4YNDA

The discovery of a-893, a new cell-active benzoxazinone inhibitor of lysine methyltransferase smyd2
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
428
structure length
428
Chain Sequence
AEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Tranferase/transferase inhibitor
molecule keywords N-lysine methyltransferase SMYD2
publication title Discovery of A-893, A New Cell-Active Benzoxazinone Inhibitor of Lysine Methyltransferase SMYD2.
pubmed doi rcsb
source organism Homo sapiens
total genus 132
structure length 428
sequence length 428
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4yndA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4yndA01
2IF4A 2R3AA 3CK8A 1ELRA 3RO2A 4GCOA 4EQFA 4XIFA 3ZGQA 2W5ZA 3S7BA 2RFIA 5EG2A 1KT1A 3CVPA 3MKRA 5CHEE 4J7IA 4GZ3A 4UQYA 1NA3A 4YVQC 5TEGA 3QDNA 4N39A 3OXFA 4GZ5A 5ARGA 4I1AA 4GYYA 1MUFA 3U3WA 1NA0A 3OPEA 1IYGA 3LY9A 5KJLA 4KYOB 2LSUA 3RU0A 5EX3A 4ABNA 4G25A 1ZKKA 3TG4A 3M58A 2XGMA 4WNFA 5TTFA 3Q5MA 3CK7A 5D0OD 3ZHEB 4IJDA 5D0QD 3KMTA 4KBQA 2ONDA 1W3BA 4F3VA 3M5AA 5LSZA 3IEGA 4J0UA 3AS8A 5JINA 2F69A 2PQRA 2WPVA 2C2LA 2Q7FA 3GYZA 2AVPA 4BTBA 4GA0A 1PC2A 2C0LA 4J83A 4CGWA 2PZIA 4I9EA 2VSNA 4AY5A 1P5QA 5DIZA 5FJYA 4HOSA 2XEVA 2YQ8A 2BQZA 3F9YA 3S7DA 1ZU2A 5ARFA 4W9RA 3MV3B 3PDNA 3F9WA 4WNEA 3HYMB 4NVQA 4O30A 3M57A 4YPEA 4GCNA 3UQ3A 4LDGA 2FBNA 3GW4A 5G04C 3F9XA 2VGYA 3SW9A 4LEUA 4APOA 2DBAA 4UI9C 5CCLA 3UPVA 5AYFA 4N2SA 4JDSA 3AS4A 1E96B 2L6JA 3FWVA 3KMJA 2P58C 3WXXA 5LCWJ 4U04A 4HORA 2GW1A 4NRHB 3GZ2A 3RQ4A 3VTXA 5M72A 1YA0A 3M56A 5BW8C 4G23A 4U07A 5F59A 1TJCA 5JIYA 4YPAA 5KJNA 3DB5A 3RJVA 2LNIA 3KS2A 4BT8A 5BT1A 5T0MA 5HQ8A 4AU7A 3S8PA 2O8JA 3RAYA 3Q15A 4U0ZA 4Y6WA 2G46A 3QWPA 4IJ8A 4U0UA 3LCAA 5C1DA 5DBKA 2IFUA 3MEKA 4HOUA 2XGSA 2C0MA 4G1TA 1A17A 2XPIA 2UWJG 4I9CA 3DALA 4YNMA 1QZ2A 5CPRB 5FZSA 4N5CA 4RG9A 2UY1A 4YNPA 3QWVA 3URZA 4YPUA 1IHGA 3MO0A 2VSYA 3KMAA 4NQ0A 4QEOA 3ZPJA 3FP3A 1H3IA 4RG6A 1MT6A 2KCVA 3LKUA 1MVHA 2PQNA 4G24A 5BNWA 4C1QA 2YHCA 1XNFA 4J8FA 4KXKB 5A7DB 4N3AA 1ML9A 3CKCA 4XI0A 3U4TA 3R9AB 1KT0A 2QPWA 4YNDA 3MO2A 2FEZA 5G05J 3K5KA 4Z4PA 3CK9A 4BTAA 2KCKA 2VQ2A 2UY1B 4H7YA 2W5YA 5JJ6A 3RIBA 3M54A 4IN3B 2FO7A 3ZFWA 4I51A 4JA9A 4J7FA 4I2WA 3MA5A 4H12A 3KD7A 3ASDA 4MI0A 4UI9K 3NF1A 1N3JA 4UQXA 2Y4TA 5A6CA 5T0KA 4J8DA 3FFLA 5HI7A 3FPDA 3OXLA 4A1SA 5LCWC 3LYAA 3CV0A 4MI5A 3LY8A 3ESKA 3ASGA 4GA1A 3ASFA 3BO5A 4UQZA 4XI9A 3EP0A 2FF4A 4GZ6A 1WM5A 1N6CA 3VV0A 3Q47B 5F5EA 2Y4UA 4B94A 1HXIA 3TAXA 3QOUA 3CBMA 2HO1A 3QKYA 3RKVA 1FCHA 1WAO1 3AS5A 4CGVA 3UUXA 2BUGA 4WNDA 3TGOA 3CVNA 3LPZA 3KAEA 3Q4AB 4JHRA 3K9IA 4NJ5A 4HOTA 5JJ0A 5TH7A 4JA7A 2VGXA 4YVOA 4HOQA 4AIFA 3SF4A 3M59A 4BT9A 4GA2A 3IHXA 4H7XA 1O9SA 4JLGA 2FI7A 4I17A 2XGOA 2KCLA 4GYOA 2E2EA 4QENA 4N2QA 3EDTB 2IGQA 4JL0A 4GYWA 4WUYA 2QFCA 3CBOA 1Y8MA 3RJWA 4N3BA 2HR2A 5JJ7A 1ZBPA 3RO3A 1QQEA 2KC7A 3MV2B 5EKQD 1MVXA 2VGXB 3M53A 3N71A 1N6AA 3M55A 5JJTA 5G05C 5CCMA 4J8EA 3TG5A 2NC9A 3ASHA 2KATA 3VTYA 4QEPA 1XQHA 3ULQA 2XCBA 4G26A 3E4BA 3LY7A 2WQHA 1NZNA 3Q49B 2J9QA 4WNGA 2JLBA 3JYSA 4BUPA 3S7FA 3BEEA 3CVQA 2VYIA 2MHKA 1B89A 2PL2A 1KLXA 2OOEA 5KJMA 4E47A 3SWCA 3F9ZA 3CVLA 4AM9A 2JV0A 3CBPA 5F6LA 5AYWD 5JHNA 1HZ4A 2XCCA 3CEQA 5FZQA 3VUZA 3CKBA 4I2ZA 3PE4A 4RZ0A 4AY6A 2I6HA 4J8OA 3PE3A 4CDRA 4U0SA 5G04J 5FZRA 2V5FA 5F6KC 3O48A 1ELWA 5FT9A 4N3CA 4Y6CA 3MO5A 5EX0A 4UI9J 1OUVA 4FMUA 3GZ1A 2R5SA 3S7JA 5T5GA 5FTPA 4BWRA 5KJKA 4GPKA 1PEGA 2LSVA 4G2VA 1HH8A 3OS5A 4O6FA 3OXGA 3HNAA 5LSXA 3ZHEA 3ZN3A 3QWWA 3SZ7A 3OOIA 4ME2A 2HYZA
chains in the Genus database with same CATH superfamily
3CK8A 5CRUA 4GCOA 4EQFA 4XIFA 3ZGQA 1DCQA 5EG2A 2WXIA 1KT1A 3AG4E 4UQYA 4YVQC 2GRQB 3DXKG 3VLDA 3CVXA 4N39A 3OXFA 4DRXE 3PS6A 3D9PA 1MUFA 1X81A 4LNUD 3Q75A 3ZU7B 3ONLA 1OWLA 3MCXA 3Q7FA 3RU0A 1N4SA 4LERA 3BU8A 1ZKKA 3G2UA 3LXUX 3IV0A 3SFYA 3Q5MA 4L2LA 3CIAA 1Q2ZA 3FTWA 3ZVVA 3CHRA 3MKQB 5EYPF 1N11A 3M5AA 3BUAA 4O1OA 3AS8A 4DX6D 5JINA 3L08A 3DEOA 3FHEA 3WG7E 3QARA 2DVWA 2ILRA 3G2TA 2OCCE 3IHVA 3R7RA 4MS6A 2VSNA 4Q94A 3PNTB 4HI8A 1RW2A 4WWNA 1ELKA 3ZRHA 2XEVA 5EILA 3TWRA 2BQZA 3S7DA 4GAAA 2CHZA 4NVQA 2GGFA 3D9MA 3X2QE 4YPEA 1FT2A 2J49A 5G04C 3GW4A 4ZHBA 5B3SE 3C3OA 2IO3C 3C5RA 5EIBE 5ANLA 1OT8A 5AYFA 1TR4A 1SQMA 3AS4A 2L6JA 5CERB 5A23A 3KMJA 2WXJA 1TYQG 3CHPA 2V4LA 2VTBA 2R03A 1U3CA 4IYPA 5M72A 3M56A 3CVVA 3HRAA 5KJNA 3RJVA 3CQGB 4DUIA 5HQ8A 4JC8A 5D2MC 4PS3A 4K0RA 2G46A 4Z68A 1NP7A 4KMOA 4EBAG 4Q96A 5LP0A 2X38A 5C1DA 1TNYA 5AARA 4EPZA 3RRNB 2C0MA 5BPPA 4G1TA 2EQXA 1A17A 4PUCA 2XPIA 3CR3A 1V54E 4JHJA 3ZXSA 3B13A 3RSEG 2IY0C 4TV3A 4I9CA 1JCQA 3DALA 2LAIA 2IEJA 4N5CA 1L5JA 1OCRE 1UOHA 3FH5A 4FJYA 4YPUA 3MO0A 4DPRA 2VSYA 3RRMB 4KZ0A 2XZTG 4I6JA 3ZYMA 3T8MA 4RG6A 2KM4A 2KCVA 4DLQA 3LKUA 1MVHA 4DX7D 2RKKA 1XNFA 3DRAA 2B6CA 1MX2A 3L16A 1JWFA 2LXLA 3U4TA 3I4RB 2P9SG 5G05J 3DSWA 3ML8A 4H7YA 5JJ6A 3RIBA 4HS2A 4IN3B 4XKCA 4KVOA 1D8EA 4B93B 4I51A 4I2WA 3LJ3A 4UWHA 1H6OA 3ZYQA 4U8YD 4UI9K 4HRNA 4UQXA 2Y4TA 5T0KA 3F6QA 5HI7A 1G3NB 3UXGA 3CV0A 3ESKA 3SBSA 4XI9A 4C9BB 3EP0A 3D9HA 2BF0X 1N6CA 3D9NA 5F5EA 5ENTD 2Y4UA 1YMPA 3ENEA 3QKYA 3TWWA 1FCHA 1WAO1 2WXFA 3FULA 3UIPC 2OVFA 4I1MA 2RFAA 3TGOA 3CVNA 2YHEA 4CT0A 2X6FA 3Q4AB 3KSLA 4JW1A 4BFRA 3I3NA 3K9IA 5EN5D 2HE0A 1O1SA 5JJ0A 4ANWA 1S63A 4AIFA 3SF4A 4OVVA 3PUKA 4QFVA 1KPSB 3DSSA 3E33A 2R02A 3ISMC 2NYJA 3ASNE 3UT8A 2E2EA 1GW6A 3EDTB 2AXZA 5EIDA 2BEDA 4GYWA 1U2VG 4WUYA 2I2OA 3SY2A 3FTXA 1Y8MA 3DXMG 3RJWA 4URKA 2CFUA 1JUQA 1ZBPA 4LCTA 2ETAA 2KC7A 2GRRB 2X6KA 4F1PA 3CSFA 1H2TC 1N6AA 4FC8A 2EIKE 3VTYA 4QEPA 3EIQC 3HVEB 1OWOA 2XCBA 3FH7A 4R7LA 4B89A 2JLBA 3KEZA 1OWMA 4FP7A 3FTSA 1K3ZD 1KLXA 2GROB 1EYHA 3ABME 4K5BA 2V5QC 4AM9A 3FU3A 5AYWD 1HZ4A 2XCCA 3CEQA 3VUZA 1O5MA 4I2ZA 4AY6A 1A5EA 3PE3A 4U0SA 5G04J 2V5FA 3DSXA 5LOZA 4Y6CA 3MO5A 4DJAA 1OUVA 3GZ1A 3CLJA 4EZLA 4UWLA 5FTPA 5KJKA 3CHQA 1S70B 4G2VA 3ZXPA 5J90A 2DZOA 3PH0C 2IF4A 2R3AA 3RO2A 4BY6A 3UM0A 2RFIA 3CVPA 3MKRA 3NOGD 4J7IA 3C72A 4JHKA 4A1GA 4I1AA 5AN8A 4GYYA 3U3WA 3I4GA 3VLFA 1BLXB 4KYOB 