4C1QA

Crystal structure of the prdm9 set domain in complex with h3k4me2 and adohcy.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
173
structure length
173
Chain Sequence
AMSQDDDYLYCEKCQNFFIDSCPNHGPPLFVKDSMVDRGHPNHSVLSLPPGLRISPSGIPEAGLGVWNEASDLPVGLHFGPYEGQITEDEEAANSGYSWLITKGRNCYEYVDGQDESQANWMRYVNCARDDEEQNLVAFQYHRKIFYRTCRVIRPGCELLVWYGDEYGQELGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HISTONE-LYSINE N-METHYLTRANSFERASE PRDM9
publication title Molecular Basis for the Regulation of the H3K4 Methyltransferase Activity of Prdm9.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/peptide
total genus 43
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4c1qA00
4J8OA 3MO2A 4J7IA 3VUZA 3KMAA 5TEGA 4Z4PA 3QWVA 5ARFA 3SW9A 1O9SA 3FPDA 5CCLA 3K5KA 4C1QA 3N71A 5KJLA 4H12A 1MUFA 5CCMA 4MI5A 1ML9A 3RIBA 3RQ4A 3VV0A 1MT6A 4QENA 5TTFA 2W5YA 3M59A 1H3IA 3S7FA 4YPEA 5LSZA 5EG2A 5F6KC 5T0KA 5JIYA 3OPEA 3OXGA 5ARGA 3F9XA 2F69A 5LSXA 4O30A 5EX3A 3MO0A 3F9YA 3TG4A 4JLGA 3IHXA 3RJWA 3DALA 4YNDA 3M57A 4IJDA 4IJ8A 4RZ0A 4YNMA 3QWWA 3QWPA 3S7JA 4WUYA 3M5AA 5JINA 2O8JA 4AU7A 3M55A 3TG5A 3OS5A 4YNPA 2QPWA 4FMUA 1PEGA 4QEPA 4QEOA 5HQ8A 5T0MA 3OXLA 1N6CA 3MEKA 5JHNA 1ZKKA 3SWCA 5HI7A 4MI0A 5F6LA 3HNAA 3F9WA 2IGQA 3CBOA 5KJNA 4JDSA 4BUPA 3M54A 3CBPA 3M53A 1N3JA 2G46A 5F5EA 2W5ZA 4YPUA 3DB5A 5CPRB 3CBMA 2RFIA 3M56A 4J83A 5T5GA 2BQZA 3MO5A 3RU0A 5KJMA 3PDNA 3OOIA 1XQHA 4J7FA 1N6AA 3KMTA 2JV0A 3S7DA 4O6FA 3S8PA 4NJ5A 3EP0A 3M58A 3KMJA 3S7BA 3F9ZA 3OXFA 4YPAA 5EX0A 2R3AA 4NVQA 1MVXA 1MVHA 4LDGA 3RAYA 3BO5A 4I51A 5TH7A 5KJKA 5F59A 5JJ0A 4E47A 5AYFA
chains in the Genus database with same CATH superfamily
