA 1N6CA 2GW1A 4CDMA 1FVHA 2UY1A 2MHKA 3CVQA 1TEZA 4QEOA 4JZYA 3QWPA 4V3IA 3SD5A 3DB5A 5C2YA 5FQ6A 4U07A 4AVXA 4HOSA 2X38A 3O48A 2GGFA 3D9OA 4XI9A 1E8YA 2FBNA 1S0PA 2AVPA 2R17C 3KS2A 4J8DA 3L17A 3Q4AB 5C1DA 3HVEB 4FLHA 4HS2A 1QQEA 3TXNA 2ONDA 4L2YA 4NACA 4GYWA 2C0LA 2IONA 5FJYA 2LNIA 3QWVA 4PS8A 3S2AA 5LX8A 1IQUA 2IQCA 5ANLA 3CVPA 4JLGA 4YPUA 3ASDA 4KMOA 4AEZC 1N3JA 1LF8A 2WPVA 3SGHA 2VSXE 5JJ7A 4AU7A 2AXZA 4B89A 3PEVB 1H2VC 1PAQA 2VQ2A 3MYVA 4WAFA 5D0OD 4WNEA 4HOQA 3FTYA 1E7UA 2BF0X 2FO7A 2KATA 3RK6A 3RO2A 4WNFA 3I3NA 3M59A 4K0RA 4P29A 4U63A 4DJAA 3FH5A 2X6JA 3QB2A 1YA0A 3T5VA 3OXLA 2WXOA 2ILRA 3CLJA 3QDNA 4M3OA 4Y6WA 5BUZA 3LYAA 4FU3A 4DLOA 2E0IA 3CVLA 1MUFA 3MKQB 4JDSA 4J6IA 4L23A 3BG0B 4D10C 2WXLA 4I17A 5KCMA 3TXMA 1MT6A 2L6JA 1UN9A 4FA6A 4JEHA 4XI0A 5FZQA 3D9IA 4CT0A 4HVBA 2VTBA 4I6GA 5JINA 3CBMA 3FUMA 4J0UA 2WMOA 4BTAA 5AYWD 3ZYKA 4BX9A 3FUHA 3OAWA 4UI9C 2VYIA 3R7RA 4PUCA 3RO3A 2I6HA 2KCKA 1H6KA 4U0SA 2AWIA 2R59A 2V0PA 2X6KA 4XKBA 2Y4UA 3Q47B 5ENNA 3RAYA 3PUKA 4I6EA 2YQ8A 3EHMA 4EQFA 4KZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MO5 A;  3KMA A;  4WUY A;  3LKU A;  5CCL A;  3M58 A;  3MV2 B;  5T0M A;  2O8J A;  3CBP A;  4AY6 A;  2Y4T A;  3TG5 A;  2Q7F A;  5LCW C;  4GCN A;  1FCH A;  4H7X A;  3RU0 A;  5F5E A;  4YND A;  2DBA A;  4YNP A;  3VTX A;  3ZHE A;  3SWC A;  4QEN A;  4I2W A;  3ASG A;  5CCM A;  3QWW A;  3F9Z A;  2XGO A;  2PZI A;  4ABN A;  3MO0 A;  3RKV A;  4H7Y A;  3GZ1 A;  3KD7 A;  1NZN A;  2IFU A;  3S8P A;  4KXK B;  5D0Q D;  4RG9 A;  3ESK A;  4QEP A;  3VV0 A;  4GA1 A;  4CGW A;  3S7F A;  4UI9 J;  4I1A A;  1A17 A;  1OUV A;  3MV3 B;  2JLB A;  4KYO B;  4XIF A;  4KBQ A;  3S7B A;  3NF1 A;  3OS5 A;  2PL2 A;  5G05 C;  4C1Q A;  4HOU A;  1O9S A;  4N39 A;  3WXX A;  2XGM A;  5FZR A;  3E4B A;  3IEG A;  4WND A;  2XGS A;  5LCW J;  3RIB A;  1PC2 A;  2C0M A;  1W3B A;  4RZ0 A;  4IJ8 A;  1ELW A;  5FTP A;  4NJ5 A;  2PQN A;  2XCC A;  4BWR A;  3LPZ A;  2HR2 A;  3GZ2 A;  3OPE A;  3AS5 A;  4N3C A;  4GYO A;  4E47 A;  5DBK A;  4J83 A;  5FT9 A;  3PE3 A;  5KJK A;  4I2Z A;  1TJC A;  3OOI A;  4IN3 B;  3TGO A;  1H3I A;  4N2Q A;  3S7D A;  4B94 A;  3ZGQ A;  4GYY A;  3N71 A;  3UPV A;  5G05 J;  2JV0 A;  3BO5 A;  5EG2 A;  3ULQ A;  5EX3 A;  4GZ6 A;  4U0Z A;  3AS4 A;  1ZBP A;  2FF4 A;  3CKC A;  1HXI A;  2P58 C;  3LY7 A;  4UI9 K;  5EKQ D;  3K5K A;  5JJT A;  4AIF A;  4J7I A;  3AS8 A;  3RQ4 A;  1IYG A;  5JJ6 A;  5AYF A;  3FFL A;  4G24 A;  4JL0 A;  3FPD A;  3U3W A;  5T0K A;  4LDG A;  3DAL A;  3SF4 A;  4U04 A;  2VGY A;  4JHR A;  2NC9 A;  3BEE A;  2IGQ A;  4NVQ A;  2BUG A;  2YHC A;  2W5Z A;  5HI7 A;  4I9C A;  5G04 C;  4MI0 A;  5KJN A;  3U4T A;  5F6K C;  4YPE A;  4YVQ C;  4G2V A;  2R5S A;  3CEQ A;  2BQZ A;  2HO1 A;  4G26 A;  2KCV A;  3OXG A;  1NA3 A;  4O30 A;  3CVN A;  3SZ7 A;  4AM9 A;  5ARG A;  4NQ0 A;  3R9A B;  1B89 A;  5LSX A;  3CK8 A;  2PQR A;  5T5G A;  4BTB A;  2VSN A;  1E96 B;  3OXF A;  4NRH B;  3TG4 A;  3M57 A;  5DIZ A;  3ASF A;  3EP0 A;  4CDR A;  5G04 J;  3M55 A;  4YVO A;  3F9W A;  4I9E A;  4IJD A;  3TAX A;  4N5C A;  3ASH A;  4UQY A;  4CGV A;  4LEU A;  4H12 A;  3RJW A;  3MKR A;  4G1T A;  3RJV A;  3URZ A;  3CV0 A;  3LY8 A;  4MI5 A;  2QPW A;  3IHX A;  3KMJ A;  5FZS A;  5EX0 A;  3KAE A;  4BT8 A;  1XNF A;  3MO2 A;  4J8E A;  2KC7 A;  1HZ4 A;  3GYZ A;  5JHN A;  4RG6 A;  3ZFW A;  2RFI A;  4Y6C A;  2HYZ A;  3HNA A;  3EDT B;  4A1S A;  4JA9 A;  3MEK A;  3S7J A;  4UQZ A;  4O6F A;  4GCO A;  2J9Q A;  3Q49 B;  1P5Q A;  5TTF A;  3M53 A;  4N2S A;  3F9Y A;  4GZ5 A;  5HQ8 A;  3MA5 A;  2VGX B;  3PE4 A;  4N3B A;  1ELR A;  5LSZ A;  3CBO A;  2G46 A;  1WAO 1;  1ZKK A;  5TH7 A;  1HH8 A;  4BT9 A;  3FP3 A;  3LCA A;  