4NURA 1WY6A 3AG3E 4G25A 4AVXA 3CK7A 3HIZA 3ZHEB 3ONKA 1DCEA 1OY3D 5JA4D 1N94A 4KBQA 4AOFA 1LF8A 4CZ2D 3UT7A 5T3RA 3ZUVB 4FJZA 3TJPA 4J0UA 4TXPA 3HXEA 1BI7B 4FLHA 3ULEG 1E8YA 2WXQA 3RAUA 2AVPA 4GA0A 4C0EA 3AU4A 1S64A 4DI4A 3P2BA 2J09A 2XEEA 1N4PA 1P5QA 3IXEA 5FJYA 4V3IA 3NBNB 3MV3B 3F9WA 2IJGX 2AXUA 2XPYA 3HXFA 4HXIA 3VLEA 3F9XA 2FBNA 4IRUA 4TXQA 3Q9NC 4GTRA 1S0PA 4PS7A 2DBAA 3D9KA 4K5CA 2WXMA 1E90A 4JDSA 3CHOA 1IKND 1E96B 2P58C 4YDYA 4OAUC 2VSOE 4HORA 1V55E 4NRHB 2MRIA 3RQ4A 4FLBA 5F59A 1TJCA 3AJIA 2ZU6B 1OWPA 1MHQA 3SO8A 1HF8A 3RAYA 1OCOE 3QNKA 3T8KA 4F6RD 3QWPA 3QAQA 3V79K 3FU6A 3NZSA 3PNLB 4U0UA 3PZ4A 3I5PA 3MEKA 3LS8A 1OCCE 2VTBB 3B7BA 4YDWA 4CCAA 3UKUG 3ZYLA 2A5UA 5FZSA 4RG9A 3IHYA 4YNPA 3QWVA 3URZA 5CEDB 1IHGA 1XGWA 4NQ0A 4BSXA 2J4BA 2WXPA 3FP3A 1H3IA 1MT6A 1N4RA 5FQ7A 2PQNA 4G24A 2OEVA 2YHCA 5FINA 4J8FA 2P9PG 3FUEA 1IQUA 5ENPD 4LUNU 4U96D 3Q9UC 4M7CA 4N3AA 3TWXA 3G2WA 1ML9A 4U95D 4AXHA 4J7WA 4YNDA 4O1PA 3FY4A 4BTAA 4I6GA 4EBAA 3ZEFA 3QJZA 3ZFWA 4L1BA 3MA5A 2KBXA 4GZDA 4BSZB 4ANVA 3NF1A 4HQDA 1N3JA 2X6JA 3KSQA 5A6CA 4ANUA 3FUFA 3JXJA 2XRZA 5T8IA 2KXPC 3FFLA 4A1SA 3LYAA 4MI5A 1H6PA 3B95A 4I43A 4UQZA 4GZ6A 2WXRA 3DSUA 3Q47B 5EYLA 4JEHA 4BERA 2FO1E 4B94A 4LRZA 3NZUA 1TNUA 3FEYA 2HO1A 3T9KA 4LNBA 1H0AA 2WQ6A 4CDNA 1OXJA 3RKVA 2LXMA 3KAEA 3ZNGA 4B8AA 1VDYA 3CGHA 5AAOA 5AQ7A 2WXGA 4U63A 4RSYA 4X8QA 2VGXA 4YVOA 1MX6A 5LFAA 2L0TB 3M59A 3LJNA 1N4QA 4H7XA 5AQAA 1SW6A 5JHAA 1SA5A 3FU0A 3ZYKA 1N0QA 3JUIA 3S2AA 2KCLA 4HFGA 2RFMA 2J07A 3U66A 2XEHA 4F7AA 2QFCA 3CBOA 1NL4A 5FQ6A 4N3BA 2HR2A 5BV1A 3UTMA 1N52A 4L2YA 2RD0A 5EKQD 3M53A 2EIJE 1Z6TA 4FHKA 3MGBA 2ZGGA 2CFZA 2LAHA 3FUMA 4ILGA 4O60A 1TN6A 5CCMA 2J8SD 3TG5A 4MKTA 2KATA 2X3MA 3ULQA 4G26A 4GTQA 2J9QA 3JYSA 4BUPA 2VSXE 4AV7A 3BEEA 3CVQA 2VYIA 2MHKA 3J5QB 2PL2A 4K03A 2I9CA 5CECB 4JZYA 1K1BA 2XS8A 5KJMA 1TNZA 3O4ZA 3UINC 3SWCA 3CBPA 2ETCA 1HS6A 2BKKB 1HX8A 3MZLB 5BXOA 3CKBA 3PE4A 4RZ0A 2IONA 3APCA 5D66A 2XHEA 2P2CP 1ELWA 1KZPA 3FUDA 4AP2A 3J5PA 2F0YA 4HLLA 4HNAD 2LSVA 5BUZA 3OS5A 1D9SA 2JABA 4J6IA 2DCPA 3FTZA 3QWWA 1Y6IA 3JCKC 1H2UA 1TNOA 1ELRA 5IY5E 2J08A 2Y0BG 2EIME 1N95A 5CHEE 5FQ4A 5AJLA 4GZ3A 5ENOD 3APDA 2R2LA 2YINA 5TEGA 1H6KA 4ATGA 5H7PA 3AG2E 5BV0A 1TEZA 3FTYA 3LY9A 3JQ1A 3DSTA 4GZCA 3APFA 2IQCA 4XE0A 3TG4A 3M58A 2XGMA 5TTFA 3DEPA 3AU5A 5D0OD 4IJDA 1TJFA 5D0QD 4J8SA 1K8KG 3KMTA 1JCRA 2WMOA 4J8YA 2GRMA 3IEGA 3D9OA 2WXHA 1BU9A 2F69A 2PQRA 3PEVB 2WPVA 4EECA 1IQRA 4GTOA 4PDXA 4BTBA 2C0LA 4J83A 2PZIA 4I9EA 4E85A 2A4ZA 2OVBA 3HDXA 4BX9A 1MX4A 2X6IA 1MQSA 1EPUA 2YQ8A 3MX3A 3DBSA 5ENQD 2P9KG 3E32A 4JPSA 3HYMB 4WNEA 4O30A 2IU1A 1JWGA 2ZIRA 1E7UA 4GCNA 3UQ3A 1DC2A 1TNBA 3UM2A 4LEUA 2LO6A 3P1UA 3IKOB 3TXNA 3UMVA 4APOA 4CRWA 3PZDA 5HRYA 2QZAA 5CCLA 1AP7A 1SZ9A 2GRPB 4N2SA 1HG2A 3EUVA 3WXXA 1IHBA 3TWUA 2V4HC 2GW1A 4FA6A 3GZ2A 2FULA 3VTXA 2GRNB 2H6HA 1YA0A 5BW8C 2YNQA 4G23A 5ENRD 4EZJA 1U3DA 3DB5A 2LNIA 5T0MA 2QY7A 3S8PA 1H2VC 3G2SA 4U0ZA 3NQPA 4Y6WA 3SFZA 5JHBA 3EHQA 1JCSA 3LCAA 5DBKA 4WAFA 1DVPA 2IFUA 4BESA 2F37A 2BTDA 4EZKA 4HOUA 1KZOA 2XGSA 2QC9A 3UM3A 2WM9A 4GTVA 2J4DA 3TWQA 1O1TA 4A3TA 4HRLA 1LD8A 5CPRB 2UY1A 1EF1C 1QNFA 4QEOA 1BD8A 3BG0B 2KZTA 3G2VA 3B7TA 4DX2A 3UI2A 4WWPA 3SI5A 1EDUA 2L6BA 3AG1E 4L9PA 3CKCA 4IULA 3TWSA 4LSZE 3B7UX 2R59A 3R9AB 5CBOA 1KT0A 4HVBA 2MYOA 3K5KA 4Z4PA 3CK9A 2WQ7A 4JB8P 5C2YA 2KCKA 2VQ2A 3FU5A 5KNGA 4DX1A 2W5YA 4NIKA 1YCSB 4LNGA 5E75A 4ACLA 4J7FA 4HI9A 4H12A 3U64A 3V2OA 5CMYA 1OWNA 1TN7A 2IO2C 1FPPA 1Z5SC 2F8XK 4OAVB 5LCWC 2XPZA 3FDHA 3QK0A 3HHMA 3LY8A 4ILHB 3ASGA 3BO5A 1FVHA 2FF4A 1E8XA 2Y3AA 1UN8A 2WXNA 3VV0A 5CEAA 1HXIA 3QOUA 3CBMA 4F1SA 4LG6A 3RK6A 2XRYA 4MBGA 3AS5A 4CGVA 2BUGA 3SGHA 4HLEA 5CMWA 3LPZA 4NJ5A 3EIJA 3SNXA 4JA7A 3L82A 4HOQA 4Q69A 4BT9A 4BX8A 3UIOC 5E76A 3Q73A 1WG0A 1O9SA 4MRUA 2IOLA 2NXPA 3EHNA 2FI7A 2XGOA 5LX8A 3EHMA 5HKPA 4K5AB 4QENA 3UT4A 4ACKA 5AJDA 3E37A 2EILE 2P9LG 4UUCA 3ZIMA 4BEPA 5JJ7A 3RO3A 3RRUA 1QQEA 3LVQE 3ZW3A 5EDSA 2VGXB 2WMNA 4C48B 4DK5A 3QC1A 3M55A 3L54A 3HG0D 4GPMA 2NSZA 2RG8A 3PRZA 2R17C 4N5QA 4J8EA 4GTPA 2WB2A 2PM6A 3ASHA 4TRQA 1PY1A 3SD5A 1N0RA 3D9LA 2WQHA 1AWCB 3ESLA 3Q7AA 4WNGA 4BETA 1D8DA 1UG3A 3V31A 5KCMA 3D9IA 4APFA 2OOEA 2WVIA 2LUHA 1E7VA 3CVLA 2JV0A 4G8LA 1HG5A 3LVRE 4UWKA 3PZ1A 4KZCA 1LD7A 2I6HA 4J8OA 3KEAA 4CT4A 4CDRA 5FZRA 5F6KC 5G55A 4JD2G 4JXTA 5FT9A 1Z3XA 5KBAA 5BXUA 1HO8A 3SHFA 5CBNA 4FMUA 4MLPA 2R5SA 4UWFA 3S7JA 3CHSA 5T5GA 4BWRA 4GTSA 2L0IA 3SFXA 4GPKA 3TWTA 1N9AA 4O6FA 3ASOE 2CG3A 2OEWA 3HNAA 3C3RA 1H19A 4M3OA 3ML9A 4OYSA 3SZ7A 3ZN3A 4ZFHA 5LSXA 4ME2A 3DPYA 3MKQA 4A63B 2Y69E 2W5ZA 3S7BA 3PZ2A 1NA3A 3QDNA 4GZ5A 5ARGA 1O1RA 4GU5A 1YYHA 1NA0A 1RZ4A 3OPEA 3NAWA 1DNPA 1LTXA 2H6GA 3FUNA 1IYGA 5KJLA 5ITZF 4I6EA 1Z3YA 3EU5A 2LSUA 3UX4A 1HU3A 5EX3A 4ABNA 1N54A 4WNFA 3FUHA 4FULA 1SZAA 2VGEA 3B7RL 2ONDA 1W3BA 4F3VA 5LSZA 5ENNA 1WDYA 4XZ4A 3R7QA 3UKRG 4ATZD 2C2LA 2Q7FA 3GYZA 4UWGA 2R05A 3U9WA 1FT1A 1PC2A 3EJNA 3GZSA 1TN8A 4CGWA 2JEKA 1QBQA 4PH4B 1BPOA 4AY5A 5DIZA 4FHJA 4HOSA 2ZXWE 3F9YA 5HS0A 1ZU2A 5ARFA 4W9RA 3PDNA 4XX5A 3V30A 2E0IA 3M57A 2WXLA 4LDGA 2CG2A 5AENA 2VGYA 3SW9A 1SVXA 1E8WA 2V8SE 2HM8A 4UI9C 3UPVA 1UJJA 1INZA 2AJAA 3T5VA 3FWVA 3L13A 1IXVA 4GMRA 3R9MA 3PUJA 5LCWJ 4U04A 2CHWA 2MOWA 3HXDA 5AQBA 4TUMA 3ULYA 4FADA 4U07A 3DPDA 3D3MA 5JIYA 4YPAA 2XQ0A 3TXMA 3KS2A 5FWQA 4BT8A 4L23A 2BKGA 2I1JA 5ENSD 3T5XA 5BT1A 4AU7A 2O8JA 3W9GA 2ZGDA 2DYRE 3Q15A 3PREA 2DYSE 3C3QA 4HRMB 3FTUA 4ILIA 4IJ8A 3SQVA 3CVYA 3BG1B 4B0ZA 4L7TA 4RQIA 3V2XA 3QB2A 2XZDG 2QYUA 1NFIE 4QQIA 3FTVA 4RVBA 2UWJG 2AWIA 3OAWA 4TXRA 2ETBA 4YNMA 4TUUA 1QZ2A 2V0PA 1MZCA 2A5EA 3KMAA 3ZPJA 2X6HA 3D9JA 2OV8A 4E6HA 3OTNA 2L9BA 4G11A 1SA4A 5JMND 4C1QA 5BNWA 3FH8A 2CHXA 3AAAC 3Q79A 5J08A 4KXKB 4CYMD 5ANRA 5A7DB 2AW6A 3W9FA 3IBEA 4A3VA 4XI0A 4YDOA 4C0MA 2P9NG 4HB5A 3CQCB 1UW4B 2QPWA 3L9TA 3MO2A 3E34A 2FEZA 3MYVA 2H6FA 4EHMA 2UY1B 4GMLA 1HFAA 2KZTB 3M54A 4KVMA 2FO7A 1UN9A 4AEZC 4JA9A 1ZB1A 2DWZA 3NB2A 4RLYA 3KD7A 3ASDA 4MI0A 3LEWA 3B7SA 4OVUA 2PNNA 3PVLA 1E8ZA 4J8DA 4KT6B 3FPDA 3OXLA 