4J8OA 3MO2A 4J7IA 3VUZA 3KMAA 5TEGA 4Z4PA 3QWVA 5ARFA 3SW9A 1O9SA 3FPDA 5CCLA 3K5KA 4C1QA 3N71A 5KJLA 4H12A 1MUFA 5CCMA 4MI5A 1ML9A 3RIBA 3RQ4A 3VV0A 1MT6A 4QENA 5TTFA 2W5YA 3M59A 1H3IA 3S7FA 4YPEA 5LSZA 5EG2A 5F6KC 5T0KA 5JIYA 3OPEA 3OXGA 5ARGA 3F9XA 2F69A 5LSXA 4O30A 5EX3A 3MO0A 3F9YA 3TG4A 4JLGA 3IHXA 3RJWA 3DALA 4YNDA 3M57A 4IJDA 4IJ8A 4RZ0A 4YNMA 3QWWA 3QWPA 3S7JA 4WUYA 3M5AA 5JINA 2O8JA 4AU7A 3M55A 3TG5A 3OS5A 4YNPA 2QPWA 4FMUA 1PEGA 4QEPA 4QEOA 5HQ8A 5T0MA 3OXLA 1N6CA 3MEKA 5JHNA 1ZKKA 3SWCA 5HI7A 4MI0A 5F6LA 3HNAA 3F9WA 2IGQA 3CBOA 5KJNA 4JDSA 4BUPA 3M54A 3CBPA 3M53A 1N3JA 2G46A 5F5EA 2W5ZA 4YPUA 3DB5A 5CPRB 3CBMA 2RFIA 3M56A 4J83A 5T5GA 2BQZA 3MO5A 3RU0A 5KJMA 3PDNA 3OOIA 1XQHA 4J7FA 1N6AA 3KMTA 2JV0A 3S7DA 4O6FA 3S8PA 4NJ5A 3EP0A 3M58A 3KMJA 3S7BA 3F9ZA 3OXFA 4YPAA 5EX0A 2R3AA 4NVQA 1MVXA 1MVHA 4LDGA 3RAYA 3BO5A 4I51A 5TH7A 5KJKA 5F59A 5JJ0A 4E47A 5AYFA
chains in the Genus database with same CATH topology
4J8OA 3MO2A 4J7IA 3VUZA 3KMAA 5TEGA 4Z4PA 3QWVA 5ARFA 3SW9A 1O9SA 3FPDA 5CCLA 3K5KA 4C1QA 3N71A 5KJLA 4H12A 1MUFA 5CCMA 4MI5A 1ML9A 3RIBA 3RQ4A 3VV0A 1MT6A 4QENA 5TTFA 2W5YA 3M59A 1H3IA 3S7FA 4YPEA 5LSZA 5EG2A 5F6KC 5T0KA 5JIYA 3OPEA 3OXGA 5ARGA 3F9XA 2F69A 5LSXA 4O30A 5EX3A 3MO0A 3F9YA 3TG4A 4JLGA 3IHXA 3RJWA 3DALA 4YNDA 3M57A 4IJDA 4IJ8A 4RZ0A 4YNMA 3QWWA 3QWPA 3S7JA 4WUYA 3M5AA 5JINA 2O8JA 4AU7A 3M55A 3TG5A 3OS5A 4YNPA 2QPWA 4FMUA 1PEGA 4QEPA 4QEOA 5HQ8A 5T0MA 3OXLA 1N6CA 3MEKA 5JHNA 1ZKKA 3SWCA 5HI7A 4MI0A 5F6LA 3HNAA 3F9WA 2IGQA 3CBOA 5KJNA 4JDSA 4BUPA 3M54A 3CBPA 3M53A 1N3JA 2G46A 5F5EA 2W5ZA 4YPUA 3DB5A 5CPRB 3CBMA 2RFIA 3M56A 4J83A 5T5GA 2BQZA 3MO5A 3RU0A 5KJMA 3PDNA 3OOIA 1XQHA 4J7FA 1N6AA 3KMTA 2JV0A 3S7DA 4O6FA 3S8PA 4NJ5A 3EP0A 3M58A 3KMJA 3S7BA 3F9ZA 3OXFA 4YPAA 5EX0A 2R3AA 4NVQA 1MVXA 1MVHA 4LDGA 3RAYA 3BO5A 4I51A 5TH7A 5KJKA 5F59A 5JJ0A 4E47A 5AYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8O A;  3MO2 A;  4J7I A;  3VUZ A;  3KMA A;  5TEG A;  4Z4P A;  3QWV A;  5ARF A;  3SW9 A;  1O9S A;  3FPD A;  5CCL A;  3K5K A;  4C1Q A;  3N71 A;  5KJL A;  4H12 A;  1MUF A;  5CCM A;  4MI5 A;  1ML9 A;  3RIB A;  3RQ4 A;  3VV0 A;  1MT6 A;  4QEN A;  5TTF A;  2W5Y A;  3M59 A;  1H3I A;  3S7F A;  4YPE A;  5LSZ A;  5EG2 A;  