4C1QA

Crystal structure of the prdm9 set domain in complex with h3k4me2 and adohcy.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
173
structure length
173
Chain Sequence
AMSQDDDYLYCEKCQNFFIDSCPNHGPPLFVKDSMVDRGHPNHSVLSLPPGLRISPSGIPEAGLGVWNEASDLPVGLHFGPYEGQITEDEEAANSGYSWLITKGRNCYEYVDGQDESQANWMRYVNCARDDEEQNLVAFQYHRKIFYRTCRVIRPGCELLVWYGDEYGQELGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Basis for the Regulation of the H3K4 Methyltransferase Activity of Prdm9.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/peptide
molecule keywords HISTONE-LYSINE N-METHYLTRANSFERASE PRDM9
total genus 43
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4c1qA00
4YPUA 4QEPA 3RQ4A 1O9SA 2JV0A 4Z4PA 3M58A 2BQZA 3EP0A 4BUPA 1ZKKA 4C1QA 3F9XA 3S7JA 1N3JA 3OPEA 3KMTA 3DALA 5LSZA 3S8PA 3OOIA 4NVQA 1PEGA 3M57A 4J7IA 3M56A 3TG5A 4O6FA 5F59A 4YPAA 5ARFA 2RFIA 3M54A 5TTFA 5CCMA 5TEGA 4NJ5A 2O8JA 3SW9A 3VV0A 3QWWA 4QEOA 3PDNA 3QWPA 4J8OA 1MT6A 3M5AA 5KJMA 3CBPA 4YNPA 3SWCA 5T5GA 2W5YA 5CCLA 2QPWA 4WUYA 5T0MA 1MUFA 5JHNA 3OXFA 3MO0A 3OS5A 4IJDA 3F9WA 4FMUA 2G46A 3CBMA 3F9YA 3MO2A 5CPRB 5AYFA 3N71A 2F69A 4MI5A 5F5EA 3MO5A 3S7FA 3MEKA 3CBOA 4RZ0A 5F6LA 2W5ZA 5JIYA 4J7FA 4YPEA 5ARGA 1MVXA 5HI7A 3M55A 4MI0A 4JLGA 4J83A 5LSXA 3IHXA 5EX3A 4IJ8A 4AU7A 5T0KA 3OXGA 5JINA 1N6AA 5TH7A 5KJLA 5EX0A 1MVHA 3RJWA 4YNMA 3RIBA 1ML9A 4QENA 3S7DA 5KJNA 3DB5A 3QWVA 3RAYA 3RU0A 3HNAA 5F6KC 3TG4A 3OXLA 4H12A 3KMJA 2IGQA 4I51A 4O30A 3BO5A 3S7BA 2R3AA 3F9ZA 1N6CA 4LDGA 1H3IA 5KJKA 4JDSA 3K5KA 1XQHA 3M53A 5JJ0A 5EG2A 4E47A 4YNDA 3M59A 3KMAA 3FPDA 5HQ8A 3VUZA
chains in the Genus database with same CATH superfamily
4YPUA 4QEPA 3RQ4A 1O9SA 2JV0A 4Z4PA 3M58A 2BQZA 3EP0A 4BUPA 1ZKKA 4C1QA 3F9XA 3S7JA 1N3JA 3OPEA 3KMTA 3DALA 5LSZA 3S8PA 3OOIA 4NVQA 1PEGA 3M57A 4J7IA 3M56A 3TG5A 4O6FA 5F59A 4YPAA 5ARFA 2RFIA 3M54A 5TTFA 5CCMA 5TEGA 4NJ5A 2O8JA 3SW9A 3VV0A 3QWWA 4QEOA 3PDNA 3QWPA 4J8OA 1MT6A 3M5AA 5KJMA 3CBPA 4YNPA 3SWCA 5T5GA 2W5YA 5CCLA 2QPWA 4WUYA 5T0MA 1MUFA 5JHNA 3OXFA 3MO0A 3OS5A 4IJDA 3F9WA 4FMUA 2G46A 3CBMA 3F9YA 3MO2A 5CPRB 5AYFA 3N71A 2F69A 4MI5A 5F5EA 3MO5A 3S7FA 3MEKA 3CBOA 4RZ0A 5F6LA 2W5ZA 5JIYA 4J7FA 4YPEA 5ARGA 1MVXA 5HI7A 3M55A 4MI0A 4JLGA 4J83A 5LSXA 3IHXA 5EX3A 4IJ8A 4AU7A 5T0KA 3OXGA 5JINA 1N6AA 5TH7A 5KJLA 5EX0A 1MVHA 3RJWA 4YNMA 3RIBA 1ML9A 4QENA 3S7DA 5KJNA 3DB5A 3QWVA 3RAYA 3RU0A 3HNAA 5F6KC 3TG4A 3OXLA 4H12A 3KMJA 2IGQA 4I51A 4O30A 3BO5A 3S7BA 2R3AA 3F9ZA 1N6CA 4LDGA 1H3IA 5KJKA 4JDSA 3K5KA 1XQHA 3M53A 5JJ0A 5EG2A 4E47A 4YNDA 3M59A 3KMAA 3FPDA 5HQ8A 3VUZA
