4C1QA

Crystal structure of the prdm9 set domain in complex with h3k4me2 and adohcy.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
173
structure length
173
Chain Sequence
AMSQDDDYLYCEKCQNFFIDSCPNHGPPLFVKDSMVDRGHPNHSVLSLPPGLRISPSGIPEAGLGVWNEASDLPVGLHFGPYEGQITEDEEAANSGYSWLITKGRNCYEYVDGQDESQANWMRYVNCARDDEEQNLVAFQYHRKIFYRTCRVIRPGCELLVWYGDEYGQELGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Basis for the Regulation of the H3K4 Methyltransferase Activity of Prdm9.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/peptide
molecule keywords HISTONE-LYSINE N-METHYLTRANSFERASE PRDM9
total genus 43
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4c1qA00
4NJ5A 1PEGA 4IJ8A 5LSXA 3CBMA 2JV0A 3M54A 4MI5A 4QENA 3M59A 3BO5A 3S7FA 3OXFA 5JHNA 3PDNA 5F59A 3S7DA 4QEPA 3QWWA 2BQZA 3OOIA 4J7IA 5TEGA 2QPWA 3OXGA 4O30A 5F6KC 3DALA 1ML9A 1XQHA 5EX3A 3F9ZA 4RZ0A 5KJLA 3MO2A 1N3JA 4YNMA 3VUZA 3CBPA 3M55A 3S7BA 3VV0A 4WUYA 5CPRB 3M5AA 5F5EA 3MEKA 3RQ4A 2R3AA 4FMUA 2F69A 5HI7A 4YNDA 3TG4A 2IGQA 4MI0A 5ARFA 4YPUA 1N6AA 4YPAA 5EX0A 5JINA 3M58A 4J8OA 3S7JA 4JLGA 3RJWA 5ARGA 5F6LA 3MO0A 3MO5A 3HNAA 4C1QA 4YNPA 3SWCA 4QEOA 3OXLA 5LSZA 4I51A 1MVHA 5T5GA 5TTFA 3RAYA 5CCMA 2W5ZA 4YPEA 4JDSA 5TH7A 2O8JA 1MT6A 3F9XA 4BUPA 2RFIA 3EP0A 3M53A 3OPEA 5JJ0A 1MVXA 2W5YA 3F9WA 3S8PA 1H3IA 4H12A 5AYFA 5CCLA 2G46A 1MUFA 3FPDA 5KJKA 3OS5A 5T0KA 3KMJA 3M56A 1O9SA 4LDGA 3KMAA 4AU7A 4IJDA 3RIBA 1N6CA 3KMTA 3IHXA 5KJNA 4J7FA 4O6FA 3K5KA 3CBOA 5JIYA 1ZKKA 4NVQA 3RU0A 3QWPA 5EG2A 3DB5A 3QWVA 3SW9A 4E47A 3M57A 4J83A 3F9YA 5T0MA 3TG5A 3N71A 5KJMA 4Z4PA 5HQ8A
chains in the Genus database with same CATH superfamily
4NJ5A 1PEGA 4IJ8A 5LSXA 3CBMA 2JV0A 3M54A 4MI5A 4QENA 3M59A 3BO5A 3S7FA 3OXFA 5JHNA 3PDNA 5F59A 3S7DA 4QEPA 3QWWA 2BQZA 3OOIA 4J7IA 5TEGA 2QPWA 3OXGA 4O30A 5F6KC 3DALA 1ML9A 1XQHA 5EX3A 3F9ZA 4RZ0A 5KJLA 3MO2A 1N3JA 4YNMA 3VUZA 3CBPA 3M55A 3S7BA 3VV0A 4WUYA 5CPRB 3M5AA 5F5EA 3MEKA 3RQ4A 