4C1QA

Crystal structure of the prdm9 set domain in complex with h3k4me2 and adohcy.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
173
structure length
173
Chain Sequence
AMSQDDDYLYCEKCQNFFIDSCPNHGPPLFVKDSMVDRGHPNHSVLSLPPGLRISPSGIPEAGLGVWNEASDLPVGLHFGPYEGQITEDEEAANSGYSWLITKGRNCYEYVDGQDESQANWMRYVNCARDDEEQNLVAFQYHRKIFYRTCRVIRPGCELLVWYGDEYGQELGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/peptide
molecule keywords HISTONE-LYSINE N-METHYLTRANSFERASE PRDM9
publication title Molecular Basis for the Regulation of the H3K4 Methyltransferase Activity of Prdm9.
pubmed doi rcsb
source organism Mus musculus
total genus 43
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4c1qA00
4LDGA 2QPWA 3CBPA 2BQZA 3MO5A 4YPAA 5HI7A 4J7IA 3OS5A 4QEOA 3S7JA 3N71A 4IJDA 4JDSA 5CCMA 3BO5A 4J83A 3M56A 1MT6A 4BUPA 4JLGA 2W5YA 5JHNA 5CCLA 5JINA 3S7FA 3OXLA 3OPEA 2IGQA 5EG2A 3OXFA 3MO0A 5KJKA 3M58A 3VV0A 3K5KA 5F6KC 4RZ0A 2O8JA 5JIYA 4MI5A 4MI0A 4AU7A 4YPUA 5TH7A 3S8PA 3SWCA 3S7DA 5LSXA 3M54A 3QWWA 3F9YA 3RJWA 4YNDA 3CBMA 2F69A 5TEGA 3DB5A 3F9WA 3CBOA 3RQ4A 3FPDA 3F9ZA 4H12A 3M5AA 3F9XA 2W5ZA 4YPEA 5T5GA 3TG4A 3RAYA 3PDNA 2RFIA 3MEKA 4J8OA 1MVXA 5T0KA 3OOIA 5EX3A 3RU0A 5HQ8A 5TTFA 5F59A 1MUFA 3M57A 3S7BA 4Z4PA 1H3IA 5JJ0A 5F6LA 3M53A 5ARFA 2G46A 5F5EA 3KMTA 3M59A 3QWVA 3EP0A 4J7FA 1PEGA 1ZKKA 2R3AA 3VUZA 4QENA 3KMAA 3DALA 2JV0A 3KMJA 3MO2A 3QWPA 4O30A 4WUYA 4NJ5A 3RIBA 5KJNA 1ML9A 4YNMA 1O9SA 1N6CA 4NVQA 4YNPA 3OXGA 5AYFA 3HNAA 1MVHA 4QEPA 3SW9A 3TG5A 5CPRB 5LSZA 5T0MA 5ARGA 4O6FA 1XQHA 5EX0A 4IJ8A 5KJLA 1N6AA 4I51A 4C1QA 4E47A 3M55A 1N3JA 3IHXA 5KJMA 4FMUA
chains in the Genus database with same CATH superfamily