4GA0 A;  4N3A A;  2XEV A;  4G23 A;  4ME2 A;  2W5Y A;  3HYM B;  2UY1 B;  5A7D B;  1WM5 A;  2UWJ G;  5BT1 A;  4J8F A;  4GA2 A;  3CKB A;  5TEG A;  3QKY A;  2OOE A;  3VTY A;  1XQH A;  2V5F A;  5KJL A;  1KT0 A;  3FWV A;  3Q15 A;  2XPI A;  2KCL A;  3QOU A;  4W9R A;  5CHE E;  3M56 A;  3LY9 A;  5M72 A;  3VUZ A;  5BNW A;  4APO A;  2LSU A;  1N6A A;  1MVX A;  3UUX A;  2LSV A;  5A6C A;  3ZPJ A;  3M54 A;  1NA0 A;  2FEZ A;  2FI7 A;  3GW4 A;  4GZ3 A;  5CPR B;  1QZ2 A;  4UQX A;  4J8O A;  3K9I A;  1IHG A;  1KT1 A;  4I51 A;  2C2L A;  3M5A A;  5ARF A;  1PEG A;  1Y8M A;  5KJM A;  2WQH A;  2QFC A;  2E2E A;  4HOT A;  5JJ0 A;  5JIY A;  1ZU2 A;  2VSY A;  3ZN3 A;  3KMT A;  4YNM A;  1ML9 A;  2F69 A;  4AY5 A;  4GPK A;  4FMU A;  3F9X A;  4U0U A;  3CK9 A;  4JA7 A;  2VGX A;  2R3A A;  2XCB A;  4G25 A;  5F59 A;  1KLX A;  4Z4P A;  3Q5M A;  3PDN A;  3UQ3 A;  5BW8 C;  5F6L A;  4HOR A;  3CK7 A;  3ZHE B;  4BUP A;  3JYS A;  4J7F A;  3SW9 A;  2IF4 A;  4WNG A;  4F3V A;  1N6C A;  2GW1 A;  3CVQ A;  2UY1 A;  2MHK A;  4QEO A;  3QWP A;  3DB5 A;  4U07 A;  4HOS A;  3O48 A;  4XI9 A;  2FBN A;  2AVP A;  3KS2 A;  4J8D A;  3Q4A B;  5C1D A;  1QQE A;  2OND A;  4GYW A;  2C0L A;  5FJY A;  2LNI A;  3QWV A;  4YPU A;  3CVP A;  4JLG A;  3ASD A;  1N3J A;  2WPV A;  5JJ7 A;  4AU7 A;  5D0O D;  2VQ2 A;  4WNE A;  4HOQ A;  2FO7 A;  2KAT A;  3RO2 A;  4WNF A;  3M59 A;  1YA0 A;  3OXL A;  3QDN A;  4Y6W A;  3LYA A;  3CVL A;  1MUF A;  4JDS A;  1MT6 A;  4I17 A;  2L6J A;  5JIN A;  5FZQ A;  4XI0 A;  3CBM A;  4J0U A;  4BTA A;  5AYW D;  1MVH A;  4UI9 C;  2VYI A;  3RO3 A;  2I6H A;  2KCK A;  4U0S A;  4YPA A;  3RAY A;  2Y4U A;  3Q47 B;  2YQ8 A;  4EQF A; 
#chains in the Genus database with same CATH topology
 4KVO A;  1O5M A;  2DZN A;  3FUF A;  2O8J A;  3CBP A;  1FCH A;  3FHE A;  5E76 A;  5G2N A;  3MCX A;  2XPY A;  4YNP A;  1JWF A;  4QEN A;  2J09 A;  3UT4 A;  4FUL A;  2RFA A;  4HBD A;  2PZI A;  3PUJ A;  3TWS A;  3MO0 A;  5FWQ A;  3FEY A;  3KD7 A;  2IFU A;  4UWH A;  5CBO A;  4GA1 A;  3ENE A;  2WXJ A;  2H6F A;  1A17 A;  3UM1 A;  3MV3 B;  5AQ7 A;  2R02 A;  3ASN E;  3FU6 A;  4LG6 A;  1BLX B;  3OS5 A;  1OCR E;  4JHK A;  4HNA D;  2WXF A;  3MX3 A;  2X3M A;  4N39 A;  5FZR A;  4GZD A;  1H2U A;  2C0M A;  3NBN B;  5AEN A;  2DWZ A;  4DX1 A;  3PH0 C;  3QJZ A;  2PQN A;  2XCC A;  4BWR A;  5HS0 A;  4UWF A;  3FUD A;  2HR2 A;  3VLF A;  3L9T A;  4GYO A;  4LNG A;  1UG3 A;  1TN7 A;  5DBK A;  3QC1 A;  3NB2 A;  3FU5 A;  2J08 A;  3OOI A;  4IN3 B;  3UIO C;  3FU3 A;  3MZL B;  1H3I A;  4F53 A;  2MOW A;  1D8D A;  4F1P A;  3IHV A;  2A4Z A;  3CHP A;  3DEO A;  1D8E A;  3ZW3 A;  4TUU A;  3AS4 A;  1UOH A;  2FF4 A;  3CKC A;  1HXI A;  4DI4 A;  1YMP A;  5JJT A;  4AIF A;  1SA5 A;  3RQ4 A;  5AYF A;  4JL0 A;  3FPD A;  1DCE A;  3U3W A;  3ISM C;  4LDG A;  2ETC A;  4ACL A;  3BEE A;  2X6H A;  4NVQ A;  2IOL A;  2YHC A;  3QAQ A;  1N94 A;  4O1O A;  5KJN A;  5HRY A;  2QC9 A;  3T5X A;  3CSF A;  2J49 A;  3IXE A;  2HO1 A;  1QBQ A;  3PRZ A;  3FDH A;  2KCV A;  2Y69 E;  3CVN A;  5ANR A;  3EIQ C;  4AM9 A;  3CST A;  3V2X A;  2KXP C;  3RAU A;  4F7A A;  4TXQ A;  1E96 B;  3OXF A;  1UJJ A;  5DIZ A;  3EP0 A;  1LTX A;  2V4L A;  4YVO A;  4AV7 A;  4I9E A;  3TWU A;  2AW6 A;  2RD0 A;  1N4Q A;  3U9W A;  3DST A;  4TXP A;  3EHQ A;  3MKR A;  4GML A;  3HRA A;  2BTD A;  3URZ A;  3IHX A;  4HFG A;  2M63 A;  4LUN U;  1U3D A;  3B13 A;  3VLD A;  1RW2 A;  2XEN A;  2X6I A;  3Q73 A;  4Y6C A;  3EDT B;  4XX5 A;  3BUA A;  3DPY A;  4GCO A;  1MX4 A;  2J9Q A;  1P5Q A;  5KNG A;  1HS6 A;  1DCQ A;  4PS3 A;  3G2T A;  2VGX B;  3PE4 A;  4GTM A;  2QYU A;  1E90 A;  3UMV A;  4U7E B;  4GTV A;  3CBO A;  2VJ8 A;  3AU5 A;  3TJP A;  1WAO 1;  5LP0 