4C1QA

Crystal structure of the prdm9 set domain in complex with h3k4me2 and adohcy.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
173
structure length
173
Chain Sequence
AMSQDDDYLYCEKCQNFFIDSCPNHGPPLFVKDSMVDRGHPNHSVLSLPPGLRISPSGIPEAGLGVWNEASDLPVGLHFGPYEGQITEDEEAANSGYSWLITKGRNCYEYVDGQDESQANWMRYVNCARDDEEQNLVAFQYHRKIFYRTCRVIRPGCELLVWYGDEYGQELGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HISTONE-LYSINE N-METHYLTRANSFERASE PRDM9
publication title Molecular Basis for the Regulation of the H3K4 Methyltransferase Activity of Prdm9.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/peptide
total genus 43
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4c1qA00
3SW9A 5LSXA 5KJKA 3M5AA 2RFIA 4NJ5A 2O8JA 1MUFA 1MT6A 5AYFA 4JDSA 2JV0A 4J83A 5KJMA 3DB5A 4NVQA 5TH7A 3S7BA 5HI7A 4C1QA 1MVHA 3DALA 5EX0A 3F9WA 3MEKA 3N71A 5EG2A 5ARGA 4IJ8A 4J8OA 5T0MA 4E47A 5HQ8A 4LDGA 2G46A 3M57A 5F59A 3OOIA 3VV0A 3MO2A 5KJNA 3M59A 3RU0A 3OPEA 3OXGA 3KMJA 4AU7A 2W5ZA 1ML9A 3KMTA 4O6FA 2F69A 3EP0A 4YNPA 5T0KA 3TG4A 3RQ4A 4BUPA 5T5GA 5TEGA 5F6KC 4YPEA 3M54A 3BO5A 2R3AA 4YNDA 5CCLA 3QWVA 5ARFA 4RZ0A 5JJ0A 3S7DA 2IGQA 1PEGA 3VUZA 3CBPA 1H3IA 5CCMA 4J7IA 3CBOA 1N6AA 3OXLA 4YNMA 3S8PA 3F9ZA 4I51A 3M58A 1ZKKA 3FPDA 3M56A 3TG5A 1N3JA 4IJDA 2W5YA 4O30A 5JIYA 3RIBA 3SWCA 3RJWA 4QEOA 3PDNA 4Z4PA 4QEPA 3OS5A 3M55A 4YPAA 5EX3A 3RAYA 4FMUA 3HNAA 3CBMA 4MI0A 3MO0A 3K5KA 5JHNA 3MO5A 3KMAA 5TTFA 1XQHA 3IHXA 1MVXA 4YPUA 3QWPA 4WUYA 3S7FA 2QPWA 4JLGA 4QENA 3F9XA 1O9SA 2BQZA 5JINA 5CPRB 5LSZA 3OXFA 5F6LA 3M53A 5KJLA 1N6CA 4J7FA 3F9YA 3QWWA 5F5EA 4H12A 3S7JA 4MI5A
chains in the Genus database with same CATH superfamily