5F6K C;  5T0K A;  5JIY A;  3OPE A;  3OXG A;  5ARG A;  3F9X A;  2F69 A;  5LSX A;  4O30 A;  5EX3 A;  3MO0 A;  3F9Y A;  3TG4 A;  4JLG A;  3IHX A;  3RJW A;  3DAL A;  4YND A;  3M57 A;  4IJD A;  4IJ8 A;  4RZ0 A;  4YNM A;  3QWW A;  3QWP A;  3S7J A;  4WUY A;  3M5A A;  5JIN A;  2O8J A;  4AU7 A;  3M55 A;  3TG5 A;  3OS5 A;  4YNP A;  2QPW A;  4FMU A;  1PEG A;  4QEP A;  4QEO A;  5HQ8 A;  5T0M A;  3OXL A;  1N6C A;  3MEK A;  5JHN A;  1ZKK A;  3SWC A;  5HI7 A;  4MI0 A;  5F6L A;  3HNA A;  3F9W A;  2IGQ A;  3CBO A;  5KJN A;  4JDS A;  4BUP A;  3M54 A;  3CBP A;  3M53 A;  1N3J A;  2G46 A;  5F5E A;  2W5Z A;  4YPU A;  3DB5 A;  5CPR B;  3CBM A;  2RFI A;  3M56 A;  4J83 A;  5T5G A;  2BQZ A;  3MO5 A;  3RU0 A;  5KJM A;  3PDN A;  3OOI A;  1XQH A;  4J7F A;  1N6A A;  3KMT A;  2JV0 A;  3S7D A;  4O6F A;  3S8P A;  4NJ5 A;  3EP0 A;  3M58 A;  3KMJ A;  3S7B A;  3F9Z A;  3OXF A;  4YPA A;  5EX0 A;  2R3A A;  4NVQ A;  1MVX A;  1MVH A;  4LDG A;  3RAY A;  3BO5 A;  4I51 A;  5TH7 A;  5KJK A;  5F59 A;  5JJ0 A;  4E47 A;  5AYF A; 
#chains in the Genus database with same CATH topology
 4J8O A;  3MO2 A;  4J7I A;  3VUZ A;  3KMA A;  5TEG A;  4Z4P A;  3QWV A;  5ARF A;  3SW9 A;  1O9S A;  3FPD A;  5CCL A;  3K5K A;  4C1Q A;  3N71 A;  5KJL A;  4H12 A;  1MUF A;  5CCM A;  4MI5 A;  1ML9 A;  3RIB A;  3RQ4 A;  3VV0 A;  1MT6 A;  4QEN A;  5TTF A;  2W5Y A;  3M59 A;  1H3I A;  3S7F A;  4YPE A;  5LSZ A;  5EG2 A;  5F6K C;  5T0K A;  5JIY A;  3OPE A;  3OXG A;  5ARG A;  3F9X A;  2F69 A;  5LSX A;  4O30 A;  5EX3 A;  3MO0 A;  3F9Y A;  3TG4 A;  4JLG A;  3IHX A;  3RJW A;  3DAL A;  4YND A;  3M57 A;  4IJD A;  4IJ8 A;  4RZ0 A;  4YNM A;  3QWW A;  3QWP A;  3S7J A;  4WUY A;  3M5A A;  5JIN A;  2O8J A;  4AU7 A;  3M55 A;  3TG5 A;  3OS5 A;  4YNP A;  2QPW A;  4FMU A;  1PEG A;  4QEP A;  4QEO A;  5HQ8 A;  5T0M A;  3OXL A;  1N6C A;  3MEK A;  5JHN A;  1ZKK A;  3SWC A;  5HI7 A;  4MI0 A;  5F6L A;  3HNA A;  3F9W A;  2IGQ A;  3CBO A;  5KJN A;  4JDS A;  4BUP