4JEUA 2PM7A 1OCZE 4GA1A 3ASFA 2XS1A 3UM1A 1WM5A 3FUIA 3ABKE 5T4YA 4I1OB 3TAXA 4NACA 2WXOA 4AJWA 5FIOA 3DSVA 4DX5D 3UUXA 1JPLA 4WNDA 3TWVA 5G2NA 4JHRA 2H6IA 3HXBA 2AXVA 3CVUA 1HE8A 4HOTA 2EINE 4G8KA 3FUJA 4F53A 1UJKA 3ZKJA 5TH7A 3HXCA 4GA2A 2F8YA 3IHXA 1K1AA 3SBTB 2GRLA 2P9UG 4JLGA 1X5BA 4I17A 1PAQA 4GYOA 3CHMA 3C98A 3ABLE 3HVEA 2DIWA 4N2QA 5AIJA 3BQOA 2IGQA 3L17A 5KNHD 4GB9A 4JL0A 3FUKA 3LDZA 4XEIG 5CRVA 1MJ0A 5KWDA 3TL5A 1FVFA 3MV2B 4GMJA 1MVXA 3MJWA 4P29A 3N71A 3JXIA 4HBDA 5JJTA 5G05C 4U7EB 4U8HA 4CEMA 4YDEA 3JQ0A 3E30A 1BI8B 5FQ8A 3L6AA 4PS8A 2NC9A 1XQHA 3E4BA 3LY7A 4WWOA 2IOSA 1MYOA 1NZNA 2B0OE 3Q49B 4GTTA 3EHRA 2Y1LE 3S7FA 1B89A 4DI3A 3DWLG 4GTMA 4D10C 1QYMA 3EU9A 4E47A 3F9ZA 3Q78A 2DZNA 4ANXA 3CVWA 2VJ8A 5F6LA 5JHNA 2QYJA 5FZQA 5B1AE 1NI1A 3FEXA 2M63A 4CDMA 2P9IG 4XKBA 3JUEA 2WXKA 3O48A 4A55A 3L22A 4U8VD 5AQ9A 4N3CA 5EX0A 2I1KA 4UI9J 3PEUB 4DLOA 4B8CB 3CSTA 1PEGA 5B1BE 1HH8A 4JVSA 2ZISA 4FU3A 3OXGA 3NOCD 3ZHEA 2XENA 3OOIA 2HYZA 3PZ3A
chains in the Genus database with same CATH topology
2IF4A 2R3AA 3CK8A 3MKQA 1ELRA 3RO2A 4BY6A 2J08A 4GCOA 4EQFA 4XIFA 3ZGQA 2W5ZA 3S7BA 2RFIA 5EG2A 2WXIA 1KT1A 3CVPA 3MKRA 5CHEE 5FQ4A 5AJLA 4J7IA 4GZ3A 4UQYA 1NA3A 4YVQC 3APDA 2YINA 5TEGA 3VLDA 3QDNA 3CVXA 1H6KA 4JHKA 3OXFA 4N39A 4GZ5A 5ARGA 4A1GA 3PS6A 4ATGA 4I1AA 3D9PA 4GU5A 4GYYA 1MUFA 3U3WA 1NA0A 3I4GA 5BV0A 3OPEA 1TEZA 1DNPA 3VLFA 3FUNA 3FTYA 1IYGA 3LY9A 5LSXA 5KJLA 3ONLA 3JQ1A 4I6EA 4KYOB 1Z3YA 2LSUA 1OWLA 4GZCA 4NURA 3MCXA 3APFA 1WY6A 2IQCA 3RU0A 3UX4A 1HU3A 5EX3A 4XE0A 4ABNA 1N54A 4LERA 4G25A 1ZKKA 3TG4A 3G2UA 3LXUX 2XGMA 4WNFA 3IV0A 3M58A 3FUHA 3Q5MA 4AVXA 3AU5A 5TTFA 3CK7A 4L2LA 5D0OD 4FULA 3HIZA 3CIAA 1SZAA 3ZHEB 1TJFA 3ONKA 4IJDA 5D0QD 3B7RL 3FTWA 4J8SA 3ZVVA 3KMTA 4KBQA 2WMOA 2ONDA 1W3BA 2GRMA 3CHRA 3MKQB 4AOFA 4F3VA 1LF8A 3M5AA 3UT7A 5T3RA 5LSZA 3IEGA 5ENNA 4FJZA 3D9OA 3TJPA 4J0UA 2WXHA 3AS8A 4XZ4A 5JINA 3R7QA 2F69A 4FLHA 2PQRA 3L08A 3PEVB 2WPVA 1E8YA 2C2LA 4EECA 2Q7FA 2WXQA 1IQRA 3FHEA 3GYZA 4UWGA 4PDXA 3U9WA 2AVPA 4BSXA 4BTBA 4GA0A 1PC2A 3QARA 4C0EA 3EJNA 2C0LA 3GZSA 4J83A 2ILRA 4CGWA 2JEKA 3AU4A 3G2TA 4PH4B 2PZIA 3IHVA 4I9EA 2A4ZA 4MS6A 3P2BA 3R7RA 2OVBA 1BPOA 4DI4A 2VSNA 3HDXA 2J09A 3PNTB 2X6IA 1MQSA 1P5QA 4Q94A 5DIZA 5FJYA 4BX9A 4WWNA 1ELKA 4FHJA 3ZRHA 4V3IA 4HOSA 1EPUA 2XEVA 2YQ8A 2BQZA 3F9YA 3MX3A 3DBSA 3S7DA 1ZU2A 5ARFA 4W9RA 4GAAA 3MV3B 3PDNA 3F9WA 4ME2A 2CHZA 2IJGX 4JPSA 4WNEA 3HYMB 4XX5A 4NVQA 2GGFA 3D9MA 4O30A 2E0IA 1JWGA 2IU1A 2AXUA 3M57A 2XPYA 4YPEA 4HXIA 3VLEA 1E7UA 2J49A 4GCNA 3UQ3A 2WXLA 3ZPJA 4LDGA 2FBNA 2CG2A 3GW4A 5G04C 3F9XA 5AENA 4IRUA 2VGYA 3SW9A 4LEUA 2LO6A 3P1UA 3IKOB 3TXNA 3UMVA 4APOA 4CRWA 3PZDA 1S0PA 4PS7A 1E8WA 2DBAA 2HM8A 2V8SE 4UI9C 5CCLA 3D9KA 3UPVA 5ANLA 2WXMA 1E90A 1SZ9A 1UJJA 5AYFA 4N2SA 1HG2A 1INZA 1SQMA 3AS4A 3CHOA 4JDSA 1E96B 2L6JA 5A23A 3FWVA 3L13A 3T5VA 3KMJA 2WXJA 2P58C 3WXXA 3PUJA 3CHPA 5LCWJ 2V4LA 4U04A 4E85A 2CHWA 2VTBA 2MOWA 2VSOE 4HORA 2GW1A 4NRHB 1U3CA 4FA6A 4IYPA 2MRIA 3GZ2A 2FULA 3VTXA 3RQ4A 5M72A 1YA0A 3M56A 3CVVA 5BW8C 4FADA 2YNQA 4FLBA 4G23A 4U07A 5F59A 1TJCA 3DPDA 3D3MA 4EZJA 4YPAA 1U3DA 5JIYA 2XQ0A 5KJNA 3DB5A 3RJVA 2LNIA 2ZU6B 3TXMA 3KS2A 5FWQA 4BT8A 4L23A 3CQGB 2I1JA 1OWPA 3T5XA 5BT1A 5T0MA 5HQ8A 1MHQA 4AU7A 2QY7A 4JC8A 3S8PA 1HF8A 2O8JA 3RAYA 4PS3A 1H2VC 4K0RA 3G2SA 3Q15A 3PREA 3QNKA 4U0ZA 3NQPA 4Y6WA 2G46A 3SFZA 5JJ7A 5JHBA 1NP7A 3FTUA 3QWPA 3QAQA 4ILIA 4KMOA 3FU6A 3NZSA 4Q96A 4EBAG 3PNLB 4IJ8A 4U0UA 5LP0A 2X38A 3LCAA 5C1DA 5DBKA 4WAFA 3CVYA 1DVPA 2IFUA 3BG1B 3I5PA 2BTDA 3MEKA 4B0ZA 3LS8A 4HOUA 4L7TA 4EPZA 3RRNB 2XGSA 2C0MA 5BPPA 3QB2A 4G1TA 2EQXA 2WM9A 1A17A 2J4DA 4PUCA 2VTBB 2XPIA 3CR3A 4JHJA 3ZXSA 3B13A 3FTVA 4RVBA 4CCAA 2UWJG 4TV3A 2AWIA 4I9CA 3ZYLA 3OAWA 3DALA 4A3TA 2A5UA 4TUUA 4YNMA 1QZ2A 2LAIA 5CPRB 5FZSA 4N5CA 1L5JA 2V0PA 4RG9A 2UY1A 3IHYA 4YNPA 1EF1C 3FH5A 3QWVA 4FJYA 3URZA 1IHGA 4DPRA 1QNFA 1XGWA 2VSYA 4KZ0A 2J4BA 4NQ0A 3RRMB 2X6HA 2WXPA 3BG0B 3D9JA 3FP3A 2KZTA 4I6JA 3T8MA 3ZYMA 1H3IA 4RG6A 2KM4A 1MT6A 3G2VA 2KCVA 2OV8A 3B7TA 4DLQA 5FQ7A 3LKUA 1MVHA 4E6HA 2PQNA 3OTNA 2L9BA 4G11A 4G24A 5BNWA 4WWPA 4C1QA 3FH8A 2YHCA 2CHXA 1XNFA 3SI5A 1EDUA 5J08A 4J8FA 3FUEA 4KXKB 1IQUA 3L16A 5ANRA 5A7DB 4LUNU 4N3AA 1ML9A 2AW6A 3G2WA 3IBEA 1JWFA 4A3VA 3CKCA 4AXHA 4XI0A 4IULA 4C0MA 3B7UX 3CQCB 2R59A 1UW4B 3U4TA 3I4RB 3R9AB 1KT0A 2QPWA 4YNDA 3MO2A 2FEZA 5G05J 4HVBA 3K5KA 3FY4A 3MYVA 4Z4PA 3CK9A 4BTAA 4EZKA 3ML8A 4I6GA 2WQ7A 5C2YA 2KCKA 2VQ2A 3FU5A 2UY1B 4H7YA 2W5YA 4EBAA 5JJ6A 4GMLA 5E75A 3RIBA 3ZEFA 3QJZA 1HFAA 2KZTB 4HS2A 4IN3B 4ACLA 4KVMA 3M54A 2FO7A 3ZFWA 4XKCA 1UN9A 4KVOA 4I51A 4AEZC 4JA9A 4J7FA 4I2WA 4L1BA 3MA5A 4H12A 3LJ3A 4UWHA 3KD7A 3ASDA 4GZDA 3U64A 4ANVA 3ZYQA 4MI0A 4UI9K 3NF1A 5CMYA 1OWNA 3LEWA 1N3JA 2X6JA 2Y4TA 3B7SA 4UQXA 5A6CA 5T0KA 4OVUA 4ANUA 3FUFA 3PVLA 5T8IA 2XRZA 1E8ZA 4J8DA 3FFLA 4KT6B 5HI7A 3FPDA 3OXLA 4A1SA 4JEUA 5LCWC 2XPZA 3FDHA 2PM7A 3LYAA 3QK0A 3HHMA 3CV0A 4MI5A 3LY8A 3ESKA 4ILHB 3SBSA 3KMAA 3ASGA 4GA1A 3ASFA 4I43A 3BO5A 4UQZA 4XI9A 1FVHA 4C9BB 3EP0A 2FF4A 1E8XA 4GZ6A 1WM5A 2BF0X 2Y3AA 1UN8A 2WXRA 2WXNA 3FUIA 3D9NA 3Q47B 1N6CA 3VV0A 4JEHA 5F5EA 5T4YA 2Y4UA 4I1OB 4B94A 1HXIA 3TAXA 4NACA 2WXOA 4LRZA 3NZUA 3QOUA 3CBMA 3FEYA 4F1SA 3RK6A 2HO1A 4AJWA 2XRYA 3ENEA 1H0AA 3QKYA 2WQ6A 4CDNA 3RKVA 1FCHA 1WAO1 2WXFA 3FULA 2OVFA 4I1MA 3AS5A 4CGVA 3UUXA 1JPLA 2BUGA 4WNDA 3SGHA 5G2NA 4HLEA 3CVNA 2YHEA 4CT0A 3TGOA 2X6FA 5CMWA 3LPZA 3KAEA 3Q4AB 4B8AA 1VDYA 3CGHA 4JHRA 4JW1A 4BFRA 3I3NA 3K9IA 4NJ5A 2AXVA 3EIJA 1HE8A 3CVUA 4HOTA 3FUJA 4F53A 1UJKA 2WXGA 4U63A 5JJ0A 5TH7A 3SNXA 4JA7A 4RSYA 4ANWA 2VGXA 4YVOA 5LFAA 2L0TB 4HOQA 4QEOA 4AIFA 3MO0A 3SF4A 4Q69A 3M59A 4BT9A 4OVVA 4GA2A 4BX8A 3IHXA 5E76A 3PUKA 4QFVA 4H7XA 4AY5A 3SBTB 5JHAA 2GRLA 3FU0A 3ZYKA 4MRUA 1O9SA 1X5BA 4JLGA 2IOLA 2NXPA 3EHNA 2FI7A 4I17A 2XGOA 3JUIA 3UT8A 3S2AA 5LX8A 1PAQA 2KCLA 3EHMA 4GYOA 3CHMA 4HFGA 3C98A 2E2EA 3HVEA 2J07A 1GW6A 4QENA 2DIWA 4N2QA 3EDTB 5AIJA 2IGQA 2AXZA 3L17A 3UT4A 4ACKA 5AJDA 4GB9A 3U66A 4JL0A 3FUKA 4GYWA 3LDZA 4F7AA 