A;  1AP7 A;  3GZS A;  4J8Y A;  3ML8 A;  1JCQ A;  3FUJ A;  3CQG B;  4CT4 A;  1G3N B;  3C5R A;  4G23 A;  4JC8 A;  4A3V A;  4AOF A;  2W5Y A;  3HG0 D;  3SBS A;  1JCR A;  3G2U A;  3VTY A;  1BD8 A;  2V5F A;  3TWV A;  3ZVV A;  5KJL A;  2HM8 A;  3SQV A;  2XPI A;  1UJK A;  5M72 A;  3R9M A;  4APO A;  3UXG A;  2DCP A;  3E32 A;  3FUN A;  5A6C A;  2B0O E;  3ZPJ A;  4MLP A;  2WXP A;  3I4R B;  3UM2 A;  4JVS A;  2FI7 A;  5CPR B;  1QZ2 A;  5BXO A;  4HRN A;  3DSX A;  4UQX A;  1K8K G;  1KT1 A;  4I51 A;  1KZP A;  5ARF A;  5ENR D;  2E2E A;  3ABM E;  1OWN A;  1ZU2 A;  2IU1 A;  1ML9 A;  3RRU A;  4PH4 B;  1YYH A;  2WQ7 A;  4FMU A;  3F9X A;  4IUL A;  2OV8 A;  4Q96 A;  2L0I A;  2VGX A;  2CHX A;  2X6F A;  2XCB A;  1OWO A;  1OXJ A;  3PS6 A;  2ZU6 B;  5F59 A;  1KLX A;  3Q5M A;  3CHM A;  4LRZ A;  3PDN A;  5BW8 C;  3JYS A;  4YDE A;  4J7F A;  2IEJ A;  1SQM A;  2BKK B;  2IF4 A;  5AQA A;  1N6C A;  1TEZ A;  4QEO A;  4V3I A;  3SD5 A;  5C2Y A;  4U07 A;  2GGF A;  2AVP A;  4J8D A;  3SO8 A;  3TXN A;  1N4S A;  2H6H A;  4NAC A;  3S2A A;  5ANL A;  3ASD A;  4KMO A;  4AEZ C;  1LF8 A;  3SGH A;  2P2C P;  3DRA A;  3MYV A;  1ZB1 A;  2FO7 A;  3RO2 A;  3M59 A;  2F8Y A;  4P29 A;  4DJA A;  3FH5 A;  3SY2 A;  1YA0 A;  3T5V A;  2WXO A;  3QDN A;  5BUZ A;  3LYA A;  1BI8 B;  4FU3 A;  4DLO A;  4QQI A;  1MUF A;  4JDS A;  4DX6 D;  3C72 A;  2XS1 A;  4OAV B;  1UN9 A;  4FA6 A;  3TWX A;  4HVB A;  5JIN A;  4CT0 A;  3CBM A;  3UIN C;  1MVH A;  4UI9 C;  2VYI A;  3R7R A;  1H6K A;  2Y4U A;  1O1R A;  3Q47 B;  3SFX A;  1IHB A;  3L13 A;  5ENQ D;  1AWC B;  3CGH A;  4PDX A;  5CCL A;  3MV2 B;  5T0M A;  4BSZ B;  3HXF A;  2Q7F A;  3JCK C;  1E8W A;  3UX4 A;  4RLY A;  3TWT A;  1JPL A;  3HDX A;  4GCN A;  4G11 A;  4H7X A;  3RU0 A;  2CG2 A;  4NIK A;  3DSU A;  3SWC A;  5CCM A;  4FLB A;  2XGO A;  2NXP A;  4H7Y A;  5AQ9 A;  5J90 A;  1X81 A;  3S8P A;  4KXK B;  5D0Q D;  4C9B B;  3ESK A;  3CVV A;  5ENO D;  3S7F A;  3SHF A;  4UI9 J;  4I1A A;  1OUV A;  5KNH D;  2OEV A;  1OCZ E;  3B7T A;  3KSL A;  3S7B A;  5CEC B;  1U3C A;  3D9J A;  5HKP A;  3HIZ A;  5EN5 D;  4ANV A;  2WVI A;  4DX7 D;  2KZT B;  2WXQ A;  2CHZ A;  3E4B A;  3IEG A;  1HFA A;  1EPU A;  2J07 A;  4IJ8 A;  2J8S D;  1V55 E;  2XEH A;  5FTP A;  4NJ5 A;  3U66 A;  2LO6 A;  2HE0 A;  1DVP A;  5T8I A;  5JA4 D;  3ZXP A;  4J83 A;  5FT9 A;  3PE3 A;  5KJK A;  1QYM A;  5EIL A;  4I2Z A;  3MGB A;  2YHE A;  3TGO A;  2FUL A;  4A3T A;  1XGW A;  2JV0 A;  3LVR E;  5EG2 A;  5EX3 A;  4GZ6 A;  3QNK A;  1ZBP A;  2PM7 A;  4F6R D;  2H6G A;  2P58 C;  4GTO A;  3LY7 A;  4MKT A;  4MS6 A;  3K5K A;  3FTW A;  2GRQ B;  2P9K G;  3ZU7 B;  4CEM A;  3FUK A;  5CEA A;  4OYS A;  5D2M C;  4JEU A;  4C48 B;  1WY6 A;  4G24 A;  3MJW A;  4DLQ A;  4NUR A;  3DAL A;  3SF4 A;  4JD2 G;  1BPO A;  3BQO A;  2CHW A;  3EHR A;  5JMN D;  3I5P A;  5JHA A;  3ONL A;  3KEA A;  2W5Z A;  3J5P A;  3UT7 A;  1JWG A;  5G04 C;  3FTX A;  5F6K C;  1N9A A;  4YVQ C;  2KZT A;  3LEW A;  3L82 A;  3UKU G;  4C0M A;  3G2S A;  3DEP A;  4MRU A;  3HXC A;  3FEX A;  3OXG A;  4O30 A;  3PZ1 A;  2L9B A;  3RRM B;  4GTS A;  1E8Z A;  3D9K A;  1MX2 A;  5ARG A;  1B89 A;  3CK8 A;  2PQR A;  2XEE A;  4BTB A;  1H6O A;  5CRU A;  2ZGG A;  3SFY A;  4NRH B;  3V79 K;  1SVX A;  3CHS A;  4K5C A;  1EF1 C;  5G04 J;  3F9W A;  3SNX A;  3Q75 A;  1INZ A;  4RSY A;  4RVB A;  3QK0 A;  4Q94 A;  2I9C A;  3L54 A;  3RJW A;  4OVV A;  4G1T A;  3RJV A;  3CV0 A;  2J4B A;  3QAR A;  2QPW A;  4FJZ A;  2MYO A;  4B8A A;  2LXM A;  3KAE A;  1K1A A;  1XNF A;  1FT1 A;  2KC7 A;  3GYZ A;  5JHN A;  3CVY A;  2RKK A;  3ZFW A;  4FP7 A;  2RFI A;  2HYZ A;  3HNA A;  2IO3 C;  1HU3 A;  4O6F A;  3C3R A;  2OCC E;  4BFR A;  4FC8 A;  2ZGD A;  