2R3AA 4FMUA 2F69A 5HI7A 4YNDA 3TG4A 2IGQA 4MI0A 5ARFA 4YPUA 1N6AA 4YPAA 5EX0A 5JINA 3M58A 4J8OA 3S7JA 4JLGA 3RJWA 5ARGA 5F6LA 3MO0A 3MO5A 3HNAA 4C1QA 4YNPA 3SWCA 4QEOA 3OXLA 5LSZA 4I51A 1MVHA 5T5GA 5TTFA 3RAYA 5CCMA 2W5ZA 4YPEA 4JDSA 5TH7A 2O8JA 1MT6A 3F9XA 4BUPA 2RFIA 3EP0A 3M53A 3OPEA 5JJ0A 1MVXA 2W5YA 3F9WA 3S8PA 1H3IA 4H12A 5AYFA 5CCLA 2G46A 1MUFA 3FPDA 5KJKA 3OS5A 5T0KA 3KMJA 3M56A 1O9SA 4LDGA 3KMAA 4AU7A 4IJDA 3RIBA 1N6CA 3KMTA 3IHXA 5KJNA 4J7FA 4O6FA 3K5KA 3CBOA 5JIYA 1ZKKA 4NVQA 3RU0A 3QWPA 5EG2A 3DB5A 3QWVA 3SW9A 4E47A 3M57A 4J83A 3F9YA 5T0MA 3TG5A 3N71A 5KJMA 4Z4PA 5HQ8A
chains in the Genus database with same CATH topology
4NJ5A 1PEGA 4IJ8A 5LSXA 3CBMA 2JV0A 3M54A 4MI5A 4QENA 3M59A 3BO5A 3S7FA 3OXFA 5JHNA 3PDNA 5F59A 3S7DA 4QEPA 3QWWA 2BQZA 3OOIA 4J7IA 5TEGA 2QPWA 3OXGA 4O30A 5F6KC 3DALA 1ML9A 1XQHA 5EX3A 3F9ZA 4RZ0A 5KJLA 3MO2A 1N3JA 4YNMA 3VUZA 3CBPA 3M55A 3S7BA 3VV0A 4WUYA 5CPRB 3M5AA 5F5EA 3MEKA 3RQ4A 2R3AA 4FMUA 2F69A 5HI7A 4YNDA 3TG4A 2IGQA 4MI0A 5ARFA 4YPUA 1N6AA 4YPAA 5EX0A 5JINA 3M58A 4J8OA 3S7JA 4JLGA 3RJWA 5ARGA 5F6LA 3MO0A 3MO5A 3HNAA 4C1QA 4YNPA 3SWCA 4QEOA 3OXLA 5LSZA 4I51A 1MVHA 5T5GA 5TTFA 3RAYA 5CCMA 2W5ZA 4YPEA 4JDSA 5TH7A 2O8JA 1MT6A 3F9XA 4BUPA 2RFIA 3EP0A 3M53A 3OPEA 5JJ0A 1MVXA 2W5YA 3F9WA 3S8PA 1H3IA 4H12A 5AYFA 5CCLA 2G46A 1MUFA 3FPDA 5KJKA 3OS5A 5T0KA 3KMJA 3M56A 1O9SA 4LDGA 3KMAA 4AU7A 4IJDA 3RIBA 1N6CA 3KMTA 3IHXA 5KJNA 4J7FA 4O6FA 3K5KA 3CBOA 5JIYA 1ZKKA 4NVQA 3RU0A 3QWPA 5EG2A 3DB5A 3QWVA 3SW9A 4E47A 3M57A 4J83A 3F9YA 5T0MA 3TG5A 3N71A 5KJMA 4Z4PA 5HQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NJ5 A;  1PEG A;  4IJ8 A;  5LSX A;  3CBM A;  2JV0 A;  3M54 A;  4MI5 A;  4QEN A;  3M59 A;  3BO5 A;  3S7F A;  3OXF A;  5JHN A;  3PDN A;  5F59 A;  3S7D A;  4QEP A;  3QWW A;  2BQZ A;  3OOI A;  4J7I A;  5TEG A;  2QPW A;  3OXG A;  4O30 A;  5F6K C;  3DAL A;  1ML9 A;  1XQH A;  5EX3 A;  3F9Z A;  4RZ0 A;  5KJL A;  3MO2 A;  1N3J