4WUYA 2I2OA 2QFCA 3CBOA 3FTXA 1Y8MA 3RJWA 4URKA 5FQ6A 4N3BA 2HR2A 3ZIMA 5BV1A 2CFUA 3TL5A 1JUQA 1ZBPA 1N52A 1QQEA 3LVQE 4LCTA 4L2YA 3RO3A 3RRUA 3ZW3A 2KC7A 5EDSA 1FVFA 2RD0A 3MV2B 5EKQD 4GMJA 1MVXA 2VGXB 3M53A 2WMNA 2X6KA 4DK5A 3MJWA 1Z6TA 3CSFA 1H2TC 4FHKA 4P29A 3MGBA 3N71A 1N6AA 3QC1A 3M55A 2CFZA 2LAHA 3L54A 5JJTA 5G05C 3FUMA 4ILGA 2NSZA 4U8HA 2RG8A 4CEMA 4FC8A 3PRZA 2R17C 5CCMA 4J8EA 3TG5A 3JQ0A 2WB2A 5FQ8A 3L6AA 2PM6A 4MKTA 4PS8A 2NC9A 3ASHA 2KATA 4TRQA 1PY1A 3VTYA 4QEPA 1XQHA 3EIQC 2X3MA 3SD5A 3HVEB 3ULQA 1OWOA 2XCBA 3D9LA 4G26A 3E4BA 3LY7A 4WWOA 2IOSA 2WQHA 3FH7A 4R7LA 1NZNA 3Q49B 2J9QA 3ESLA 4YPUA 4WNGA 4B89A 2JLBA 3JYSA 3KEZA 4BUPA 2VSXE 4AV7A 1OWMA 3S7FA 4FP7A 3BEEA 3CVQA 1UG3A 2MHKA 1B89A 2VYIA 2PL2A 3FTSA 3D9IA 4K03A 5KCMA 1KLXA 4DI3A 2I9CA 4D10C 4APFA 4JZYA 2OOEA 2WVIA 1EYHA 5KJMA 4E47A 3O4ZA 1E7VA 3SWCA 3F9ZA 3CVLA 4AM9A 4ANXA 2JV0A 3CBPA 1HG5A 3FU3A 3LVRE 1HS6A 4UWKA 3CVWA 1HX8A 2VJ8A 3MZLB 5F6LA 5AYWD 5JHNA 1HZ4A 2XCCA 3CEQA 5FZQA 3VUZA 3CKBA 4I2ZA 3PE4A 4KZCA 4RZ0A 4AY6A 3FEXA 2IONA 2I6HA 4J8OA 3PE3A 2M63A 4CT4A 4CDRA 4U0SA 5G04J 5FZRA 4CDMA 2V5FA 3APCA 4XKBA 5F6KC 5G55A 5LOZA 4JXTA 4A55A 2WXKA 2XHEA 3O48A 3L22A 1ELWA 5FT9A 1Z3XA 3FUDA 4N3CA 4Y6CA 3MO5A 5EX0A 2I1KA 1HO8A 4AP2A 4UI9J 3SHFA 4DJAA 1OUVA 4FMUA 3GZ1A 4MLPA 2R5SA 4UWFA 3S7JA 3CHSA 3PEUB 3CLJA 4DLOA 4EZLA 4UWLA 5FTPA 4B8CB 5T5GA 4BWRA 2L0IA 5KJKA 4GPKA 3CSTA 1PEGA 3CHQA 2LSVA 5BUZA 4G2VA 1HH8A 4JVSA 3OS5A 4O6FA 5J90A 4J6IA 4FU3A 3PH0C 3OXGA 2DCPA 2CG3A 3FTZA 3HNAA 1H19A 4M3OA 3ML9A 4OYSA 3QWWA 3SZ7A 1Y6IA 3ZHEA 3JCKC 3ZN3A 3OOIA 2HYZA 1H2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IF4 A;  2R3A A;  3CK8 A;  1ELR A;  3RO2 A;  4GCO A;  4EQF A;  4XIF A;  3ZGQ A;  2W5Z A;  3S7B A;  2RFI A;  5EG2 A;  1KT1 A;  3CVP A;  3MKR A;  5CHE E;  4J7I A;  4GZ3 A;  4UQY A;  1NA3 A;  4YVQ C;  5TEG A;  3QDN A;  4N39 A;  3OXF A;  4GZ5 A;  5ARG A;  4I1A A;  4GYY A;  1MUF A;  3U3W A;  1NA0 A;  3OPE A;  1IYG A;  3LY9 A;  5KJL A;  4KYO B;  2LSU A;  3RU0 A;  5EX3 A;  4ABN A;  4G25 A;  1ZKK A;  3TG4 A;  3M58 A;  2XGM A;  4WNF A;  5TTF A;  3Q5M A;  3CK7 A;  5D0O D;  3ZHE B;  4IJD A;  5D0Q D;  3KMT A;  4KBQ A;  2OND A;  1W3B A;  4F3V A;  3M5A A;  5LSZ A;  3IEG A;  4J0U A;  3AS8 A;  5JIN A;  2F69 A;  2PQR A;  2WPV A;  2C2L A;  2Q7F A;  3GYZ A;  2AVP A;  4BTB A;  4GA0 A;  1PC2 A;  2C0L A;  4J83 A;  4CGW A;  2PZI A;  4I9E A;  2VSN A;  4AY5 A;  1P5Q A;  5DIZ A;  5FJY A;  4HOS A;  2XEV A;  2YQ8 A;  2BQZ A;  3F9Y A;  3S7D A;  1ZU2 A;  5ARF A;  4W9R A;  3MV3 B;  3PDN A;  3F9W A;  4WNE A;  3HYM B;  4NVQ A;  4O30 A;  3M57 A;  4YPE A;  4GCN A;  3UQ3 A;  4LDG A;  2FBN A;  3GW4 A;  5G04 C;  3F9X A;  2VGY A;  3SW9 A;  4LEU A;  4APO A;  2DBA A;  4UI9 C;  5CCL A;  3UPV A;  5AYF A;  4N2S A;  4JDS A;  3AS4 A;  1E96 B;  2L6J A;  3FWV A;  3KMJ A;  2P58 C;  3WXX A;  5LCW J;  4U04 A;  4HOR A;  2GW1 A;  4NRH B;  3GZ2 A;  3RQ4 A;  3VTX A;  5M72 A;  1YA0 A;  3M56 A;  5BW8 C;  4G23 A;  4U07 A;  5F59 A;  1TJC A;  5JIY A;  4YPA A;  5KJN A;  3DB5 A;  3RJV A;  2LNI A;  3KS2 A;  4BT8 A;  5BT1 A;  5T0M A;  5HQ8 A;  4AU7 A;  3S8P A;  2O8J A;  3RAY A;  3Q15 A;  4U0Z A;  4Y6W A;  2G46 A;  3QWP A;  4IJ8 A;  4U0U A;  3LCA A;  5C1D A;  5DBK A;  2IFU A;  3MEK A;  4HOU A;  2XGS A;  2C0M A;  4G1T A;  1A17 A;  2XPI A;  2UWJ G;  4I9C A;  3DAL A;  4YNM A;  1QZ2 A;  5CPR B;  5FZS A;  4N5C A;  4RG9 A;  2UY1 A;  4YNP A;  3QWV A;  3URZ A;  4YPU A;  1IHG A;  3MO0 A;  2VSY A;  3KMA A;  4NQ0 A;  4QEO A;  3ZPJ A;  3FP3 A;  1H3I A;  4RG6 A;  1MT6 A;  2KCV A;  3LKU A;  1MVH A;  2PQN A;  4G24 A;  5BNW A;  4C1Q A;  2YHC A;  1XNF A;  4J8F A;  4KXK B;  5A7D B;  4N3A A;  1ML9 A;  3CKC A;  4XI0 A;  3U4T A;  3R9A B;  1KT0 A;  2QPW A;  4YND A;  3MO2 A;  2FEZ A;  5G05 J;  3K5K A;  4Z4P A;  3CK9 A;  4BTA A;  2KCK A;  2VQ2 A;  2UY1 B;  4H7Y A;  2W5Y A;  5JJ6 A;  3RIB A;  3M54 A;  4IN3 B;  2FO7 A;  3ZFW A;  4I51 A;  4JA9 A;  4J7F A;  4I2W A;  3MA5 A;  4H12 A;  3KD7 A;  3ASD A;  4MI0 A;  4UI9 K;  3NF1 A;  1N3J A;  4UQX A;  2Y4T A;  5A6C A;  5T0K A;  4J8D A;  3FFL A;  5HI7 A;  3FPD A;  3OXL A;  4A1S A;  5LCW C;  3LYA A;  3CV0 A;  4MI5 A;  3LY8 A;  3ESK A;  3ASG A;  4GA1 A;  3ASF A;  3BO5 A;  4UQZ A;  4XI9 A;  3EP0 A;  2FF4 A;  4GZ6 A;  1WM5 A;  1N6C A;  3VV0 A;  3Q47 B;  5F5E A;  2Y4U A;  4B94 A;  1HXI A;  3TAX A;  3QOU A;  3CBM A;  2HO1 A;  3QKY A;  3RKV A;  1FCH A;  1WAO 1;  3AS5 A;  4CGV A;  3UUX A;  2BUG A;  4WND A;  3TGO A;  3CVN A;  3LPZ A;  3KAE A;  3Q4A B;  4JHR A;  3K9I A;  4NJ5 A;  4HOT A;  5JJ0 A;  5TH7 A;  4JA7 A;  2VGX A;  4YVO A;  4HOQ A;  4AIF A;  3SF4 A;  3M59 A;  4BT9 A;  4GA2 A;  3IHX A;  4H7X A;  1O9S A;  4JLG A;  2FI7 A;  4I17 A;  2XGO A;  2KCL A;  4GYO A;  2E2E A;  4QEN A;  4N2Q A;  3EDT B;  2IGQ A;  4JL0 A;  4GYW A;  4WUY A;  2QFC A;  3CBO A;  1Y8M A;  3RJW A;  4N3B A;  2HR2 A;  5JJ7 A;  1ZBP A;  3RO3 A;  1QQE A;  2KC7 A;  3MV2 B;  5EKQ D;  1MVX A;  2VGX B;  3M53 A;  3N71 A;  1N6A A;  3M55 A;  5JJT A;  5G05 C;  5CCM A;  4J8E A;  3TG5 A;  2NC9 A;  3ASH A;  2KAT A;  3VTY A;  4QEP A;  1XQH A;  3ULQ A;  2XCB A;  4G26 A;  3E4B A;  3LY7 A;  2WQH A;  1NZN A;  3Q49 B;  2J9Q A;  4WNG A;  2JLB A;  3JYS A;  4BUP A;  3S7F A;  3BEE A;  3CVQ A;  2VYI A;  2MHK A;  1B89 A;  2PL2 A;  1KLX A;  2OOE A;  5KJM A;  4E47 A;  3SWC A;  3F9Z A;  3CVL A;  4AM9 A;  2JV0 A;  3CBP A;  5F6L A;  5AYW D;  5JHN A;  1HZ4 A;  2XCC A;  3CEQ A;  5FZQ A;  3VUZ A;  3CKB A;  4I2Z A;  3PE4 A;  4RZ0 A;  4AY6 A;  2I6H A;  4J8O A;  3PE3 A;  4CDR A;  4U0S A;  5G04 J;  5FZR A;  2V5F A;  5F6K C;  3O48 A;  1ELW A;  5FT9 A;  4N3C A;  4Y6C A;  3MO5 A;  5EX0 A;  4UI9 J;  1OUV A;  4FMU A;  3GZ1 A;  2R5S A;  3S7J A;  5T5G A;  5FTP A;  4BWR A;  5KJK A;  4GPK A;  1PEG A;  2LSV A;  4G2V A;  1HH8 A;  3OS5 A;  4O6F A;  3OXG A;  3HNA A;  5LSX A;  3ZHE A;  3ZN3 A;  3QWW A;  3SZ7 A;  3OOI A;  4ME2 A;  2HYZ A; 
#chains in the Genus database with same CATH topology