3SW9A 5LSXA 5KJKA 3M5AA 2RFIA 4NJ5A 2O8JA 1MUFA 1MT6A 5AYFA 4JDSA 2JV0A 4J83A 5KJMA 3DB5A 4NVQA 5TH7A 3S7BA 5HI7A 4C1QA 1MVHA 3DALA 5EX0A 3F9WA 3MEKA 3N71A 5EG2A 5ARGA 4IJ8A 4J8OA 5T0MA 4E47A 5HQ8A 4LDGA 2G46A 3M57A 5F59A 3OOIA 3VV0A 3MO2A 5KJNA 3M59A 3RU0A 3OPEA 3OXGA 3KMJA 4AU7A 2W5ZA 1ML9A 3KMTA 4O6FA 2F69A 3EP0A 4YNPA 5T0KA 3TG4A 3RQ4A 4BUPA 5T5GA 5TEGA 5F6KC 4YPEA 3M54A 3BO5A 2R3AA 4YNDA 5CCLA 3QWVA 5ARFA 4RZ0A 5JJ0A 3S7DA 2IGQA 1PEGA 3VUZA 3CBPA 1H3IA 5CCMA 4J7IA 3CBOA 1N6AA 3OXLA 4YNMA 3S8PA 3F9ZA 4I51A 3M58A 1ZKKA 3FPDA 3M56A 3TG5A 1N3JA 4IJDA 2W5YA 4O30A 5JIYA 3RIBA 3SWCA 3RJWA 4QEOA 3PDNA 4Z4PA 4QEPA 3OS5A 3M55A 4YPAA 5EX3A 3RAYA 4FMUA 3HNAA 3CBMA 4MI0A 3MO0A 3K5KA 5JHNA 3MO5A 3KMAA 5TTFA 1XQHA 3IHXA 1MVXA 4YPUA 3QWPA 4WUYA 3S7FA 2QPWA 4JLGA 4QENA 3F9XA 1O9SA 2BQZA 5JINA 5CPRB 5LSZA 3OXFA 5F6LA 3M53A 5KJLA 1N6CA 4J7FA 3F9YA 3QWWA 5F5EA 4H12A 3S7JA 4MI5A
chains in the Genus database with same CATH topology
3SW9A 5LSXA 5KJKA 3M5AA 2RFIA 4NJ5A 2O8JA 1MUFA 1MT6A 5AYFA 4JDSA 2JV0A 4J83A 5KJMA 3DB5A 4NVQA 5TH7A 3S7BA 5HI7A 4C1QA 1MVHA 3DALA 5EX0A 3F9WA 3MEKA 3N71A 5EG2A 5ARGA 4IJ8A 4J8OA 5T0MA 4E47A 5HQ8A 4LDGA 2G46A 3M57A 5F59A 3OOIA 3VV0A 3MO2A 5KJNA 3M59A 3RU0A 3OPEA 3OXGA 3KMJA 4AU7A 2W5ZA 1ML9A 3KMTA 4O6FA 2F69A 3EP0A 4YNPA 5T0KA 3TG4A 3RQ4A 4BUPA 5T5GA 5TEGA 5F6KC 4YPEA 3M54A 3BO5A 2R3AA 4YNDA 5CCLA 3QWVA 5ARFA 4RZ0A 5JJ0A 3S7DA 2IGQA 1PEGA 3VUZA 3CBPA 1H3IA 5CCMA 4J7IA 3CBOA 1N6AA 3OXLA 4YNMA 3S8PA 3F9ZA 4I51A 3M58A 1ZKKA 3FPDA 3M56A 3TG5A 1N3JA 4IJDA 2W5YA 4O30A 5JIYA 3RIBA 3SWCA 3RJWA 4QEOA 3PDNA 4Z4PA 4QEPA 3OS5A 3M55A 4YPAA 5EX3A 3RAYA 4FMUA 3HNAA 3CBMA 4MI0A 3MO0A 3K5KA 5JHNA 3MO5A 3KMAA 5TTFA 1XQHA 3IHXA 1MVXA 4YPUA 3QWPA 4WUYA 3S7FA 2QPWA 4JLGA 4QENA 3F9XA 1O9SA 2BQZA 5JINA 5CPRB 5LSZA 3OXFA 5F6LA 3M53A 5KJLA 1N6CA 4J7FA 3F9YA 3QWWA 5F5EA 4H12A 3S7JA 4MI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SW9 A;  5LSX A;  5KJK A;  3M5A A;  2RFI A;  4NJ5 A;  2O8J A;  1MUF A;  1MT6 A;  5AYF A;  4JDS A;  2JV0 A;  4J83 A;  5KJM A;  3DB5 A;  4NVQ A;  5TH7 A;  3S7B A;  5HI7 A;  4C1Q A;  1MVH A;  3DAL A;  5EX0 A;  3F9W A;  3MEK A;  3N71 A;  5EG2 A;  5ARG A;  4IJ8 A;  4J8O A;  5T0M A;  4E47 A;  5HQ8 A;  4LDG A;  2G46 A;  