4LDGA 2QPWA 3CBPA 2BQZA 3MO5A 4YPAA 5HI7A 4J7IA 3OS5A 4QEOA 3S7JA 3N71A 4IJDA 4JDSA 5CCMA 3BO5A 4J83A 3M56A 1MT6A 4BUPA 4JLGA 2W5YA 5JHNA 5CCLA 5JINA 3S7FA 3OXLA 3OPEA 2IGQA 5EG2A 3OXFA 3MO0A 5KJKA 3M58A 3VV0A 3K5KA 5F6KC 4RZ0A 2O8JA 5JIYA 4MI5A 4MI0A 4AU7A 4YPUA 5TH7A 3S8PA 3SWCA 3S7DA 5LSXA 3M54A 3QWWA 3F9YA 3RJWA 4YNDA 3CBMA 2F69A 5TEGA 3DB5A 3F9WA 3CBOA 3RQ4A 3FPDA 3F9ZA 4H12A 3M5AA 3F9XA 2W5ZA 4YPEA 5T5GA 3TG4A 3RAYA 3PDNA 2RFIA 3MEKA 4J8OA 1MVXA 5T0KA 3OOIA 5EX3A 3RU0A 5HQ8A 5TTFA 5F59A 1MUFA 3M57A 3S7BA 4Z4PA 1H3IA 5JJ0A 5F6LA 3M53A 5ARFA 2G46A 5F5EA 3KMTA 3M59A 3QWVA 3EP0A 4J7FA 1PEGA 1ZKKA 2R3AA 3VUZA 4QENA 3KMAA 3DALA 2JV0A 3KMJA 3MO2A 3QWPA 4O30A 4WUYA 4NJ5A 3RIBA 5KJNA 1ML9A 4YNMA 1O9SA 1N6CA 4NVQA 4YNPA 3OXGA 5AYFA 3HNAA 1MVHA 4QEPA 3SW9A 3TG5A 5CPRB 5LSZA 5T0MA 5ARGA 4O6FA 1XQHA 5EX0A 4IJ8A 5KJLA 1N6AA 4I51A 4C1QA 4E47A 3M55A 1N3JA 3IHXA 5KJMA 4FMUA
chains in the Genus database with same CATH topology
4LDGA 2QPWA 3CBPA 2BQZA 3MO5A 4YPAA 5HI7A 4J7IA 3OS5A 4QEOA 3S7JA 3N71A 4IJDA 4JDSA 5CCMA 3BO5A 4J83A 3M56A 1MT6A 4BUPA 4JLGA 2W5YA 5JHNA 5CCLA 5JINA 3S7FA 3OXLA 3OPEA 2IGQA 5EG2A 3OXFA 3MO0A 5KJKA 3M58A 3VV0A 3K5KA 5F6KC 4RZ0A 2O8JA 5JIYA 4MI5A 4MI0A 4AU7A 4YPUA 5TH7A 3S8PA 3SWCA 3S7DA 5LSXA 3M54A 3QWWA 3F9YA 3RJWA 4YNDA 3CBMA 2F69A 5TEGA 3DB5A 3F9WA 3CBOA 3RQ4A 3FPDA 3F9ZA 4H12A 3M5AA 3F9XA 2W5ZA 4YPEA 5T5GA 3TG4A 3RAYA 3PDNA 2RFIA 3MEKA 4J8OA 1MVXA 5T0KA 3OOIA 5EX3A 3RU0A 5HQ8A 5TTFA 5F59A 1MUFA 3M57A 3S7BA 4Z4PA 1H3IA 5JJ0A 5F6LA 3M53A 5ARFA 2G46A 5F5EA 3KMTA 3M59A 3QWVA 3EP0A 4J7FA 1PEGA 1ZKKA 2R3AA 3VUZA 4QENA 3KMAA 3DALA 2JV0A 3KMJA 3MO2A 3QWPA 4O30A 4WUYA 4NJ5A 3RIBA 5KJNA 1ML9A 4YNMA 1O9SA 1N6CA 4NVQA 4YNPA 3OXGA 5AYFA 3HNAA 1MVHA 4QEPA 3SW9A 3TG5A 5CPRB 5LSZA 5T0MA 5ARGA 4O6FA 1XQHA 5EX0A 4IJ8A 5KJLA 1N6AA 4I51A 4C1QA 4E47A 3M55A 1N3JA 3IHXA 5KJMA 4FMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LDG A;  2QPW A;  3CBP A;  2BQZ A;  3MO5 A;  4YPA A;  5HI7 A;  4J7I A;  3OS5 A;  4QEO A;  3S7J A;  3N71 A;  4IJD A;  4JDS A;  5CCM A;  3BO5 A;  4J83 A;  3M56 A;  1MT6 A;  4BUP A;  4JLG A;  2W5Y A;  5JHN A;  5CCL A;  5JIN A;  3S7F A;  3OXL A;  3OPE A;  2IGQ A;  5EG2 A;  3OXF A;  3MO0 A;  5KJK A;  3M58 A;  3VV0 