4GZ5 A;  3LDZ A;  3CVU A;  4DK5 A;  3PRE A;  4J8S A;  1H6P A;  1Q2Z A;  1FVF A;  4HRM B;  2G46 A;  4LNB A;  3UI2 A;  1ZKK A;  2YIN A;  3BG1 B;  3LCA A;  4BY6 A;  4N3A A;  2A5U A;  5ENP D;  1TN8 A;  4ME2 A;  3CVX A;  2FO1 E;  2UWJ G;  4BX8 A;  4J8F A;  5ENT D;  3EU5 A;  4L9P A;  5TEG A;  2BED A;  1PY1 A;  3B7U X;  1KT0 A;  2R05 A;  3QOU A;  3VUZ A;  2P9U G;  3T9K A;  4K03 A;  2LSU A;  3ZEF A;  3BU8 A;  2V4H C;  5H7P A;  2IOS A;  1NA0 A;  4UWL A;  4ATG A;  4GZ3 A;  2ETA A;  3IHY A;  4A1G A;  3DBS A;  4J8O A;  5KBA A;  5T4Y A;  1IHG A;  1TJF A;  3UM3 A;  2WB2 A;  1PEG A;  2I2O A;  2WQH A;  1S70 B;  3P1U A;  5JIY A;  3KSQ A;  1SZ9 A;  3KMT A;  4ILG A;  2F69 A;  4AY5 A;  3AG3 E;  3TWR A;  4R7L A;  2V5Q C;  4JA7 A;  4MBG A;  3JXI A;  4G25 A;  1SW6 A;  1MX6 A;  4EHM A;  5F6L A;  3CK7 A;  3ZHE B;  1MQS A;  3AG4 E;  2QY7 A;  4B8C B;  4F3V A;  4CDM A;  1OCO E;  3CVQ A;  2MHK A;  4JZY A;  4HOS A;  4RQI A;  3D9O A;  5D66 A;  2L6B A;  2EIM E;  3Q4A B;  5C1D A;  3HVE B;  4HS2 A;  2OND A;  2AJA A;  4GYW A;  2C0L A;  5FJY A;  4YPU A;  4JLG A;  2VSX E;  4O60 A;  5CBN A;  3DXM G;  4AU7 A;  4B89 A;  4WAF A;  4WNE A;  4M7C A;  3DWL G;  1OT8 A;  3OXL A;  4M3O A;  4Y6W A;  4J6I A;  1MT6 A;  2WXL A;  4I17 A;  2L6J A;  3FUM A;  4J0U A;  2WMO A;  4BTA A;  4BX9 A;  1TNY A;  4CZ2 D;  3OAW A;  2KCK A;  4YPA A;  4XKB A;  2R59 A;  2V0P A;  3RAY A;  2YQ8 A;  5EID A;  3EHM A;  4KZ0 A;  4EZK A;  2WXR A;  3KMA A;  4UWG A;  3LKU A;  3M58 A;  4KVM A;  3W9F A;  3DSW A;  4L7T A;  1FT2 A;  4I6J A;  4EBA A;  4GPM A;  5BV0 A;  3ZHE A;  4CYM D;  4I2W A;  3ASG A;  2RFM A;  3QWW A;  4L2L A;  4AP2 A;  5AAO A;  2MRI A;  4ATZ D;  3EHN A;  3AG2 E;  3EJN A;  3D3M A;  1TN6 A;  1HG5 A;  1BU9 A;  2WXK A;  2V8S E;  3HVE A;  2JLB A;  4KYO B;  2DYS E;  1IKN D;  3IBE A;  3FU0 A;  4ILI A;  5E75 A;  4CCA A;  1Z3X A;  4ILH B;  4KBQ A;  4L1B A;  3NF1 A;  3UT8 A;  3T8K A;  2XRY A;  5G05 C;  5CED B;  4C1Q A;  1O9S A;  3WXX A;  2XGM A;  2XGS A;  3RIB A;  3TWQ A;  2P9L G;  3JUE A;  3LVQ E;  4OAU C;  4RZ0 A;  3B7R L;  4DRX E;  1MYO A;  4FAD A;  3LPZ A;  2IJG X;  4ZHB A;  3OPE A;  2JEK A;  2WM9 A;  3APF A;  2NYJ A;  1H0A A;  2GRL A;  4EZL A;  1OWL A;  4N2Q A;  3ZNG A;  1S63 A;  3S7D A;  3ZGQ A;  4GYY A;  5G05 J;  4JPS A;  4QFV A;  2CG3 A;  4HLL A;  4U0Z A;  1HX8 A;  3ESL A;  2A5E A;  4UI9 K;  3PZD A;  3B7S A;  2B6C A;  4J7W A;  4J7I A;  3Q78 A;  4A55 A;  1IYG A;  4AJW A;  3D9M A;  2VGY A;  2NC9 A;  2IGQ A;  3CIA A;  4ANX A;  4GAA A;  3DSV A;  5CMY A;  4E6H A;  3U4T A;  2JAB A;  3W9G A;  3V2O A;  4G2V A;  4U95 D;  2R5S A;  4G8L A;  3CEQ A;  5BXU A;  4G26 A;  1NA3 A;  2OVF A;  3FTU A;  3SZ7 A;  3HXE A;  2DIW A;  1KZO A;  1YCS B;  3CQC B;  1OWP A;  4UWK A;  3JXJ A;  4HQD A;  5LSX A;  3OTN A;  4GTP A;  5T5G A;  2WXG A;  4ANW A;  3TG4 A;  4N5Q A;  2NSZ A;  2LUH A;  3PNL B;  3EU9 A;  3ASF A;  4CDR A;  1JCS A;  3T8M A;  3M55 A;  4B93 B;  3CR3 A;  4GZC A;  3TAX A;  3ZIM A;  1TYQ G;  2VGE A;  4UQY A;  4LEU A;  3TL5 A;  4EPZ A;  3LY8 A;  4MI5 A;  5FQ8 A;  3SFZ A;  4AXH A;  3KMJ A;  2AXV A;  5FZS A;  1RZ4 A;  1BI7 B;  4BT8 A;  2XRZ A;  3MO2 A;  4J8E A;  4O1P A;  1HZ4 A;  4RG6 A;  4URK A;  3PZ4 A;  5EYP F;  2F0Y A;  5FQ7 A;  4U8Y D;  3EUV A;  3RRN B;  1NFI E;  2R03 A;  5AJD A;  1VDY A;  3D9P A;  4JA9 A;  3MEK A;  4OVU A;  4JW1 A;  3S7J A;  4Z68 A;  1N0R A;  4WWN A;  2QZA A;  1FPP A;  3PZ3 A;  5HQ8 A;  3MA5 A;  3PVL A;  4N3B A;  1ELR A;  5LSZ A;  2XS8 A;  3JQ1 A;  4YDO A;  5TH7 A;  1HH8 A;  1LD8 A;  4BT9 A;  3ZKJ A;  4K5B A;  4K5A B;  1Z3Y A;  4A63 B;  3D9L A;  5BPP A;  3HYM B;  5A7D B;  3PZ2 A;  1WM5 A;  5KWD A;  3NZS A;  3C3O A;  3ZYQ A;  3APC A;  