chains in the Genus database with same CATH topology
4YPUA 4QEPA 3RQ4A 1O9SA 2JV0A 4Z4PA 3M58A 2BQZA 3EP0A 4BUPA 1ZKKA 4C1QA 3F9XA 3S7JA 1N3JA 3OPEA 3KMTA 3DALA 5LSZA 3S8PA 3OOIA 4NVQA 1PEGA 3M57A 4J7IA 3M56A 3TG5A 4O6FA 5F59A 4YPAA 5ARFA 2RFIA 3M54A 5TTFA 5CCMA 5TEGA 4NJ5A 2O8JA 3SW9A 3VV0A 3QWWA 4QEOA 3PDNA 3QWPA 4J8OA 1MT6A 3M5AA 5KJMA 3CBPA 4YNPA 3SWCA 5T5GA 2W5YA 5CCLA 2QPWA 4WUYA 5T0MA 1MUFA 5JHNA 3OXFA 3MO0A 3OS5A 4IJDA 3F9WA 4FMUA 2G46A 3CBMA 3F9YA 3MO2A 5CPRB 5AYFA 3N71A 2F69A 4MI5A 5F5EA 3MO5A 3S7FA 3MEKA 3CBOA 4RZ0A 5F6LA 2W5ZA 5JIYA 4J7FA 4YPEA 5ARGA 1MVXA 5HI7A 3M55A 4MI0A 4JLGA 4J83A 5LSXA 3IHXA 5EX3A 4IJ8A 4AU7A 5T0KA 3OXGA 5JINA 1N6AA 5TH7A 5KJLA 5EX0A 1MVHA 3RJWA 4YNMA 3RIBA 1ML9A 4QENA 3S7DA 5KJNA 3DB5A 3QWVA 3RAYA 3RU0A 3HNAA 5F6KC 3TG4A 3OXLA 4H12A 3KMJA 2IGQA 4I51A 4O30A 3BO5A 3S7BA 2R3AA 3F9ZA 1N6CA 4LDGA 1H3IA 5KJKA 4JDSA 3K5KA 1XQHA 3M53A 5JJ0A 5EG2A 4E47A 4YNDA 3M59A 3KMAA 3FPDA 5HQ8A 3VUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YPU A;  4QEP A;  3RQ4 A;  1O9S A;  2JV0 A;  4Z4P A;  3M58 A;  2BQZ A;  3EP0 A;  4BUP A;  1ZKK A;  4C1Q A;  3F9X A;  3S7J A;  1N3J A;  3OPE A;  3KMT A;  3DAL A;  5LSZ A;  3S8P A;  3OOI A;  4NVQ A;  1PEG A;  3M57 A;  4J7I A;  3M56 A;  3TG5 A;  4O6F A;  5F59 A;  4YPA A;  5ARF A;  2RFI A;  3M54 A;  5TTF A;  5CCM A;  5TEG A;  4NJ5 A;  2O8J A;  3SW9 A;  3VV0 A;  3QWW A;  4QEO A;  3PDN A;  3QWP A;  4J8O A;  1MT6 A;  3M5A A;  5KJM A;  3CBP A;  4YNP A;  3SWC A;  5T5G A;  2W5Y A;  5CCL A;  2QPW A;  4WUY A;  5T0M A;  1MUF A;  5JHN A;  3OXF A;  3MO0 A;  3OS5 A;  4IJD A;  3F9W A;  4FMU A;  2G46 A;  3CBM A;  3F9Y A;  3MO2 A;  5CPR B;  5AYF A;  3N71 A;  2F69 A;  4MI5 A;  5F5E A;  3MO5 A;  3S7F A;  3MEK A;  3CBO A;  4RZ0 A;  5F6L A;  2W5Z A;  5JIY A;  4J7F A;  4YPE A;  5ARG A;  1MVX A;  5HI7 A;  3M55 A;  4MI0 A;  4JLG A;  4J83 A;  5LSX A;  3IHX A;  5EX3 A;  4IJ8 A;  4AU7 A;  5T0K A;  3OXG A;  5JIN A;  1N6A A;  5TH7 A;  5KJL A;  5EX0 A;  1MVH A;  3RJW A;  4YNM A;  3RIB A;  1ML9 A;  4QEN A;  3S7D A;  5KJN A;  3DB5 A;  3QWV A;  3RAY A;  3RU0 A;  3HNA A;  5F6K C;  3TG4 A;  3OXL A;  4H12 A;  3KMJ A;  2IGQ A;  4I51 A;  4O30 A;  3BO5 A;  3S7B A;  2R3A A;  3F9Z A;  1N6C A;  4LDG A;  1H3I A;  5KJK A;  4JDS A;  3K5K A;  1XQH A;  3M53 A;  5JJ0 A;  5EG2 A;  4E47 A;  4YND A;  3M59 A;  3KMA A;  3FPD A;  5HQ8 A;  3VUZ A; 
#chains in the Genus database with same CATH topology