 3CK8 A;  5CRU A;  4GCO A;  4EQF A;  4XIF A;  3ZGQ A;  1DCQ A;  5EG2 A;  2WXI A;  1KT1 A;  3AG4 E;  4UQY A;  4YVQ C;  2GRQ B;  3DXK G;  3VLD A;  3CVX A;  4N39 A;  3OXF A;  4DRX E;  3PS6 A;  3D9P A;  1MUF A;  1X81 A;  4LNU D;  3Q75 A;  3ZU7 B;  3ONL A;  1OWL A;  3MCX A;  3Q7F A;  3RU0 A;  1N4S A;  4LER A;  3BU8 A;  1ZKK A;  3G2U A;  3LXU X;  3IV0 A;  3SFY A;  3Q5M A;  4L2L A;  3CIA A;  1Q2Z A;  3FTW A;  3ZVV A;  3CHR A;  3MKQ B;  5EYP F;  1N11 A;  3M5A A;  3BUA A;  4O1O A;  3AS8 A;  4DX6 D;  5JIN A;  3L08 A;  3DEO A;  3FHE A;  3WG7 E;  3QAR A;  2DVW A;  2ILR A;  3G2T A;  2OCC E;  3IHV A;  3R7R A;  4MS6 A;  2VSN A;  4Q94 A;  3PNT B;  4HI8 A;  1RW2 A;  4WWN A;  1ELK A;  3ZRH A;  2XEV A;  5EIL A;  3TWR A;  2BQZ A;  3S7D A;  4GAA A;  2CHZ A;  4NVQ A;  2GGF A;  3D9M A;  3X2Q E;  4YPE A;  1FT2 A;  2J49 A;  5G04 C;  3GW4 A;  4ZHB A;  5B3S E;  3C3O A;  2IO3 C;  3C5R A;  5EIB E;  5ANL A;  1OT8 A;  5AYF A;  1TR4 A;  1SQM A;  3AS4 A;  2L6J A;  5CER B;  5A23 A;  3KMJ A;  2WXJ A;  1TYQ G;  3CHP A;  2V4L A;  2VTB A;  2R03 A;  1U3C A;  4IYP A;  5M72 A;  3M56 A;  3CVV A;  3HRA A;  5KJN A;  3RJV A;  3CQG B;  4DUI A;  5HQ8 A;  4JC8 A;  5D2M C;  4PS3 A;  4K0R A;  2G46 A;  4Z68 A;  1NP7 A;  4KMO A;  4EBA G;  4Q96 A;  5LP0 A;  2X38 A;  5C1D A;  1TNY A;  5AAR A;  4EPZ A;  3RRN B;  2C0M A;  5BPP A;  4G1T A;  2EQX A;  1A17 A;  4PUC A;  2XPI A;  3CR3 A;  1V54 E;  4JHJ A;  3ZXS A;  3B13 A;  3RSE G;  2IY0 C;  4TV3 A;  4I9C A;  1JCQ A;  3DAL A;  2LAI A;  2IEJ A;  4N5C A;  1L5J A;  1OCR E;  1UOH A;  3FH5 A;  4FJY A;  4YPU A;  3MO0 A;  4DPR A;  2VSY A;  3RRM B;  4KZ0 A;  2XZT G;  4I6J A;  3ZYM A;  3T8M A;  4RG6 A;  2KM4 A;  2KCV A;  4DLQ A;  3LKU A;  1MVH A;  4DX7 D;  2RKK A;  1XNF A;  3DRA A;  2B6C A;  1MX2 A;  3L16 A;  1JWF A;  2LXL A;  3U4T A;  3I4R B;  2P9S G;  5G05 J;  3DSW A;  3ML8 A;  4H7Y A;  5JJ6 A;  3RIB A;  4HS2 A;  4IN3 B;  4XKC A;  4KVO A;  1D8E A;  4B93 B;  4I51 A;  4I2W A;  3LJ3 A;  4UWH A;  1H6O A;  3ZYQ A;  4U8Y D;  4UI9 K;  4HRN A;  4UQX A;  2Y4T A;  5T0K A;  3F6Q A;  5HI7 A;  1G3N B;  3UXG A;  3CV0 A;  3ESK A;  3SBS A;  4XI9 A;  4C9B B;  3EP0 A;  3D9H A;  2BF0 X;  1N6C A;  3D9N A;  5F5E A;  5ENT D;  2Y4U A;  1YMP A;  3ENE A;  3QKY A;  3TWW A;  1FCH A;  1WAO 1;  2WXF A;  3FUL A;  3UIP C;  2OVF A;  4I1M A;  2RFA A;  3TGO A;  3CVN A;  2YHE A;  4CT0 A;  2X6F A;  3Q4A B;  3KSL A;  4JW1 A;  4BFR A;  3I3N A;  3K9I A;  5EN5 D;  2HE0 A;  1O1S A;  5JJ0 A;  4ANW A;  1S63 A;  4AIF A;  3SF4 A;  4OVV A;  3PUK A;  4QFV A;  1KPS B;  3DSS A;  3E33 A;  2R02 A;  3ISM C;  2NYJ A;  3ASN E;  3UT8 A;  2E2E A;  1GW6 A;  3EDT B;  2AXZ A;  5EID A;  2BED A;  4GYW A;  1U2V G;  4WUY A;  2I2O A;  3SY2 A;  3FTX A;  1Y8M A;  3DXM G;  3RJW A;  4URK A;  2CFU A;  1JUQ A;  1ZBP A;  4LCT A;  2ETA A;  2KC7 A;  2GRR B;  2X6K A;  4F1P A;  3CSF A;  1H2T C;  1N6A A;  4FC8 A;  2EIK E;  3VTY A;  4QEP A;  3EIQ C;  3HVE B;  1OWO A;  2XCB A;  3FH7 A;  4R7L A;  4B89 A;  2JLB A;  3KEZ A;  1OWM A;  4FP7 A;  3FTS A;  1K3Z D;  1KLX A;  2GRO B;  1EYH A;  3ABM E;  4K5B A;  2V5Q C;  4AM9 A;  3FU3 A;  5AYW D;  1HZ4 A;  2XCC A;  3CEQ A;  3VUZ A;  1O5M A;  4I2Z A;  4AY6 A;  1A5E A;  3PE3 A;  4U0S A;  5G04 J;  2V5F A;  3DSX A;  5LOZ A;  4Y6C A;  3MO5 A;  4DJA A;  1OUV A;  3GZ1 A;  3CLJ A;  4EZL A;  4UWL A;  5FTP A;  5KJK A;  3CHQ A;  1S70 B;  4G2V A;  3ZXP A;  5J90 A;  2DZO A;  3PH0 C;  2IF4 A;  2R3A A;  3RO2 A;  4BY6 A;  3UM0 A;  2RFI A;  3CVP A;  3MKR A;  3NOG D;  4J7I A;  3C72 A;  4JHK A;  4A1G A;  4I1A A;  5AN8 A;  4GYY A;  3U3W A;  3I4G A;  3VLF A;  1BLX B;  4KYO B;  4NUR A;  1WY6 A;  3AG3 E;  4G25 A;  4AVX A;  3CK7 A;  3HIZ A;  3ZHE B;  3ONK A;  1DCE A;  1OY3 D;  5JA4 D;  1N94 A;  4KBQ A;  4AOF A;  1LF8 A;  4CZ2 D;  3UT7 A;  5T3R A;  3ZUV B;  4FJZ A;  3TJP A;  4J0U A;  4TXP A;  3HXE A;  1BI7 B;  4FLH A;  3ULE G;  1E8Y A;  2WXQ A;  3RAU A;  2AVP A;  4GA0 A;  4C0E A;  3AU4 A;  1S64 A;  4DI4 A;  3P2B A;  2J09 A;  2XEE A;  1N4P A;  1P5Q A;  3IXE A;  5FJY A;  4V3I A;  3NBN B;  3MV3 B;  3F9W A;  2IJG X;  2AXU A;  2XPY A;  3HXF A;  4HXI A;  3VLE A;  3F9X A;  2FBN A;  4IRU A;  4TXQ A;  3Q9N C;  4GTR A;  1S0P A;  4PS7 A;  2DBA A;  3D9K A;  4K5C A;  2WXM A;  1E90 A;  4JDS A;  3CHO A;  1IKN D;  1E96 B;  2P58 C;  4YDY A;  4OAU C;  2VSO E;  4HOR A;  1V55 E;  4NRH B;  2MRI A;  3RQ4 A;  4FLB A;  5F59 A;  1TJC A;  3AJI A;  2ZU6 B;  1OWP A;  1MHQ A;  3SO8 A;  1HF8 A;  3RAY A;  1OCO E;  3QNK A;  3T8K A;  4F6R D;  3QWP A;  3QAQ A;  3V79 K;  3FU6 A;  3NZS A;  3PNL B;  4U0U A;  3PZ4 A;  3I5P A;  3MEK A;  3LS8 A;  1OCC E;  2VTB B;  3B7B A;  4YDW A;  4CCA A;  3UKU G;  3ZYL A;  2A5U A;  5FZS A;  4RG9 A;  3IHY A;  4YNP A;  3QWV A;  3URZ A;  5CED B;  1IHG A;  1XGW A;  4NQ0 A;  4BSX A;  2J4B A;  2WXP A;  3FP3 A;  1H3I A;  1MT6 A;  1N4R A;  5FQ7 A;  2PQN A;  4G24 A;  2OEV A;  2YHC A;  5FIN A;  4J8F A;  2P9P G;  3FUE A;  1IQU A;  5ENP D;  4LUN U;  4U96 D;  3Q9U C;  4M7C A;  4N3A A;  3TWX A;  3G2W A;  1ML9 A;  4U95 D;  4AXH A;  4J7W A;  4YND A;  4O1P A;  3FY4 A;  4BTA A;  4I6G A;  4EBA A;  3ZEF A;  3QJZ A;  3ZFW A;  4L1B A;  3MA5 A;  2KBX A;  4GZD A;  4BSZ B;  4ANV A;  3NF1 A;  4HQD A;  1N3J A;  2X6J A;  3KSQ A;  5A6C A;  4ANU A;  3FUF A;  3JXJ A;  2XRZ A;  5T8I A;  2KXP C;  3FFL A;  4A1S A;  3LYA A;  4MI5 A;  1H6P A;  3B95 A;  4I43 A;  4UQZ A;  4GZ6 A;  2WXR A;  3DSU A;  3Q47 B;  5EYL A;  4JEH A;  4BER A;  2FO1 E;  4B94 A;  4LRZ A;  3NZU A;  1TNU A;  3FEY A;  2HO1 A;  3T9K A;  4LNB A;  1H0A A;  2WQ6 A;  4CDN A;  1OXJ A;  3RKV A;  2LXM A;  3KAE A;  3ZNG A;  4B8A A;  1VDY A;  3CGH A;  5AAO A;  5AQ7 A;  2WXG A;  4U63 A;  4RSY A;  4X8Q A;  2VGX A;  4YVO A;  1MX6 A;  5LFA A;  2L0T B;  3M59 A;  3LJN A;  1N4Q A;  4H7X A;  5AQA A;  1SW6 A;  5JHA A;  1SA5 A;  3FU0 A;  3ZYK A;  1N0Q A;  3JUI A;  3S2A A;  2KCL A;  4HFG A;  2RFM A;  2J07 A;  3U66 A;  2XEH A;  4F7A A;  2QFC A;  3CBO A;  1NL4 A;  5FQ6 A;  4N3B A;  2HR2 A;  5BV1 A;  3UTM A;  1N52 A;  4L2Y A;  2RD0 A;  5EKQ D;  3M53 A;  2EIJ E;  1Z6T