1EYH A;  3EIJ A;  4ZFH A;  3QKY A;  1UW4 B;  2GRO B;  4JXT A;  4W9R A;  3ZYL A;  3M56 A;  3LY9 A;  2WXH A;  5EYL A;  3UKR G;  5BNW A;  4ANU A;  4TV3 A;  2EQX A;  1MVX A;  1TNB A;  2LSV A;  1NP7 A;  3M54 A;  3HHM A;  2FEZ A;  4X8Q A;  4WWP A;  3GW4 A;  5FQ4 A;  2XZD G;  1V54 E;  1OWM A;  2C2L A;  3M5A A;  3B95 A;  2RG8 A;  5KJM A;  1L5J A;  1HE8 A;  2GRR B;  3DXK G;  2VSY A;  3PNT B;  4FJY A;  5FIO A;  4DI3 A;  3L08 A;  5B3S E;  4GPK A;  4TRQ A;  3J5Q B;  4U0U A;  4BSX A;  2R3A A;  2YNQ A;  5LFA A;  4EBA G;  1DC2 A;  4JB8 P;  1H2T C;  3E33 A;  1HF8 A;  4HOR A;  4BUP A;  3E34 A;  3SW9 A;  2ZIS A;  4WNG A;  5AIJ A;  2GW1 A;  1N11 A;  2F8X K;  4HB5 A;  3DB5 A;  5ITZ F;  4AVX A;  2X38 A;  1S0P A;  2R17 C;  3KS2 A;  3L17 A;  3TWW A;  5LX8 A;  3QWV A;  4PS8 A;  1IQU A;  3CVP A;  2WPV A;  1NI1 A;  2AXZ A;  3PEV B;  1PAQ A;  5D0O D;  3FTY A;  1E7U A;  2P9I G;  2BF0 X;  2KAT A;  4WNF A;  4K0R A;  4U63 A;  4BEP A;  4HI9 A;  2X6J A;  4DX5 D;  2E0I A;  5AN8 A;  3CVL A;  3MKQ B;  4L23 A;  4XEI G;  3BG0 B;  5KCM A;  5AQB A;  4JEH A;  4I6G A;  2KBX A;  4PUC A;  1S64 A;  2AWI A;  5IY5 E;  3PUK A;  4HI8 A;  2XHE A;  3MO5 A;  5T3R A;  4WUY A;  3V30 A;  1QNF A;  1IXV A;  4GU5 A;  4EZJ A;  4IRU A;  4AY6 A;  2AXU A;  2Y4T A;  3TG5 A;  4ACK A;  5LCW C;  4GTQ A;  5F5E A;  3FUE A;  4YDW A;  4YND A;  2DBA A;  4E85 A;  3VTX A;  2XPZ A;  3F9Z A;  3FUL A;  4ABN A;  4YDY A;  3FY4 A;  4U96 D;  3RKV A;  3GZ1 A;  1N54 A;  2WXN A;  2OEW A;  1NZN A;  3APD A;  4RG9 A;  4QEP A;  2IO2 C;  3VV0 A;  4CGW A;  3UIP C;  3L6A A;  1WG0 A;  3HXD A;  4XIF A;  3UM0 A;  2KM4 A;  2P9N G;  3ZUV B;  3Q79 A;  3IV0 A;  2L0T B;  4GB9 A;  2PL2 A;  2GRN B;  3I4G A;  4HOU A;  2PNN A;  4WND A;  5LCW J;  1PC2 A;  2LAH A;  1W3B A;  4XE0 A;  5JHB A;  5ENS D;  2Y1L E;  3D9H A;  1N95 A;  1N0Q A;  3F6Q A;  1ELW A;  3MKQ A;  4IYP A;  2DZO A;  3DSS A;  3GZ2 A;  3ML9 A;  3SI5 A;  2I1K A;  3AS5 A;  4N3C A;  4GTR A;  3DPD A;  4E47 A;  2ZIR A;  2H6I A;  2GRP B;  1TJC A;  3RSE G;  3X2Q E;  1UN8 A;  2EIN E;  4U8V D;  4LCT A;  4B94 A;  2LAI A;  4TXR A;  2GRM A;  3N71 A;  4GMJ A;  4EEC A;  3UPV A;  1ELK A;  3BO5 A;  3ULQ A;  3P2B A;  3B7B A;  3ZRH A;  3C98 A;  4B0Z A;  5EKQ D;  4HXI A;  3ZYM A;  4LNU D;  3JUI A;  3AS8 A;  1K1B A;  4FHJ A;  5JJ6 A;  3FFL A;  2WXM A;  1Z5S C;  2XQ0 A;  5T0K A;  1TNZ A;  4U04 A;  4CRW A;  4JHR A;  3L22 A;  4FHK A;  2ZXW E;  5BV1 A;  3SBT B;  3WG7 E;  2BUG A;  5HI7 A;  4I9C A;  1OCC E;  4I1O B;  3KEZ A;  1H19 A;  4MI0 A;  5B1B E;  3CHO A;  2ETB A;  2Y3A A;  3AAA C;  4YPE A;  4LSZ E;  2BQZ A;  1O1T A;  4JHJ A;  3FUI A;  1D9S A;  2PM6 A;  2WXI A;  1GW6 A;  4F1S A;  1MHQ A;  2CFU A;  3V31 A;  3AU4 A;  4NQ0 A;  3R9A B;  4GTT A;  4BES A;  3NZU A;  3LXU X;  3NOG D;  3CVW A;  3FH8 A;  4I43 A;  2VSN A;  3M57 A;  4WWO A;  2EIJ E;  5EIB E;  4IJD A;  1Z6T A;  4HLE A;  4N5C A;  3ASH A;  3ONK A;  4CGV A;  4H12 A;  3G2W A;  3AJI A;  1N52 A;  4U8H A;  1A5E A;  5EX0 A;  3ABL E;  4UUC A;  2WQ6 A;  3FTV A;  3LS8 A;  4KZC A;  1O1S A;  2WMN A;  3PEU B;  1SZA A;  3Q9N C;  1JUQ A;  2VSO E;  4G8K A;  2BKG A;  1TNU A;  4A1S A;  3D9N A;  5EDS A;  3NAW A;  4UQZ A;  2P9P G;  3FTS A;  3ABK E;  3Q49 B;  4XKC A;  4BER A;  1TNO A;  3FH7 A;  5TTF A;  3M53 A;  1HO8 A;  5A23 A;  4N2S A;  3JQ0 A;  3F9Y A;  5AJL A;  3ULE G;  5J08 A;  1X5B A;  2QYJ A;  4HRL A;  3CHQ A;  2OVB A;  3NQP A;  4DX2 A;  3G2V A;  3FP3 A;  3CHR A;  3LJ3 A;  4GA0 A;  2XEV A;  2DVW A;  3ULY A;  3C3Q A;  2UY1 B;  4BET A;  5BT1 A;  3FTZ A;  4GA2 A;  1Y6I A;  3CKB A;  2I1J A;  2OOE A;  1XQH A;  1EDU A;  1WDY A;  5FIN A;  3FWV A;  3Q15 A;  3Q7F A;  2KCL A;  4LER A;  5CHE E;  1OY3 