A;  3M54 A;  3CBP A;  3M53 A;  1N3J A;  2G46 A;  5F5E A;  2W5Z A;  4YPU A;  3DB5 A;  5CPR B;  3CBM A;  2RFI A;  3M56 A;  4J83 A;  5T5G A;  2BQZ A;  3MO5 A;  3RU0 A;  5KJM A;  3PDN A;  3OOI A;  1XQH A;  4J7F A;  1N6A A;  3KMT A;  2JV0 A;  3S7D A;  4O6F A;  3S8P A;  4NJ5 A;  3EP0 A;  3M58 A;  3KMJ A;  3S7B A;  3F9Z A;  3OXF A;  4YPA A;  5EX0 A;  2R3A A;  4NVQ A;  1MVX A;  1MVH A;  4LDG A;  3RAY A;  3BO5 A;  4I51 A;  5TH7 A;  5KJK A;  5F59 A;  5JJ0 A;  4E47 A;  5AYF A; 
#chains in the Genus database with same CATH homology
 4J8O A;  3MO2 A;  4J7I A;  3VUZ A;  3KMA A;  5TEG A;  4Z4P A;  3QWV A;  5ARF A;  3SW9 A;  1O9S A;  3FPD A;  5CCL A;  3K5K A;  4C1Q A;  3N71 A;  5KJL A;  4H12 A;  1MUF A;  5CCM A;  4MI5 A;  1ML9 A;  3RIB A;  3RQ4 A;  3VV0 A;  1MT6 A;  4QEN A;  5TTF A;  2W5Y A;  3M59 A;  1H3I A;  3S7F A;  4YPE A;  5LSZ A;  5EG2 A;  5F6K C;  5T0K A;  5JIY A;  3OPE A;  3OXG A;  5ARG A;  3F9X A;  2F69 A;  5LSX A;  4O30 A;  5EX3 A;  3MO0 A;  3F9Y A;  3TG4 A;  4JLG A;  3IHX A;  3RJW A;  3DAL A;  4YND A;  3M57 A;  4IJD A;  4IJ8 A;  4RZ0 A;  4YNM A;  3QWW A;  3QWP A;  3S7J A;  4WUY A;  3M5A A;  5JIN A;  2O8J A;  4AU7 A;  3M55 A;  3TG5 A;  3OS5 A;  4YNP A;  2QPW A;  4FMU A;  1PEG A;  4QEP A;  4QEO A;  5HQ8 A;  5T0M A;  3OXL A;  1N6C A;  3MEK A;  5JHN A;  1ZKK A;  3SWC A;  5HI7 A;  4MI0 A;  5F6L A;  3HNA A;  3F9W A;  2IGQ A;  3CBO A;  5KJN A;  4JDS A;  4BUP A;  3M54 A;  3CBP A;  3M53 A;  1N3J A;  2G46 A;  5F5E A;  2W5Z A;  4YPU A;  3DB5 A;  5CPR B;  3CBM A;  2RFI A;  3M56 A;  4J83 A;  5T5G A;  2BQZ A;  3MO5 A;  3RU0 A;  5KJM A;  3PDN A;  3OOI A;  1XQH A;  4J7F A;  1N6A A;  3KMT A;  2JV0 A;  3S7D A;  4O6F A;  3S8P A;  4NJ5 A;  3EP0 A;  3M58 A;  3KMJ A;  3S7B A;  3F9Z A;  3OXF A;  4YPA A;  5EX0 A;  2R3A A;  4NVQ A;  1MVX A;  1MVH A;  4LDG A;  3RAY A;  3BO5 A;  4I51 A;  5TH7 A;  5KJK A;  5F59 A;  5JJ0 A;  4E47 A;  5AYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...