A;  4FHK A;  3MGB A;  2ZGG A;  2CFZ A;  2LAH A;  3FUM A;  4ILG A;  4O60 A;  1TN6 A;  5CCM A;  2J8S D;  3TG5 A;  4MKT A;  2KAT A;  2X3M A;  3ULQ A;  4G26 A;  4GTQ A;  2J9Q A;  3JYS A;  4BUP A;  2VSX E;  4AV7 A;  3BEE A;  3CVQ A;  2VYI A;  2MHK A;  3J5Q B;  2PL2 A;  4K03 A;  2I9C A;  5CEC B;  4JZY A;  1K1B A;  2XS8 A;  5KJM A;  1TNZ A;  3O4Z A;  3UIN C;  3SWC A;  3CBP A;  2ETC A;  1HS6 A;  2BKK B;  1HX8 A;  3MZL B;  5BXO A;  3CKB A;  3PE4 A;  4RZ0 A;  2ION A;  3APC A;  5D66 A;  2XHE A;  2P2C P;  1ELW A;  1KZP A;  3FUD A;  4AP2 A;  3J5P A;  2F0Y A;  4HLL A;  4HNA D;  2LSV A;  5BUZ A;  3OS5 A;  1D9S A;  2JAB A;  4J6I A;  2DCP A;  3FTZ A;  3QWW A;  1Y6I A;  3JCK C;  1H2U A;  1TNO A;  1ELR A;  5IY5 E;  2J08 A;  2Y0B G;  2EIM E;  1N95 A;  5CHE E;  5FQ4 A;  5AJL A;  4GZ3 A;  5ENO D;  3APD A;  2R2L A;  2YIN A;  5TEG A;  1H6K A;  4ATG A;  5H7P A;  3AG2 E;  5BV0 A;  1TEZ A;  3FTY A;  3LY9 A;  3JQ1 A;  3DST A;  4GZC A;  3APF A;  2IQC A;  4XE0 A;  3TG4 A;  3M58 A;  2XGM A;  5TTF A;  3DEP A;  3AU5 A;  5D0O D;  4IJD A;  1TJF A;  5D0Q D;  4J8S A;  1K8K G;  3KMT A;  1JCR A;  2WMO A;  4J8Y A;  2GRM A;  3IEG A;  3D9O A;  2WXH A;  1BU9 A;  2F69 A;  2PQR A;  3PEV B;  2WPV A;  4EEC A;  1IQR A;  4GTO A;  4PDX A;  4BTB A;  2C0L A;  4J83 A;  2PZI A;  4I9E A;  4E85 A;  2A4Z A;  2OVB A;  3HDX A;  4BX9 A;  1MX4 A;  2X6I A;  1MQS A;  1EPU A;  2YQ8 A;  3MX3 A;  3DBS A;  5ENQ D;  2P9K G;  3E32 A;  4JPS A;  3HYM B;  4WNE A;  4O30 A;  2IU1 A;  1JWG A;  2ZIR A;  1E7U A;  4GCN A;  3UQ3 A;  1DC2 A;  1TNB A;  3UM2 A;  4LEU A;  2LO6 A;  3P1U A;  3IKO B;  3TXN A;  3UMV A;  4APO A;  4CRW A;  3PZD A;  5HRY A;  2QZA A;  5CCL A;  1AP7 A;  1SZ9 A;  2GRP B;  4N2S A;  1HG2 A;  3EUV A;  3WXX A;  1IHB A;  3TWU A;  2V4H C;  2GW1 A;  4FA6 A;  3GZ2 A;  2FUL A;  3VTX A;  2GRN B;  2H6H A;  1YA0 A;  5BW8 C;  2YNQ A;  4G23 A;  5ENR D;  4EZJ A;  1U3D A;  3DB5 A;  2LNI A;  5T0M A;  2QY7 A;  3S8P A;  1H2V C;  3G2S A;  4U0Z A;  3NQP A;  4Y6W A;  3SFZ A;  5JHB A;  3EHQ A;  1JCS A;  3LCA A;  5DBK A;  4WAF A;  1DVP A;  2IFU A;  4BES A;  2F37 A;  2BTD A;  4EZK A;  4HOU A;  1KZO A;  2XGS A;  2QC9 A;  3UM3 A;  2WM9 A;  4GTV A;  2J4D A;  3TWQ A;  1O1T A;  4A3T A;  4HRL A;  1LD8 A;  5CPR B;  2UY1 A;  1EF1 C;  1QNF A;  4QEO A;  1BD8 A;  3BG0 B;  2KZT A;  3G2V A;  3B7T A;  4DX2 A;  3UI2 A;  4WWP A;  3SI5 A;  1EDU A;  2L6B A;  3AG1 E;  4L9P A;  3CKC A;  4IUL A;  3TWS A;  4LSZ E;  3B7U X;  2R59 A;  3R9A B;  5CBO A;  1KT0 A;  4HVB A;  2MYO A;  3K5K A;  4Z4P A;  3CK9 A;  2WQ7 A;  4JB8 P;  5C2Y A;  2KCK A;  2VQ2 A;  3FU5 A;  5KNG A;  4DX1 A;  2W5Y A;  4NIK A;  1YCS B;  4LNG A;  5E75 A;  4ACL A;  4J7F A;  4HI9 A;  4H12 A;  3U64 A;  3V2O A;  5CMY A;  1OWN A;  1TN7 A;  2IO2 C;  1FPP A;  1Z5S C;  2F8X K;  4OAV B;  5LCW C;  2XPZ A;  3FDH A;  3QK0 A;  3HHM A;  3LY8 A;  4ILH B;  3ASG A;  3BO5 A;  1FVH A;  2FF4 A;  1E8X A;  2Y3A A;  1UN8 A;  2WXN A;  3VV0 A;  5CEA A;  1HXI A;  3QOU A;  3CBM A;  4F1S A;  4LG6 A;  3RK6 A;  2XRY A;  4MBG A;  3AS5 A;  4CGV A;  2BUG A;  3SGH A;  4HLE A;  5CMW A;  3LPZ A;  4NJ5 A;  3EIJ A;  3SNX A;  4JA7 A;  3L82 A;  4HOQ A;  4Q69 A;  4BT9 A;  4BX8 A;  3UIO C;  5E76 A;  3Q73 A;  1WG0 A;  1O9S A;  4MRU A;  2IOL A;  2NXP A;  3EHN A;  2FI7 A;  2XGO A;  5LX8 A;  3EHM A;  5HKP A;  4K5A B;  4QEN A;  3UT4 A;  4ACK A;  5AJD A;  3E37 A;  2EIL E;  2P9L G;  4UUC A;  3ZIM A;  4BEP A;  5JJ7 A;  3RO3 A;  3RRU A;  1QQE A;  3LVQ E;  3ZW3 A;  5EDS A;  2VGX B;  2WMN A;  4C48 B;  4DK5 A;  3QC1 A;  3M55 A;  3L54 A;  3HG0 D;  4GPM A;  2NSZ A;  2RG8 A;  3PRZ A;  2R17 C;  4N5Q A;  4J8E A;  4GTP A;  2WB2 A;  2PM6 A;  3ASH A;  4TRQ A;  1PY1 A;  3SD5 A;  1N0R A;  3D9L A;  2WQH A;  1AWC B;  3ESL A;  3Q7A A;  4WNG A;  4BET A;  1D8D A;  1UG3 A;  3V31 A;  5KCM A;  3D9I A;  4APF A;  2OOE A;  2WVI A;  2LUH A;  1E7V A;  3CVL A;  2JV0 A;  4G8L A;  1HG5 A;  3LVR E;  4UWK A;  3PZ1 A;  4KZC A;  1LD7 A;  2I6H A;  4J8O A;  3KEA A;  4CT4 A;  4CDR A;  5FZR A;  5F6K C;  5G55 A;  4JD2 G;  4JXT A;  5FT9 A;  1Z3X A;  5KBA A;  5BXU A;  1HO8 A;  3SHF A;  5CBN A;  4FMU A;  4MLP A;  2R5S A;  4UWF A;  3S7J A;  3CHS A;  5T5G A;  4BWR A;  4GTS A;  2L0I A;  3SFX A;  4GPK A;  3TWT A;  1N9A A;  4O6F A;  3ASO E;  2CG3 A;  2OEW A;  3HNA A;  3C3R A;  1H19 A;  4M3O A;  3ML9 A;  4OYS A;  3SZ7 A;  3ZN3 A;  4ZFH A;  5LSX A;  4ME2 A;  3DPY A;  3MKQ A;  4A63 B;  2Y69 E;  2W5Z A;  3S7B A;  3PZ2 A;  1NA3 A;  3QDN A;  4GZ5 A;  5ARG A;  1O1R A;  4GU5 A;  1YYH A;  1NA0 A;  1RZ4 A;  3OPE A;  3NAW A;  1DNP A;  1LTX A;  2H6G A;  3FUN A;  1IYG A;  5KJL A;  5ITZ F;  4I6E A;  1Z3Y A;  3EU5 A;  2LSU A;  3UX4 A;  1HU3 A;  5EX3 A;  4ABN A;  1N54 A;  4WNF A;  3FUH A;  4FUL A;  1SZA A;  2VGE A;  3B7R L;  2OND A;  1W3B A;  4F3V A;  5LSZ A;  5ENN A;  1WDY A;  4XZ4 A;  3R7Q A;  3UKR G;  4ATZ D;  2C2L A;  2Q7F A;  3GYZ A;  4UWG A;  2R05 A;  3U9W A;  1FT1 A;  1PC2 A;  3EJN A;  3GZS A;  1TN8 A;  4CGW A;  2JEK A;  1QBQ A;  4PH4 B;  1BPO A;  4AY5 A;  5DIZ A;  4FHJ A;  4HOS A;  2ZXW E;  3F9Y A;  5HS0 A;  1ZU2 A;  5ARF A;  4W9R A;  3PDN A;  4XX5 A;  3V30 A;  2E0I A;  3M57 A;  2WXL A;  4LDG A;  2CG2 A;  5AEN A;  2VGY A;  3SW9 A;  1SVX A;  1E8W A;  2V8S E;  2HM8 A;  4UI9 C;  3UPV A;  1UJJ A;  1INZ A;  2AJA A;  3T5V A;  3FWV A;  3L13 A;  1IXV A;  4GMR A;  3R9M A;  3PUJ A;  5LCW J;  4U04 A;  2CHW A;  2MOW A;  3HXD A;  5AQB A;  4TUM A;  3ULY A;  4FAD A;  4U07 A;  3DPD A;  3D3M A;  5JIY A;  4YPA A;  2XQ0 A;  3TXM A;  3KS2 A;  5FWQ A;  4BT8 A;  4L23 A;  2BKG A;  2I1J A;  5ENS D;  3T5X A;  5BT1 A;  4AU7 A;  2O8J A;  3W9G A;  2ZGD A;  2DYR E;  3Q15 A;  3PRE A;  2DYS E;  3C3Q A;  4HRM B;  3FTU A;  4ILI A;  4IJ8 A;  3SQV A;  3CVY A;  3BG1 B;  4B0Z A;  4L7T A;  4RQI A;  3V2X A;  3QB2 A;  2XZD G;  2QYU A;  1NFI E;  4QQI A;  3FTV A;  4RVB A;  2UWJ G;  2AWI A;  3OAW A;  4TXR A;  2ETB A;  4YNM A;  4TUU A;  1QZ2 A;  2V0P A;  1MZC A;  2A5E A;  3KMA A;  3ZPJ A;  2X6H A;  3D9J A;  2OV8 A;  4E6H A;  3OTN A;  2L9B