D;  1LD7 A;  4DPR A;  1N6A A;  4APF A;  3IKO B;  3UUX A;  3L16 A;  5B1A E;  2EIL E;  2Y0B G;  3E37 A;  2EIK E;  1E7V A;  2P9S G;  3K9I A;  1HG2 A;  3UTM A;  4C0E A;  1E8X A;  2VTB B;  3NOC D;  1Y8M A;  2QFC A;  1DNP A;  4HOT A;  5JJ0 A;  4XZ4 A;  1K3Z D;  3R7Q A;  4KT6 B;  3ZN3 A;  3ASO E;  4YNM A;  4PS7 A;  3VLE A;  5LOZ A;  3HXB A;  4I1M A;  1MJ0 A;  2DYR E;  3CK9 A;  5CMW A;  1KPS B;  3U64 A;  4Z4P A;  2J4D A;  3UQ3 A;  3O4Z A;  3ZXS A;  1IQR A;  2LXL A;  2CFZ A;  5G55 A;  4CDN A;  1FVH A;  2UY1 A;  1U2V G;  1SA4 A;  3QWP A;  4DUI A;  1N4R A;  5FQ6 A;  3O48 A;  4XI9 A;  1E8Y A;  2FBN A;  1N4P A;  5CRV A;  4FLH A;  1QQE A;  4L2Y A;  1TR4 A;  2ION A;  2LNI A;  2IQC A;  1N3J A;  5JJ7 A;  3AG1 E;  1H2V C;  2VQ2 A;  4HOQ A;  3Q7A A;  3RK6 A;  3I3N A;  3QB2 A;  1MZC A;  2ILR A;  3CLJ A;  2IY0 C;  4GMR A;  4D10 C;  3TXM A;  2F37 A;  1NL4 A;  2VTB A;  5FZQ A;  4XI0 A;  3D9I A;  3E30 A;  4TUM A;  5AYW D;  3ZYK A;  3FUH A;  3RO3 A;  2I6H A;  4U0S A;  2X6K A;  5ENN A;  2XZT G;  3LJN A;  3Q9U C;  4I6E A;  5CER B;  5AAR A;  4Q69 A;  4EQF A;  2R2L A; 
#chains in the Genus database with same CATH homology
 3L13 A;  4KVO A;  2XHE A;  4EZK A;  3MO5 A;  2WXR A;  3CGH A;  3KMA A;  4PDX A;  5T3R A;  4UWG A;  3FUF A;  3LKU A;  4WUY A;  5CCL A;  1QNF A;  3MV2 B;  3M58 A;  2O8J A;  4GU5 A;  5T0M A;  3CBP A;  4EZJ A;  4IRU A;  4AY6 A;  2AXU A;  2Y4T A;  4KVM A;  2Q7F A;  3TG5 A;  3JCK C;  1E8W A;  3UX4 A;  4ACK A;  5LCW C;  1JPL A;  3HDX A;  4GCN A;  1FCH A;  3FHE A;  4G11 A;  4H7X A;  4I6J A;  2CG2 A;  4L7T A;  3RU0 A;  3FUE A;  4EBA A;  5F5E A;  5E76 A;  4YND A;  5G2N A;  2DBA A;  4E85 A;  3MCX A;  5BV0 A;  2XPY A;  4YNP A;  1JWF A;  3VTX A;  3ZHE A;  2XPZ A;  3SWC A;  4QEN A;  4I2W A;  3ASG A;  5CCM A;  4FLB A;  2J09 A;  3UT4 A;  3QWW A;  4L2L A;  4FUL A;  4AP2 A;  3F9Z A;  2XGO A;  2MRI A;  3FUL A;  2PZI A;  3PUJ A;  4ABN A;  2NXP A;  3FY4 A;  3MO0 A;  3RKV A;  4H7Y A;  3GZ1 A;  3EHN A;  5FWQ A;  5J90 A;  3FEY A;  1N54 A;  2WXN A;  3D3M A;  1NZN A;  2IFU A;  3EJN A;  3KD7 A;  3S8P A;  4KXK B;  3APD A;  4UWH A;  5D0Q D;  4RG9 A;  4C9B B;  3ESK A;  4QEP A;  3CVV A;  3VV0 A;  1HG5 A;  4GA1 A;  2WXK A;  4CGW A;  3ENE A;  2V8S E;  2WXJ A;  3S7F A;  4UI9 J;  3HVE A;  4I1A A;  1A17 A;  1OUV A;  3MV3 B;  3SHF A;  2JLB A;  4KYO B;  3L6A A;  3IBE A;  3FU6 A;  3FU0 A;  4XIF A;  3B7T A;  4ILI A;  5E75 A;  4CCA A;  1Z3X A;  4ILH B;  4KBQ A;  4L1B A;  3NF1 A;  2KM4 A;  1U3C A;  3D9J A;  4JHK A;  3S7B A;  3UT8 A;  3OS5 A;  2WXF A;  3IV0 A;  2L0T B;  4GB9 A;  2XRY A;  2PL2 A;  3HIZ A;  5G05 C;  4ANV A;  4C1Q A;  3MX3 A;  2WVI A;  2X3M A;  3I4G A;  4HOU A;  1O9S A;  4N39 A;  3WXX A;  2XGM A;  2KZT B;  2WXQ A;  5FZR A;  2CHZ A;  3E4B A;  3IEG A;  4WND A;  4GZD A;  1HFA A;  2XGS A;  3RIB A;  5LCW J;  1PC2 A;  1H2U A;  2C0M A;  2LAH A;  1EPU A;  1W3B A;  3LVQ E;  4XE0 A;  5AEN A;  5JHB A;  4RZ0 A;  3PH0 C;  3B7R L;  2J07 A;  3QJZ A;  4IJ8 A;  1ELW A;  5FTP A;  4NJ5 A;  2PQN A;  2XCC A;  3MKQ A;  4BWR A;  4IYP A;  4FAD A;  3U66 A;  2LO6 A;  3FUD A;  3LPZ A;  2HR2 A;  3GZ2 A;  4UWF A;  3VLF A;  2IJG X;  3OPE A;  3ML9 A;  1DVP A;  3SI5 A;  2I1K A;  2JEK A;  5T8I A;  3AS5 A;  4N3C A;  4GYO A;  1UG3 A;  2WM9 A;  3DPD A;  4E47 A;  5DBK A;  3APF A;  3QC1 A;  1H0A A;  2GRL A;  4J83 A;  5FT9 A;  3PE3 A;  5KJK A;  4I2Z A;  3FU5 A;  4EZL A;  1TJC A;  2J08 A;  3MGB A;  3OOI A;  2YHE A;  4IN3 B;  1OWL A;  3FU3 A;  3TGO A;  3MZL B;  2FUL A;  1H3I A;  4F53 A;  1UN8 A;  2MOW A;  4N2Q A;  3S7D A;  4LCT A;  3ZGQ A;  4A3T A;  1XGW A;  2LAI A;  4B94 A;  3IHV A;  2GRM A;  3N71 A;  4GMJ A;  2A4Z A;  4GYY A;  4EEC A;  3UPV A;  