3M57 A;  5F59 A;  3OOI A;  3VV0 A;  3MO2 A;  5KJN A;  3M59 A;  3RU0 A;  3OPE A;  3OXG A;  3KMJ A;  4AU7 A;  2W5Z A;  1ML9 A;  3KMT A;  4O6F A;  2F69 A;  3EP0 A;  4YNP A;  5T0K A;  3TG4 A;  3RQ4 A;  4BUP A;  5T5G A;  5TEG A;  5F6K C;  4YPE A;  3M54 A;  3BO5 A;  2R3A A;  4YND A;  5CCL A;  3QWV A;  5ARF A;  4RZ0 A;  5JJ0 A;  3S7D A;  2IGQ A;  1PEG A;  3VUZ A;  3CBP A;  1H3I A;  5CCM A;  4J7I A;  3CBO A;  1N6A A;  3OXL A;  4YNM A;  3S8P A;  3F9Z A;  4I51 A;  3M58 A;  1ZKK A;  3FPD A;  3M56 A;  3TG5 A;  1N3J A;  4IJD A;  2W5Y A;  4O30 A;  5JIY A;  3RIB A;  3SWC A;  3RJW A;  4QEO A;  3PDN A;  4Z4P A;  4QEP A;  3OS5 A;  3M55 A;  4YPA A;  5EX3 A;  3RAY A;  4FMU A;  3HNA A;  3CBM A;  4MI0 A;  3MO0 A;  3K5K A;  5JHN A;  3MO5 A;  3KMA A;  5TTF A;  1XQH A;  3IHX A;  1MVX A;  4YPU A;  3QWP A;  4WUY A;  3S7F A;  2QPW A;  4JLG A;  4QEN A;  3F9X A;  1O9S A;  2BQZ A;  5JIN A;  5CPR B;  5LSZ A;  3OXF A;  5F6L A;  3M53 A;  5KJL A;  1N6C A;  4J7F A;  3F9Y A;  3QWW A;  5F5E A;  4H12 A;  3S7J A;  4MI5 A; 
#chains in the Genus database with same CATH topology
 3SW9 A;  5LSX A;  5KJK A;  3M5A A;  2RFI A;  4NJ5 A;  2O8J A;  1MUF A;  1MT6 A;  5AYF A;  4JDS A;  2JV0 A;  4J83 A;  5KJM A;  3DB5 A;  4NVQ A;  5TH7 A;  3S7B A;  5HI7 A;  4C1Q A;  1MVH A;  3DAL A;  5EX0 A;  3F9W A;  3MEK A;  3N71 A;  5EG2 A;  5ARG A;  4IJ8 A;  4J8O A;  5T0M A;  4E47 A;  5HQ8 A;  4LDG A;  2G46 A;  3M57 A;  5F59 A;  3OOI A;  3VV0 A;  3MO2 A;  5KJN A;  3M59 A;  3RU0 A;  3OPE A;  3OXG A;  3KMJ A;  4AU7 A;  2W5Z A;  1ML9 A;  3KMT A;  4O6F A;  2F69 A;  3EP0 A;  4YNP A;  5T0K A;  3TG4 A;  3RQ4 A;  4BUP A;  5T5G A;  5TEG A;  5F6K C;  4YPE A;  3M54 A;  3BO5 A;  2R3A A;  4YND A;  5CCL A;  3QWV A;  5ARF A;  4RZ0 A;  5JJ0 A;  3S7D A;  2IGQ A;  1PEG A;  3VUZ A;  3CBP A;  1H3I A;  5CCM A;  4J7I A;  3CBO A;  1N6A A;  3OXL A;  4YNM A;  3S8P A;  3F9Z A;  4I51 A;  3M58 A;  1ZKK A;  3FPD A;  3M56 A;  3TG5 A;  1N3J A;  4IJD A;  2W5Y