A;  4G11 A;  1SA4 A;  5JMN D;  4C1Q A;  5BNW A;  3FH8 A;  2CHX A;  3AAA C;  3Q79 A;  5J08 A;  4KXK B;  4CYM D;  5ANR A;  5A7D B;  2AW6 A;  3W9F A;  3IBE A;  4A3V A;  4XI0 A;  4YDO A;  4C0M A;  2P9N G;  4HB5 A;  3CQC B;  1UW4 B;  2QPW A;  3L9T A;  3MO2 A;  3E34 A;  2FEZ A;  3MYV A;  2H6F A;  4EHM A;  2UY1 B;  4GML A;  1HFA A;  2KZT B;  3M54 A;  4KVM A;  2FO7 A;  1UN9 A;  4AEZ C;  4JA9 A;  1ZB1 A;  2DWZ A;  3NB2 A;  4RLY A;  3KD7 A;  3ASD A;  4MI0 A;  3LEW A;  3B7S A;  4OVU A;  2PNN A;  3PVL A;  1E8Z A;  4J8D A;  4KT6 B;  3FPD A;  3OXL A;  4JEU A;  2PM7 A;  1OCZ E;  4GA1 A;  3ASF A;  2XS1 A;  3UM1 A;  1WM5 A;  3FUI A;  3ABK E;  5T4Y A;  4I1O B;  3TAX A;  4NAC A;  2WXO A;  4AJW A;  5FIO A;  3DSV A;  4DX5 D;  3UUX A;  1JPL A;  4WND A;  3TWV A;  5G2N A;  4JHR A;  2H6I A;  3HXB A;  2AXV A;  3CVU A;  1HE8 A;  4HOT A;  2EIN E;  4G8K A;  3FUJ A;  4F53 A;  1UJK A;  3ZKJ A;  5TH7 A;  3HXC A;  4GA2 A;  2F8Y A;  3IHX A;  1K1A A;  3SBT B;  2GRL A;  2P9U G;  4JLG A;  1X5B A;  4I17 A;  1PAQ A;  4GYO A;  3CHM A;  3C98 A;  3ABL E;  3HVE A;  2DIW A;  4N2Q A;  5AIJ A;  3BQO A;  2IGQ A;  3L17 A;  5KNH D;  4GB9 A;  4JL0 A;  3FUK A;  3LDZ A;  4XEI G;  5CRV A;  1MJ0 A;  5KWD A;  3TL5 A;  1FVF A;  3MV2 B;  4GMJ A;  1MVX A;  3MJW A;  4P29 A;  3N71 A;  3JXI A;  4HBD A;  5JJT A;  5G05 C;  4U7E B;  4U8H A;  4CEM A;  4YDE A;  3JQ0 A;  3E30 A;  1BI8 B;  5FQ8 A;  3L6A A;  4PS8 A;  2NC9 A;  1XQH A;  3E4B A;  3LY7 A;  4WWO A;  2IOS A;  1MYO A;  1NZN A;  2B0O E;  3Q49 B;  4GTT A;  3EHR A;  2Y1L E;  3S7F A;  1B89 A;  4DI3 A;  3DWL G;  4GTM A;  4D10 C;  1QYM A;  3EU9 A;  4E47 A;  3F9Z A;  3Q78 A;  2DZN A;  4ANX A;  3CVW A;  2VJ8 A;  5F6L A;  5JHN A;  2QYJ A;  5FZQ A;  5B1A E;  1NI1 A;  3FEX A;  2M63 A;  4CDM A;  2P9I G;  4XKB A;  3JUE A;  2WXK A;  3O48 A;  4A55 A;  3L22 A;  4U8V D;  5AQ9 A;  4N3C A;  5EX0 A;  2I1K A;  4UI9 J;  3PEU B;  4DLO A;  4B8C B;  3CST A;  1PEG A;  5B1B E;  1HH8 A;  4JVS A;  2ZIS A;  4FU3 A;  3OXG A;  3NOC D;  3ZHE A;  2XEN A;  3OOI A;  2HYZ A;  3PZ3 A; 
#chains in the Genus database with same CATH homology
 2IF4 A;  2R3A A;  3CK8 A;  3MKQ A;  1ELR A;  3RO2 A;  4BY6 A;  2J08 A;  4GCO A;  4EQF A;  4XIF A;  3ZGQ A;  2W5Z A;  3S7B A;  2RFI A;  5EG2 A;  2WXI A;  1KT1 A;  3CVP A;  3MKR A;  5CHE E;  5FQ4 A;  5AJL A;  4J7I A;  4GZ3 A;  4UQY A;  1NA3 A;  4YVQ C;  3APD A;  2YIN A;  5TEG A;  3VLD A;  3QDN A;  3CVX A;  1H6K A;  4JHK A;  3OXF A;  4N39 A;  4GZ5 A;  5ARG A;  4A1G A;  3PS6 A;  4ATG A;  4I1A A;  3D9P A;  4GU5 A;  4GYY A;  1MUF A;  3U3W A;  1NA0 A;  3I4G A;  5BV0 A;  3OPE A;  1TEZ A;  1DNP A;  3VLF A;  3FUN A;  3FTY A;  1IYG A;  3LY9 A;  5LSX A;  5KJL A;  3ONL A;  3JQ1 A;  4I6E A;  4KYO B;  1Z3Y A;  2LSU A;  1OWL A;  4GZC A;  4NUR A;  3MCX A;  3APF A;  1WY6 A;  2IQC A;  3RU0 A;  3UX4 A;  1HU3 A;  5EX3 A;  4XE0 A;  4ABN A;  1N54 A;  4LER A;  4G25 A;  1ZKK A;  3TG4 A;  3G2U A;  3LXU X;  2XGM A;  4WNF A;  3IV0 A;  3M58 A;  3FUH A;  3Q5M A;  4AVX A;  3AU5 A;  5TTF A;  3CK7 A;  4L2L A;  5D0O D;  4FUL A;  3HIZ A;  3CIA A;  1SZA A;  3ZHE B;  1TJF A;  3ONK A;  4IJD A;  5D0Q D;  3B7R L;  3FTW A;  4J8S A;  3ZVV A;  3KMT A;  4KBQ A;  2WMO A;  2OND A;  1W3B A;  2GRM A;  3CHR A;  3MKQ B;  4AOF A;  4F3V A;  1LF8 A;  3M5A A;  3UT7 A;  5T3R A;  5LSZ A;  3IEG A;  5ENN A;  4FJZ A;  3D9O A;  3TJP A;  4J0U A;  2WXH A;  3AS8 A;  4XZ4 A;  5JIN A;  3R7Q A;  2F69 A;  4FLH A;  2PQR A;  3L08 A;  3PEV B;  2WPV A;  1E8Y A;  2C2L A;  4EEC A;  2Q7F A;  2WXQ A;  1IQR A;  3FHE A;  3GYZ A;  4UWG A;  4PDX A;  3U9W A;  2AVP A;  4BSX A;  4BTB A;  4GA0 A;  1PC2 A;  3QAR A;  4C0E A;  3EJN A;  2C0L A;  3GZS A;  4J83 A;  2ILR A;  4CGW A;  2JEK A;  3AU4 A;  3G2T A;  4PH4 B;  2PZI A;  3IHV A;  4I9E A;  2A4Z A;  4MS6 A;  3P2B A;  3R7R A;  2OVB A;  1BPO A;  4DI4 A;  2VSN A;  3HDX A;  2J09 A;  3PNT B;  2X6I A;  1MQS A;  1P5Q A;  4Q94 A;  5DIZ A;  5FJY A;  4BX9 A;  4WWN A;  1ELK A;  4FHJ A;  3ZRH A;  4V3I A;  4HOS A;  1EPU A;  2XEV A;  2YQ8 A;  2BQZ A;  3F9Y A;  3MX3 A;  3DBS A;  3S7D A;  1ZU2 A;  5ARF A;  4W9R A;  4GAA A;  3MV3 B;  3PDN A;  3F9W A;  4ME2 A;  2CHZ A;  2IJG X;  4JPS A;  4WNE A;  3HYM B;  4XX5 A;  4NVQ A;  2GGF A;  3D9M A;  4O30 A;  2E0I A;  1JWG A;  2IU1 A;  2AXU A;  3M57 A;  2XPY A;  4YPE A;  4HXI A;  3VLE A;  1E7U A;  2J49 A;  4GCN A;  3UQ3 A;  2WXL A;  3ZPJ A;  4LDG A;  2FBN A;  2CG2 A;  3GW4 A;  5G04 C;  3F9X A;  5AEN A;  4IRU A;  2VGY A;  3SW9 A;  4LEU A;  2LO6 A;  3P1U A;  3IKO B;  3TXN A;  3UMV A;  4APO A;  4CRW A;  3PZD A;  1S0P A;  4PS7 A;  1E8W A;  2DBA A;  2HM8 A;  2V8S E;  4UI9 C;  5CCL A;  3D9K A;  3UPV A;  5ANL A;  2WXM A;  1E90 A;  1SZ9 A;  1UJJ A;  5AYF A;  4N2S A;  1HG2 A;  1INZ A;  1SQM A;  3AS4 A;  3CHO A;  4JDS A;  1E96 B;  2L6J A;  5A23 A;  3FWV A;  3L13 A;  3T5V A;  3KMJ A;  2WXJ A;  2P58 C;  3WXX A;  3PUJ A;  3CHP A;  5LCW J;  2V4L A;  4U04 A;  4E85 A;  2CHW A;  2VTB A;  2MOW A;  2VSO E;  4HOR A;  2GW1 A;  4NRH B;  1U3C A;  4FA6 A;  4IYP A;  2MRI A;  3GZ2 A;  2FUL A;  3VTX A;  3RQ4 A;  5M72 A;  1YA0 A;  3M56 A;  3CVV A;  5BW8 C;  4FAD A;  2YNQ A;  4FLB A;  4G23 A;  4U07 A;  5F59 A;  1TJC A;  3DPD A;  3D3M A;  4EZJ A;  4YPA A;  1U3D A;  5JIY A;  2XQ0 A;  5KJN A;  3DB5 A;  3RJV A;  2LNI A;  2ZU6 B;  3TXM A;  3KS2 A;  5FWQ A;  4BT8 A;  4L23 A;  3CQG B;  2I1J A;  1OWP A;  3T5X A;  5BT1 A;  5T0M A;  5HQ8 A;  1MHQ A;  4AU7 A;  2QY7 A;  4JC8 A;  3S8P A;  1HF8 A;  2O8J A;  3RAY A;  4PS3 A;  1H2V C;  4K0R A;  3G2S A;  3Q15 A;  3PRE A;  3QNK A;  4U0Z A;  3NQP A;  4Y6W A;  2G46 A;  3SFZ A;  5JJ7 A;  5JHB A;  1NP7 A;  3FTU A;  3QWP A;  3QAQ A;  4ILI A;  4KMO A;  3FU6 A;  3NZS A;  4Q96 A;  4EBA G;  3PNL B;  4IJ8 A;  4U0U A;  5LP0 A;  2X38 A;  3LCA A;  5C1D A;  5DBK A;  4WAF A;  3CVY A;  1DVP A;  2IFU A;  3BG1 B;  3I5P A;  2BTD A;  3MEK A;  4B0Z A;  3LS8 A;  4HOU A;  4L7T A;  4EPZ A;  3RRN B;  2XGS A;  2C0M A;  5BPP A;  3QB2 A;  4G1T A;  2EQX A;  2WM9 A;  1A17 A;  2J4D A;  4PUC A;  2VTB