5G05 J;  1ELK A;  2JV0 A;  3BO5 A;  4JPS A;  4QFV A;  3CHP A;  3LVR E;  2CG3 A;  3ULQ A;  5EG2 A;  5EX3 A;  3P2B A;  4GZ6 A;  3ZW3 A;  3QNK A;  1HX8 A;  4U0Z A;  3AS4 A;  4TUU A;  1ZBP A;  2FF4 A;  3CKC A;  3ESL A;  2PM7 A;  3ZRH A;  1HXI A;  2P58 C;  3C98 A;  3LY7 A;  4MKT A;  3PZD A;  4MS6 A;  3FTW A;  4UI9 K;  5EKQ D;  4B0Z A;  4DI4 A;  4HXI A;  3B7S A;  3ZYM A;  4CEM A;  5JJT A;  3JUI A;  4AIF A;  4J7I A;  4A55 A;  3FUK A;  3AS8 A;  3RQ4 A;  4OYS A;  4FHJ A;  1IYG A;  4JEU A;  5JJ6 A;  4AJW A;  5AYF A;  1WY6 A;  3FFL A;  2WXM A;  4G24 A;  4JL0 A;  3D9M A;  2XQ0 A;  3MJW A;  3FPD A;  4DLQ A;  4NUR A;  3U3W A;  5T0K A;  4LDG A;  3DAL A;  3SF4 A;  4U04 A;  4CRW A;  2VGY A;  4ACL A;  4JHR A;  2NC9 A;  3L22 A;  1BPO A;  4FHK A;  3BEE A;  2IGQ A;  5BV1 A;  2CHW A;  2X6H A;  3SBT B;  3CIA A;  4NVQ A;  3I5P A;  2BUG A;  4ANX A;  2IOL A;  2YHC A;  5JHA A;  3ONL A;  4GAA A;  2W5Z A;  5HI7 A;  1JWG A;  4I9C A;  3QAQ A;  4I1O B;  5G04 C;  3UT7 A;  3KEZ A;  1H19 A;  4MI0 A;  5KJN A;  5CMY A;  4E6H A;  3FTX A;  3U4T A;  5F6K C;  3CHO A;  2Y3A A;  3T5X A;  3CSF A;  4YPE A;  2J49 A;  4YVQ C;  4G2V A;  2KZT A;  2R5S A;  3CEQ A;  3LEW A;  4Q69 A;  2BQZ A;  4JHJ A;  3FUI A;  2HO1 A;  4C0M A;  4YPA A;  2PM6 A;  4G26 A;  2WXI A;  3G2S A;  1GW6 A;  3PRZ A;  4F1S A;  3FDH A;  4MRU A;  1MHQ A;  3FEX A;  2KCV A;  3OXG A;  1NA3 A;  2OVF A;  4O30 A;  3FTU A;  3CVN A;  2L9B A;  5ANR A;  3EIQ C;  3SZ7 A;  2CFU A;  4AM9 A;  2DIW A;  3CST A;  3RRM B;  3AU4 A;  1E8Z A;  3D9K A;  5ARG A;  3CQC B;  4NQ0 A;  1OWP A;  3R9A B;  4UWK A;  1B89 A;  3NZU A;  3LXU X;  5LSX A;  3OTN A;  3CK8 A;  3CVW A;  2PQR A;  3FH8 A;  5T5G A;  4F7A A;  2WXG A;  4I43 A;  4BTB A;  2VSN A;  4ANW A;  1E96 B;  3OXF A;  4NRH B;  3TG4 A;  2NSZ A;  3M57 A;  3PNL B;  4WWO A;  1UJJ A;  1MVH A;  3CHS A;  3ASF A;  5DIZ A;  4CDR A;  3EP0 A;  3T8M A;  1EF1 C;  5G04 J;  3M55 A;  2V4L A;  4YVO A;  3SNX A;  4AV7 A;  3F9W A;  4I9E A;  3CR3 A;  4GZC A;  4IJD A;  1INZ A;  2AW6 A;  4RSY A;  4RVB A;  1Z6T A;  3TAX A;  3ZIM A;  4HLE A;  2RD0 A;  3K5K A;  4N5C A;  3QK0 A;  4Q94 A;  3ASH A;  3ONK A;  2I9C A;  4UQY A;  3U9W A;  3L54 A;  4CGV A;  4LEU A;  4H12 A;  3RJW A;  3MKR A;  4GML A;  4OVV A;  4G1T A;  3G2W A;  3RJV A;  3TL5 A;  4EPZ A;  2BTD A;  3URZ A;  3CV0 A;  3LY8 A;  2J4B A;  4MI5 A;  3QAR A;  5FQ8 A;  2QPW A;  1N52 A;  3SFZ A;  4FJZ A;  3IHX A;  4U8H A;  4AXH A;  2AXV A;  3KMJ A;  5FZS A;  4HFG A;  5EX0 A;  4B8A A;  2WQ6 A;  2M63 A;  3KAE A;  4BT8 A;  4LUN U;  1XNF A;  2XRZ A;  1U3D A;  3MO2 A;  3FTV A;  3B13 A;  4J8E A;  2KC7 A;  1HZ4 A;  3GYZ A;  3LS8 A;  4KZC A;  3VLD A;  3CVY A;  4RG6 A;  5JHN A;  4URK A;  2WMN A;  3PEU B;  5FQ7 A;  1SZA A;  2X6I A;  3ZFW A;  3RRN B;  4FP7 A;  1JUQ A;  2VSO E;  2RFI A;  4Y6C A;  2HYZ A;  3HNA A;  5AJD A;  3EDT B;  1VDY A;  1HU3 A;  3D9P A;  4A1S A;  3D9N A;  4JA9 A;  3MEK A;  4OVU A;  4XX5 A;  4JW1 A;  3S7J A;  5EDS A;  4UQZ A;  3FTS A;  4O6F A;  4GCO A;  2J9Q A;  3Q49 B;  1P5Q A;  4WWN A;  1HS6 A;  4XKC A;  4BFR A;  3FH7 A;  4FC8 A;  5TTF A;  3M53 A;  1HO8 A;  4PS3 A;  5A23 A;  4N2S A;  3G2T A;  3JQ0 A;  3F9Y A;  4GZ5 A;  5AJL A;  3LDZ A;  5HQ8 A;  3CVU A;  3MA5 A;  3PVL A;  4DK5 A;  2VGX B;  3PE4 A;  3PRE A;  4N3B A;  1ELR A;  4J8S A;  5LSZ A;  5J08 A;  1X5B A;  1E90 A;  3UMV A;  1FVF A;  3CHQ A;  3CBO A;  2VJ8 A;  3AU5 A;  2G46 A;  3JQ1 A;  3TJP A;  1WAO 1;  5LP0 A;  1ZKK A;  5TH7 A;  1HH8 A;  2OVB A;  2YIN A;  3GZS A;  3NQP A;  4BT9 A;  3BG1 B;  3ML8 A;  3G2V A;  3FUJ A;  3FP3 A;  3LCA A;  4BY6 A;  1Z3Y A;  3CHR A;  3LJ3 A;  3CQG B;  4GA0 A;  4CT4 A;  3D9L A;  4N3A A;  2A5U A;  2XEV A;  5BPP A;  