A;  4O30 A;  5JIY A;  3RIB A;  3SWC A;  3RJW A;  4QEO A;  3PDN A;  4Z4P A;  4QEP A;  3OS5 A;  3M55 A;  4YPA A;  5EX3 A;  3RAY A;  4FMU A;  3HNA A;  3CBM A;  4MI0 A;  3MO0 A;  3K5K A;  5JHN A;  3MO5 A;  3KMA A;  5TTF A;  1XQH A;  3IHX A;  1MVX A;  4YPU A;  3QWP A;  4WUY A;  3S7F A;  2QPW A;  4JLG A;  4QEN A;  3F9X A;  1O9S A;  2BQZ A;  5JIN A;  5CPR B;  5LSZ A;  3OXF A;  5F6L A;  3M53 A;  5KJL A;  1N6C A;  4J7F A;  3F9Y A;  3QWW A;  5F5E A;  4H12 A;  3S7J A;  4MI5 A; 
#chains in the Genus database with same CATH homology
 3SW9 A;  5LSX A;  5KJK A;  3M5A A;  2RFI A;  4NJ5 A;  2O8J A;  1MUF A;  1MT6 A;  5AYF A;  4JDS A;  2JV0 A;  4J83 A;  5KJM A;  3DB5 A;  4NVQ A;  5TH7 A;  3S7B A;  5HI7 A;  4C1Q A;  1MVH A;  3DAL A;  5EX0 A;  3F9W A;  3MEK A;  3N71 A;  5EG2 A;  5ARG A;  4IJ8 A;  4J8O A;  5T0M A;  4E47 A;  5HQ8 A;  4LDG A;  2G46 A;  3M57 A;  5F59 A;  3OOI A;  3VV0 A;  3MO2 A;  5KJN A;  3M59 A;  3RU0 A;  3OPE A;  3OXG A;  3KMJ A;  4AU7 A;  2W5Z A;  1ML9 A;  3KMT A;  4O6F A;  2F69 A;  3EP0 A;  4YNP A;  5T0K A;  3TG4 A;  3RQ4 A;  4BUP A;  5T5G A;  5TEG A;  5F6K C;  4YPE A;  3M54 A;  3BO5 A;  2R3A A;  4YND A;  5CCL A;  3QWV A;  5ARF A;  4RZ0 A;  5JJ0 A;  3S7D A;  2IGQ A;  1PEG A;  3VUZ A;  3CBP A;  1H3I A;  5CCM A;  4J7I A;  3CBO A;  1N6A A;  3OXL A;  4YNM A;  3S8P A;  3F9Z A;  4I51 A;  3M58 A;  1ZKK A;  3FPD A;  3M56 A;  3TG5 A;  1N3J A;  4IJD A;  2W5Y A;  4O30 A;  5JIY A;  3RIB A;  3SWC A;  3RJW A;  4QEO A;  3PDN A;  4Z4P A;  4QEP A;  3OS5 A;  3M55 A;  4YPA A;  5EX3 A;  3RAY A;  4FMU A;  3HNA A;  3CBM A;  4MI0 A;  3MO0 A;  3K5K A;  5JHN A;  3MO5 A;  3KMA A;  5TTF A;  1XQH A;  3IHX A;  1MVX A;  4YPU A;  3QWP A;  4WUY A;  3S7F A;  2QPW A;  4JLG A;  4QEN A;  3F9X A;  1O9S A;  2BQZ A;  5JIN A;  5CPR B;  5LSZ A;  3OXF A;  5F6L A;  3M53 A;  5KJL A;  1N6C A;  4J7F A;  3F9Y A;  3QWW A;  5F5E A;  4H12 A;  3S7J A;  4MI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...