A;  3K5K A;  5F6K C;  4RZ0 A;  2O8J A;  5JIY A;  4MI5 A;  4MI0 A;  4AU7 A;  4YPU A;  5TH7 A;  3S8P A;  3SWC A;  3S7D A;  5LSX A;  3M54 A;  3QWW A;  3F9Y A;  3RJW A;  4YND A;  3CBM A;  2F69 A;  5TEG A;  3DB5 A;  3F9W A;  3CBO A;  3RQ4 A;  3FPD A;  3F9Z A;  4H12 A;  3M5A A;  3F9X A;  2W5Z A;  4YPE A;  5T5G A;  3TG4 A;  3RAY A;  3PDN A;  2RFI A;  3MEK A;  4J8O A;  1MVX A;  5T0K A;  3OOI A;  5EX3 A;  3RU0 A;  5HQ8 A;  5TTF A;  5F59 A;  1MUF A;  3M57 A;  3S7B A;  4Z4P A;  1H3I A;  5JJ0 A;  5F6L A;  3M53 A;  5ARF A;  2G46 A;  5F5E A;  3KMT A;  3M59 A;  3QWV A;  3EP0 A;  4J7F A;  1PEG A;  1ZKK A;  2R3A A;  3VUZ A;  4QEN A;  3KMA A;  3DAL A;  2JV0 A;  3KMJ A;  3MO2 A;  3QWP A;  4O30 A;  4WUY A;  4NJ5 A;  3RIB A;  5KJN A;  1ML9 A;  4YNM A;  1O9S A;  1N6C A;  4NVQ A;  4YNP A;  3OXG A;  5AYF A;  3HNA A;  1MVH A;  4QEP A;  3SW9 A;  3TG5 A;  5CPR B;  5LSZ A;  5T0M A;  5ARG A;  4O6F A;  1XQH A;  5EX0 A;  4IJ8 A;  5KJL A;  1N6A A;  4I51 A;  4C1Q A;  4E47 A;  3M55 A;  1N3J A;  3IHX A;  5KJM A;  4FMU A; 
#chains in the Genus database with same CATH topology
 4LDG A;  2QPW A;  3CBP A;  2BQZ A;  3MO5 A;  4YPA A;  5HI7 A;  4J7I A;  3OS5 A;  4QEO A;  3S7J A;  3N71 A;  4IJD A;  4JDS A;  5CCM A;  3BO5 A;  4J83 A;  3M56 A;  1MT6 A;  4BUP A;  4JLG A;  2W5Y A;  5JHN A;  5CCL A;  5JIN A;  3S7F A;  3OXL A;  3OPE A;  2IGQ A;  5EG2 A;  3OXF A;  3MO0 A;  5KJK A;  3M58 A;  3VV0 A;  3K5K A;  5F6K C;  4RZ0 A;  2O8J A;  5JIY A;  4MI5 A;  4MI0 A;  4AU7 A;  4YPU A;  5TH7 A;  3S8P A;  3SWC A;  3S7D A;  5LSX A;  3M54 A;  3QWW A;  3F9Y A;  3RJW A;  4YND A;  3CBM A;  2F69 A;  5TEG A;  3DB5 A;  3F9W A;  3CBO A;  3RQ4 A;  3FPD A;  3F9Z A;  4H12 A;  3M5A A;  3F9X A;  2W5Z A;  4YPE A;  5T5G A;  3TG4 A;  3RAY A;  3PDN A;  2RFI A;  3MEK A;  4J8O A;  1MVX A;  5T0K A;  3OOI A;  5EX3 A;  3RU0 A;  5HQ8 A;  5TTF A;  5F59 A;  1MUF A;  3M57 A;  3S7B A;  4Z4P A;  1H3I A;  5JJ0 A;  5F6L A;  3M53 A;  5ARF A;  2G46 A;  