B;  2XPI A;  3CR3 A;  4JHJ A;  3ZXS A;  3B13 A;  3FTV A;  4RVB A;  4CCA A;  2UWJ G;  4TV3 A;  2AWI A;  4I9C A;  3ZYL A;  3OAW A;  3DAL A;  4A3T A;  2A5U A;  4TUU A;  4YNM A;  1QZ2 A;  2LAI A;  5CPR B;  5FZS A;  4N5C A;  1L5J A;  2V0P A;  4RG9 A;  2UY1 A;  3IHY A;  4YNP A;  1EF1 C;  3FH5 A;  3QWV A;  4FJY A;  3URZ A;  1IHG A;  4DPR A;  1QNF A;  1XGW A;  2VSY A;  4KZ0 A;  2J4B A;  4NQ0 A;  3RRM B;  2X6H A;  2WXP A;  3BG0 B;  3D9J A;  3FP3 A;  2KZT A;  4I6J A;  3T8M A;  3ZYM A;  1H3I A;  4RG6 A;  2KM4 A;  1MT6 A;  3G2V A;  2KCV A;  2OV8 A;  3B7T A;  4DLQ A;  5FQ7 A;  3LKU A;  1MVH A;  4E6H A;  2PQN A;  3OTN A;  2L9B A;  4G11 A;  4G24 A;  5BNW A;  4WWP A;  4C1Q A;  3FH8 A;  2YHC A;  2CHX A;  1XNF A;  3SI5 A;  1EDU A;  5J08 A;  4J8F A;  3FUE A;  4KXK B;  1IQU A;  3L16 A;  5ANR A;  5A7D B;  4LUN U;  4N3A A;  1ML9 A;  2AW6 A;  3G2W A;  3IBE A;  1JWF A;  4A3V A;  3CKC A;  4AXH A;  4XI0 A;  4IUL A;  4C0M A;  3B7U X;  3CQC B;  2R59 A;  1UW4 B;  3U4T A;  3I4R B;  3R9A B;  1KT0 A;  2QPW A;  4YND A;  3MO2 A;  2FEZ A;  5G05 J;  4HVB A;  3K5K A;  3FY4 A;  3MYV A;  4Z4P A;  3CK9 A;  4BTA A;  4EZK A;  3ML8 A;  4I6G A;  2WQ7 A;  5C2Y A;  2KCK A;  2VQ2 A;  3FU5 A;  2UY1 B;  4H7Y A;  2W5Y A;  4EBA A;  5JJ6 A;  4GML A;  5E75 A;  3RIB A;  3ZEF A;  3QJZ A;  1HFA A;  2KZT B;  4HS2 A;  4IN3 B;  4ACL A;  4KVM A;  3M54 A;  2FO7 A;  3ZFW A;  4XKC A;  1UN9 A;  4KVO A;  4I51 A;  4AEZ C;  4JA9 A;  4J7F A;  4I2W A;  4L1B A;  3MA5 A;  4H12 A;  3LJ3 A;  4UWH A;  3KD7 A;  3ASD A;  4GZD A;  3U64 A;  4ANV A;  3ZYQ A;  4MI0 A;  4UI9 K;  3NF1 A;  5CMY A;  1OWN A;  3LEW A;  1N3J A;  2X6J A;  2Y4T A;  3B7S A;  4UQX A;  5A6C A;  5T0K A;  4OVU A;  4ANU A;  3FUF A;  3PVL A;  5T8I A;  2XRZ A;  1E8Z A;  4J8D A;  3FFL A;  4KT6 B;  5HI7 A;  3FPD A;  3OXL A;  4A1S A;  4JEU A;  5LCW C;  2XPZ A;  3FDH A;  2PM7 A;  3LYA A;  3QK0 A;  3HHM A;  3CV0 A;  4MI5 A;  3LY8 A;  3ESK A;  4ILH B;  3SBS A;  3KMA A;  3ASG A;  4GA1 A;  3ASF A;  4I43 A;  3BO5 A;  4UQZ A;  4XI9 A;  1FVH A;  4C9B B;  3EP0 A;  2FF4 A;  1E8X A;  4GZ6 A;  1WM5 A;  2BF0 X;  2Y3A A;  1UN8 A;  2WXR A;  2WXN A;  3FUI A;  3D9N A;  3Q47 B;  1N6C A;  3VV0 A;  4JEH A;  5F5E A;  5T4Y A;  2Y4U A;  4I1O B;  4B94 A;  1HXI A;  3TAX A;  4NAC A;  2WXO A;  4LRZ A;  3NZU A;  3QOU A;  3CBM A;  3FEY A;  4F1S A;  3RK6 A;  2HO1 A;  4AJW A;  2XRY A;  3ENE A;  1H0A A;  3QKY A;  2WQ6 A;  4CDN A;  3RKV A;  1FCH A;  1WAO 1;  2WXF A;  3FUL A;  2OVF A;  4I1M A;  3AS5 A;  4CGV A;  3UUX A;  1JPL A;  2BUG A;  4WND A;  3SGH A;  5G2N A;  4HLE A;  3CVN A;  2YHE A;  4CT0 A;  3TGO A;  2X6F A;  5CMW A;  3LPZ A;  3KAE A;  3Q4A B;  4B8A A;  1VDY A;  3CGH A;  4JHR A;  4JW1 A;  4BFR A;  3I3N A;  3K9I A;  4NJ5 A;  2AXV A;  3EIJ A;  1HE8 A;  3CVU A;  4HOT A;  3FUJ A;  4F53 A;  1UJK A;  2WXG A;  4U63 A;  5JJ0 A;  5TH7 A;  3SNX A;  4JA7 A;  4RSY A;  4ANW A;  2VGX A;  4YVO A;  5LFA A;  2L0T B;  4HOQ A;  4QEO A;  4AIF A;  3MO0 A;  3SF4 A;  4Q69 A;  3M59 A;  4BT9 A;  4OVV A;  4GA2 A;  4BX8 A;  3IHX A;  5E76 A;  3PUK A;  4QFV A;  4H7X A;  4AY5 A;  3SBT B;  5JHA A;  2GRL A;  3FU0 A;  3ZYK A;  4MRU A;  1O9S A;  1X5B A;  4JLG A;  2IOL A;  2NXP A;  3EHN A;  2FI7 A;  4I17 A;  2XGO A;  3JUI A;  3UT8 A;  3S2A A;  5LX8 A;  1PAQ A;  2KCL A;  3EHM A;  4GYO A;  3CHM A;  4HFG A;  3C98 A;  2E2E A;  3HVE A;  2J07 A;  1GW6 A;  4QEN A;  2DIW A;  4N2Q A;  3EDT B;  5AIJ A;  2IGQ A;  2AXZ A;  3L17 A;  3UT4 A;  4ACK A;  5AJD A;  4GB9 A;  3U66 A;  4JL0 A;  3FUK A;  4GYW A;  3LDZ A;  4F7A A;  4WUY A;  2I2O A;  2QFC A;  3CBO A;  3FTX A;  1Y8M A;  3RJW A;  4URK A;  5FQ6 A;  4N3B A;  2HR2 A;  3ZIM A;  5BV1 A;  2CFU A;  3TL5 A;  1JUQ A;  1ZBP A;  1N52 A;  1QQE A;  3LVQ E;  4LCT A;  4L2Y A;  3RO3 A;  3RRU A;  3ZW3 A;  2KC7 A;  5EDS A;  1FVF A;  2RD0 A;  3MV2 B;  5EKQ D;  4GMJ A;  1MVX A;  2VGX B;  3M53 A;  2WMN A;  2X6K A;  4DK5 A;  3MJW A;  1Z6T A;  3CSF A;  1H2T C;  4FHK A;  4P29 A;  3MGB A;  3N71 A;  1N6A A;  3QC1 A;  3M55 A;  2CFZ A;  2LAH A;  3L54 A;  5JJT A;  5G05 C;  3FUM A;  4ILG A;  2NSZ A;  4U8H A;  2RG8 A;  4CEM A;  4FC8 A;  3PRZ A;  2R17 C;  5CCM A;  4J8E A;  3TG5 A;  3JQ0 A;  2WB2 A;  5FQ8 A;  3L6A A;  2PM6 A;  4MKT A;  4PS8 A;  2NC9 A;  3ASH A;  2KAT A;  4TRQ A;  1PY1 A;  3VTY A;  4QEP A;  1XQH A;  3EIQ C;  2X3M A;  3SD5 A;  3HVE B;  3ULQ A;  1OWO A;  2XCB A;  3D9L A;  4G26 A;  3E4B A;  3LY7 A;  4WWO A;  2IOS A;  2WQH A;  3FH7 A;  4R7L A;  1NZN A;  3Q49 B;  2J9Q A;  3ESL A;  4YPU A;  4WNG A;  4B89 A;  2JLB A;  3JYS A;  3KEZ A;  4BUP A;  2VSX E;  4AV7 A;  1OWM A;  3S7F A;  4FP7 A;  3BEE A;  3CVQ A;  1UG3 A;  2MHK A;  1B89 A;  2VYI A;  2PL2 A;  3FTS A;  3D9I A;  4K03 A;  5KCM A;  1KLX A;  4DI3 A;  2I9C A;  4D10 C;  4APF A;  4JZY A;  2OOE A;  2WVI A;  1EYH A;  5KJM A;  4E47 A;  3O4Z A;  1E7V A;  3SWC A;  3F9Z A;  3CVL A;  4AM9 A;  4ANX A;  2JV0 A;  3CBP A;  1HG5 A;  3FU3 A;  3LVR E;  1HS6 A;  4UWK A;  3CVW A;  1HX8 A;  2VJ8 A;  3MZL B;  5F6L A;  5AYW D;  5JHN A;  1HZ4 A;  2XCC A;  3CEQ A;  5FZQ A;  3VUZ A;  3CKB A;  4I2Z A;  3PE4 A;  4KZC A;  4RZ0 A;  4AY6 A;  3FEX A;  2ION A;  2I6H A;  4J8O A;  3PE3 A;  2M63 A;  4CT4 A;  4CDR A;  4U0S A;  5G04 J;  5FZR A;  4CDM A;  2V5F A;  3APC A;  4XKB A;  5F6K C;  5G55 A;  5LOZ A;  4JXT A;  4A55 A;  2WXK A;  2XHE A;  3O48 A;  3L22 A;  1ELW A;  5FT9 A;  1Z3X A;  3FUD A;  4N3C A;  4Y6C A;  3MO5 A;  5EX0 A;  2I1K A;  1HO8 A;  4AP2 A;  4UI9 J;  3SHF A;  4DJA A;  1OUV A;  4FMU A;  3GZ1 A;  4MLP A;  2R5S A;  4UWF A;  3S7J A;  3CHS A;  3PEU B;  3CLJ A;  4DLO A;  4EZL A;  4UWL A;  5FTP A;  4B8C B;  5T5G A;  4BWR A;  2L0I A;  5KJK A;  4GPK A;  3CST A;  1PEG A;  3CHQ A;  2LSV A;  5BUZ A;  4G2V A;  1HH8 A;  4JVS A;  3OS5 A;  4O6F A;  5J90 A;  4J6I A;  4FU3 A;  3PH0 C;  3OXG A;  2DCP A;  2CG3 A;  3FTZ A;  3HNA A;  1H19 A;  4M3O A;  3ML9 A;  4OYS A;  3QWW A;  3SZ7 A;  1Y6I A;  3ZHE A;  3JCK C;  3ZN3 A;  3OOI A;  2HYZ A;  1H2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...