A;  4YNM A;  3VUZ A;  3CBP A;  3M55 A;  3S7B A;  3VV0 A;  4WUY A;  5CPR B;  3M5A A;  5F5E A;  3MEK A;  3RQ4 A;  2R3A A;  4FMU A;  2F69 A;  5HI7 A;  4YND A;  3TG4 A;  2IGQ A;  4MI0 A;  5ARF A;  4YPU A;  1N6A A;  4YPA A;  5EX0 A;  5JIN A;  3M58 A;  4J8O A;  3S7J A;  4JLG A;  3RJW A;  5ARG A;  5F6L A;  3MO0 A;  3MO5 A;  3HNA A;  4C1Q A;  4YNP A;  3SWC A;  4QEO A;  3OXL A;  5LSZ A;  4I51 A;  1MVH A;  5T5G A;  5TTF A;  3RAY A;  5CCM A;  2W5Z A;  4YPE A;  4JDS A;  5TH7 A;  2O8J A;  1MT6 A;  3F9X A;  4BUP A;  2RFI A;  3EP0 A;  3M53 A;  3OPE A;  5JJ0 A;  1MVX A;  2W5Y A;  3F9W A;  3S8P A;  1H3I A;  4H12 A;  5AYF A;  5CCL A;  2G46 A;  1MUF A;  3FPD A;  5KJK A;  3OS5 A;  5T0K A;  3KMJ A;  3M56 A;  1O9S A;  4LDG A;  3KMA A;  4AU7 A;  4IJD A;  3RIB A;  1N6C A;  3KMT A;  3IHX A;  5KJN A;  4J7F A;  4O6F A;  3K5K A;  3CBO A;  5JIY A;  1ZKK A;  4NVQ A;  3RU0 A;  3QWP A;  5EG2 A;  3DB5 A;  3QWV A;  3SW9 A;  4E47 A;  3M57 A;  4J83 A;  3F9Y A;  5T0M A;  3TG5 A;  3N71 A;  5KJM A;  4Z4P A;  5HQ8 A; 
#chains in the Genus database with same CATH topology
 4NJ5 A;  1PEG A;  4IJ8 A;  5LSX A;  3CBM A;  2JV0 A;  3M54 A;  4MI5 A;  4QEN A;  3M59 A;  3BO5 A;  3S7F A;  3OXF A;  5JHN A;  3PDN A;  5F59 A;  3S7D A;  4QEP A;  3QWW A;  2BQZ A;  3OOI A;  4J7I A;  5TEG A;  2QPW A;  3OXG A;  4O30 A;  5F6K C;  3DAL A;  1ML9 A;  1XQH A;  5EX3 A;  3F9Z A;  4RZ0 A;  5KJL A;  3MO2 A;  1N3J A;  4YNM A;  3VUZ A;  3CBP A;  3M55 A;  3S7B A;  3VV0 A;  4WUY A;  5CPR B;  3M5A A;  5F5E A;  3MEK A;  3RQ4 A;  2R3A A;  4FMU A;  2F69 A;  5HI7 A;  4YND A;  3TG4 A;  2IGQ A;  4MI0 A;  5ARF A;  4YPU A;  1N6A A;  4YPA A;  5EX0 A;  5JIN A;  3M58 A;  4J8O A;  3S7J A;  4JLG A;  3RJW A;  5ARG A;  5F6L A;  3MO0 A;  3MO5 A;  3HNA A;  4C1Q A;  4YNP A;  3SWC A;  4QEO A;  3OXL A;  5LSZ A;  4I51 A;  1MVH A;  5T5G A;  5TTF A;  3RAY A;  5CCM A;  2W5Z A;  4YPE A;  4JDS A;  5TH7 A;  2O8J A;  1MT6 A;  3F9X A;  4BUP A;  2RFI A;  3EP0 