4G23 A;  4JC8 A;  4ME2 A;  4A3V A;  4AOF A;  3CVX A;  3HYM B;  2W5Y A;  2UY1 B;  5A7D B;  3SBS A;  1WM5 A;  2UWJ G;  3NZS A;  3ZYQ A;  4BX8 A;  5BT1 A;  4J8F A;  3APC A;  3FTZ A;  3G2U A;  4GA2 A;  1EYH A;  1Y6I A;  3EIJ A;  3CKB A;  2I1J A;  5TEG A;  3QKY A;  2OOE A;  3VTY A;  1XQH A;  1UW4 B;  1EDU A;  2V5F A;  3ZVV A;  1PY1 A;  3B7U X;  2HM8 A;  5KJL A;  1KT0 A;  3FWV A;  3Q15 A;  2XPI A;  2KCL A;  4JXT A;  1UJK A;  4LER A;  3QOU A;  4W9R A;  5CHE E;  3ZYL A;  3M56 A;  3LY9 A;  5M72 A;  3VUZ A;  2WXH A;  5BNW A;  4APO A;  4ANU A;  4K03 A;  2DCP A;  2LSU A;  4TV3 A;  4DPR A;  1N6A A;  4APF A;  2EQX A;  1MVX A;  3IKO B;  3UUX A;  3ZEF A;  3L16 A;  2LSV A;  3FUN A;  1NP7 A;  5A6C A;  3ZPJ A;  3M54 A;  4MLP A;  2IOS A;  3HHM A;  1NA0 A;  2FEZ A;  2WXP A;  4UWL A;  3I4R B;  4JVS A;  4WWP A;  4ATG A;  2FI7 A;  3GW4 A;  5FQ4 A;  4GZ3 A;  5CPR B;  1QZ2 A;  3IHY A;  4A1G A;  1E7V A;  3DBS A;  4UQX A;  4J8O A;  3K9I A;  5T4Y A;  1OWM A;  1IHG A;  1KT1 A;  1HG2 A;  1TJF A;  4I51 A;  2C2L A;  4C0E A;  1E8X A;  2WB2 A;  3M5A A;  2VTB B;  2RG8 A;  5ARF A;  1PEG A;  1Y8M A;  2I2O A;  2WQH A;  5KJM A;  1L5J A;  2QFC A;  2E2E A;  1DNP A;  1OWN A;  3P1U A;  4HOT A;  5JJ0 A;  5JIY A;  1HE8 A;  1ZU2 A;  4XZ4 A;  2VSY A;  3R7Q A;  4KT6 B;  3ZN3 A;  1SZ9 A;  3PNT B;  3KMT A;  4ILG A;  4YNM A;  4FJY A;  2IU1 A;  1ML9 A;  4PS7 A;  3RRU A;  3VLE A;  4PH4 B;  2F69 A;  4DI3 A;  4AY5 A;  3L08 A;  4GPK A;  4TRQ A;  5LOZ A;  2WQ7 A;  4I1M A;  4FMU A;  3F9X A;  4R7L A;  4U0U A;  4IUL A;  2OV8 A;  4BSX A;  3CK9 A;  4JA7 A;  4Q96 A;  2L0I A;  2VGX A;  2CHX A;  2X6F A;  2R3A A;  2XCB A;  2YNQ A;  5CMW A;  1OWO A;  5LFA A;  4EBA G;  4G25 A;  3PS6 A;  2ZU6 B;  5F59 A;  3U64 A;  1KLX A;  4Z4P A;  3Q5M A;  2J4D A;  3CHM A;  4LRZ A;  1H2T C;  3PDN A;  1HF8 A;  3O4Z A;  5BW8 C;  3UQ3 A;  3ZXS A;  4HOR A;  3CK7 A;  3ZHE B;  5F6L A;  4BUP A;  1IQR A;  3JYS A;  1MQS A;  2QY7 A;  4J7F A;  2CFZ A;  1SQM A;  3SW9 A;  5G55 A;  2IF4 A;  4WNG A;  5AIJ A;  4CDN A;  4B8C B;  4F3V A;  1N6C A;  2GW1 A;  4CDM A;  1FVH A;  2UY1 A;  2MHK A;  3CVQ A;  1TEZ A;  4QEO A;  4JZY A;  3QWP A;  4V3I A;  3SD5 A;  3DB5 A;  5C2Y A;  5FQ6 A;  4U07 A;  4AVX A;  4HOS A;  2X38 A;  3O48 A;  2GGF A;  3D9O A;  4XI9 A;  1E8Y A;  2FBN A;  1S0P A;  2AVP A;  2R17 C;  3KS2 A;  4J8D A;  3L17 A;  3Q4A B;  5C1D A;  3HVE B;  4FLH A;  4HS2 A;  1QQE A;  3TXN A;  2OND A;  4L2Y A;  4NAC A;  4GYW A;  2C0L A;  2ION A;  5FJY A;  2LNI A;  3QWV A;  4PS8 A;  3S2A A;  5LX8 A;  1IQU A;  2IQC A;  5ANL A;  3CVP A;  4JLG A;  4YPU A;  3ASD A;  4KMO A;  4AEZ C;  1N3J A;  1LF8 A;  2WPV A;  3SGH A;  2VSX E;  5JJ7 A;  4AU7 A;  2AXZ A;  4B89 A;  3PEV B;  1H2V C;  1PAQ A;  2VQ2 A;  3MYV A;  4WAF A;  5D0O D;  4WNE A;  4HOQ A;  3FTY A;  1E7U A;  2BF0 X;  2FO7 A;  2KAT A;  3RK6 A;  3RO2 A;  4WNF A;  3I3N A;  3M59 A;  4K0R A;  4P29 A;  4U63 A;  4DJA A;  3FH5 A;  2X6J A;  3QB2 A;  1YA0 A;  3T5V A;  3OXL A;  2WXO A;  2ILR A;  3CLJ A;  3QDN A;  4M3O A;  4Y6W A;  5BUZ A;  3LYA A;  4FU3 A;  4DLO A;  2E0I A;  3CVL A;  1MUF A;  3MKQ B;  4JDS A;  4J6I A;  4L23 A;  3BG0 B;  4D10 C;  2WXL A;  4I17 A;  5KCM A;  3TXM A;  1MT6 A;  2L6J A;  1UN9 A;  4FA6 A;  4JEH A;  4XI0 A;  5FZQ A;  3D9I A;  4CT0 A;  4HVB A;  2VTB A;  4I6G A;  5JIN A;  3CBM A;  3FUM A;  4J0U A;  2WMO A;  4BTA A;  5AYW D;  3ZYK A;  4BX9 A;  3FUH A;  3OAW A;  4UI9 C;  2VYI A;  3R7R A;  4PUC A;  3RO3 A;  2I6H A;  2KCK A;  1H6K A;  4U0S A;  2AWI A;  2R59 A;  2V0P A;  2X6K A;  4XKB A;  2Y4U A;  3Q47 B;  5ENN A;  3RAY A;  3PUK A;  4I6E A;  2YQ8 A;  3EHM A;  4EQF A;  4KZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...