5F5E A;  3KMT A;  3M59 A;  3QWV A;  3EP0 A;  4J7F A;  1PEG A;  1ZKK A;  2R3A A;  3VUZ A;  4QEN A;  3KMA A;  3DAL A;  2JV0 A;  3KMJ A;  3MO2 A;  3QWP A;  4O30 A;  4WUY A;  4NJ5 A;  3RIB A;  5KJN A;  1ML9 A;  4YNM A;  1O9S A;  1N6C A;  4NVQ A;  4YNP A;  3OXG A;  5AYF A;  3HNA A;  1MVH A;  4QEP A;  3SW9 A;  3TG5 A;  5CPR B;  5LSZ A;  5T0M A;  5ARG A;  4O6F A;  1XQH A;  5EX0 A;  4IJ8 A;  5KJL A;  1N6A A;  4I51 A;  4C1Q A;  4E47 A;  3M55 A;  1N3J A;  3IHX A;  5KJM A;  4FMU A; 
#chains in the Genus database with same CATH homology
 4LDG A;  2QPW A;  3CBP A;  2BQZ A;  3MO5 A;  4YPA A;  5HI7 A;  4J7I A;  3OS5 A;  4QEO A;  3S7J A;  3N71 A;  4IJD A;  4JDS A;  5CCM A;  3BO5 A;  4J83 A;  3M56 A;  1MT6 A;  4BUP A;  4JLG A;  2W5Y A;  5JHN A;  5CCL A;  5JIN A;  3S7F A;  3OXL A;  3OPE A;  2IGQ A;  5EG2 A;  3OXF A;  3MO0 A;  5KJK A;  3M58 A;  3VV0 A;  3K5K A;  5F6K C;  4RZ0 A;  2O8J A;  5JIY A;  4MI5 A;  4MI0 A;  4AU7 A;  4YPU A;  5TH7 A;  3S8P A;  3SWC A;  3S7D A;  5LSX A;  3M54 A;  3QWW A;  3F9Y A;  3RJW A;  4YND A;  3CBM A;  2F69 A;  5TEG A;  3DB5 A;  3F9W A;  3CBO A;  3RQ4 A;  3FPD A;  3F9Z A;  4H12 A;  3M5A A;  3F9X A;  2W5Z A;  4YPE A;  5T5G A;  3TG4 A;  3RAY A;  3PDN A;  2RFI A;  3MEK A;  4J8O A;  1MVX A;  5T0K A;  3OOI A;  5EX3 A;  3RU0 A;  5HQ8 A;  5TTF A;  5F59 A;  1MUF A;  3M57 A;  3S7B A;  4Z4P A;  1H3I A;  5JJ0 A;  5F6L A;  3M53 A;  5ARF A;  2G46 A;  5F5E A;  3KMT A;  3M59 A;  3QWV A;  3EP0 A;  4J7F A;  1PEG A;  1ZKK A;  2R3A A;  3VUZ A;  4QEN A;  3KMA A;  3DAL A;  2JV0 A;  3KMJ A;  3MO2 A;  3QWP A;  4O30 A;  4WUY A;  4NJ5 A;  3RIB A;  5KJN A;  1ML9 A;  4YNM A;  1O9S A;  1N6C A;  4NVQ A;  4YNP A;  3OXG A;  5AYF A;  3HNA A;  1MVH A;  4QEP A;  3SW9 A;  3TG5 A;  5CPR B;  5LSZ A;  5T0M A;  5ARG A;  4O6F A;  1XQH A;  5EX0 A;  4IJ8 A;  5KJL A;  1N6A A;  4I51 A;  4C1Q A;  4E47 A;  3M55 A;  1N3J A;  3IHX A;  5KJM A;  4FMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...