A;  3M53 A;  3OPE A;  5JJ0 A;  1MVX A;  2W5Y A;  3F9W A;  3S8P A;  1H3I A;  4H12 A;  5AYF A;  5CCL A;  2G46 A;  1MUF A;  3FPD A;  5KJK A;  3OS5 A;  5T0K A;  3KMJ A;  3M56 A;  1O9S A;  4LDG A;  3KMA A;  4AU7 A;  4IJD A;  3RIB A;  1N6C A;  3KMT A;  3IHX A;  5KJN A;  4J7F A;  4O6F A;  3K5K A;  3CBO A;  5JIY A;  1ZKK A;  4NVQ A;  3RU0 A;  3QWP A;  5EG2 A;  3DB5 A;  3QWV A;  3SW9 A;  4E47 A;  3M57 A;  4J83 A;  3F9Y A;  5T0M A;  3TG5 A;  3N71 A;  5KJM A;  4Z4P A;  5HQ8 A; 
#chains in the Genus database with same CATH homology
 4NJ5 A;  1PEG A;  4IJ8 A;  5LSX A;  3CBM A;  2JV0 A;  3M54 A;  4MI5 A;  4QEN A;  3M59 A;  3BO5 A;  3S7F A;  3OXF A;  5JHN A;  3PDN A;  5F59 A;  3S7D A;  4QEP A;  3QWW A;  2BQZ A;  3OOI A;  4J7I A;  5TEG A;  2QPW A;  3OXG A;  4O30 A;  5F6K C;  3DAL A;  1ML9 A;  1XQH A;  5EX3 A;  3F9Z A;  4RZ0 A;  5KJL A;  3MO2 A;  1N3J A;  4YNM A;  3VUZ A;  3CBP A;  3M55 A;  3S7B A;  3VV0 A;  4WUY A;  5CPR B;  3M5A A;  5F5E A;  3MEK A;  3RQ4 A;  2R3A A;  4FMU A;  2F69 A;  5HI7 A;  4YND A;  3TG4 A;  2IGQ A;  4MI0 A;  5ARF A;  4YPU A;  1N6A A;  4YPA A;  5EX0 A;  5JIN A;  3M58 A;  4J8O A;  3S7J A;  4JLG A;  3RJW A;  5ARG A;  5F6L A;  3MO0 A;  3MO5 A;  3HNA A;  4C1Q A;  4YNP A;  3SWC A;  4QEO A;  3OXL A;  5LSZ A;  4I51 A;  1MVH A;  5T5G A;  5TTF A;  3RAY A;  5CCM A;  2W5Z A;  4YPE A;  4JDS A;  5TH7 A;  2O8J A;  1MT6 A;  3F9X A;  4BUP A;  2RFI A;  3EP0 A;  3M53 A;  3OPE A;  5JJ0 A;  1MVX A;  2W5Y A;  3F9W A;  3S8P A;  1H3I A;  4H12 A;  5AYF A;  5CCL A;  2G46 A;  1MUF A;  3FPD A;  5KJK A;  3OS5 A;  5T0K A;  3KMJ A;  3M56 A;  1O9S A;  4LDG A;  3KMA A;  4AU7 A;  4IJD A;  3RIB A;  1N6C A;  3KMT A;  3IHX A;  5KJN A;  4J7F A;  4O6F A;  3K5K A;  3CBO A;  5JIY A;  1ZKK A;  4NVQ A;  3RU0 A;  3QWP A;  5EG2 A;  3DB5 A;  3QWV A;  3SW9 A;  4E47 A;  3M57 A;  4J83 A;  3F9Y A;  5T0M A;  3TG5 A;  3N71 A;  5KJM A;  4Z4P A;  5HQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...