 4YPU A;  4QEP A;  3RQ4 A;  1O9S A;  2JV0 A;  4Z4P A;  3M58 A;  2BQZ A;  3EP0 A;  4BUP A;  1ZKK A;  4C1Q A;  3F9X A;  3S7J A;  1N3J A;  3OPE A;  3KMT A;  3DAL A;  5LSZ A;  3S8P A;  3OOI A;  4NVQ A;  1PEG A;  3M57 A;  4J7I A;  3M56 A;  3TG5 A;  4O6F A;  5F59 A;  4YPA A;  5ARF A;  2RFI A;  3M54 A;  5TTF A;  5CCM A;  5TEG A;  4NJ5 A;  2O8J A;  3SW9 A;  3VV0 A;  3QWW A;  4QEO A;  3PDN A;  3QWP A;  4J8O A;  1MT6 A;  3M5A A;  5KJM A;  3CBP A;  4YNP A;  3SWC A;  5T5G A;  2W5Y A;  5CCL A;  2QPW A;  4WUY A;  5T0M A;  1MUF A;  5JHN A;  3OXF A;  3MO0 A;  3OS5 A;  4IJD A;  3F9W A;  4FMU A;  2G46 A;  3CBM A;  3F9Y A;  3MO2 A;  5CPR B;  5AYF A;  3N71 A;  2F69 A;  4MI5 A;  5F5E A;  3MO5 A;  3S7F A;  3MEK A;  3CBO A;  4RZ0 A;  5F6L A;  2W5Z A;  5JIY A;  4J7F A;  4YPE A;  5ARG A;  1MVX A;  5HI7 A;  3M55 A;  4MI0 A;  4JLG A;  4J83 A;  5LSX A;  3IHX A;  5EX3 A;  4IJ8 A;  4AU7 A;  5T0K A;  3OXG A;  5JIN A;  1N6A A;  5TH7 A;  5KJL A;  5EX0 A;  1MVH A;  3RJW A;  4YNM A;  3RIB A;  1ML9 A;  4QEN A;  3S7D A;  5KJN A;  3DB5 A;  3QWV A;  3RAY A;  3RU0 A;  3HNA A;  5F6K C;  3TG4 A;  3OXL A;  4H12 A;  3KMJ A;  2IGQ A;  4I51 A;  4O30 A;  3BO5 A;  3S7B A;  2R3A A;  3F9Z A;  1N6C A;  4LDG A;  1H3I A;  5KJK A;  4JDS A;  3K5K A;  1XQH A;  3M53 A;  5JJ0 A;  5EG2 A;  4E47 A;  4YND A;  3M59 A;  3KMA A;  3FPD A;  5HQ8 A;  3VUZ A; 
#chains in the Genus database with same CATH homology
 4YPU A;  4QEP A;  3RQ4 A;  1O9S A;  2JV0 A;  4Z4P A;  3M58 A;  2BQZ A;  3EP0 A;  4BUP A;  1ZKK A;  4C1Q A;  3F9X A;  3S7J A;  1N3J A;  3OPE A;  3KMT A;  3DAL A;  5LSZ A;  3S8P A;  3OOI A;  4NVQ A;  1PEG A;  3M57 A;  4J7I A;  3M56 A;  3TG5 A;  4O6F A;  5F59 A;  4YPA A;  5ARF A;  2RFI A;  3M54 A;  5TTF A;  5CCM A;  5TEG A;  4NJ5 A;  2O8J A;  3SW9 A;  3VV0 A;  3QWW A;  4QEO A;  3PDN A;  3QWP A;  4J8O A;  1MT6 A;  3M5A A;  5KJM A;  3CBP A;  4YNP A;  3SWC A;  5T5G A;  2W5Y A;  5CCL A;  2QPW A;  4WUY A;  5T0M A;  1MUF A;  5JHN A;  3OXF A;  3MO0 A;  3OS5 A;  4IJD A;  3F9W A;  4FMU A;  2G46 A;  3CBM A;  3F9Y A;  3MO2 A;  5CPR B;  5AYF A;  3N71 A;  2F69 A;  4MI5 A;  5F5E A;  3MO5 A;  3S7F A;  3MEK A;  3CBO A;  4RZ0 A;  5F6L A;  2W5Z A;  5JIY A;  4J7F A;  4YPE A;  5ARG A;  1MVX A;  5HI7 A;  3M55 A;  4MI0 A;  4JLG A;  4J83 A;  5LSX A;  3IHX A;  5EX3 A;  4IJ8 A;  4AU7 A;  5T0K A;  3OXG A;  5JIN A;  1N6A A;  5TH7 A;  5KJL A;  5EX0 A;  1MVH A;  3RJW A;  4YNM A;  3RIB A;  1ML9 A;  4QEN A;  3S7D A;  5KJN A;  3DB5 A;  3QWV A;  3RAY A;  3RU0 A;  3HNA A;  5F6K C;  3TG4 A;  3OXL A;  4H12 A;  3KMJ A;  2IGQ A;  4I51 A;  4O30 A;  3BO5 A;  3S7B A;  2R3A A;  3F9Z A;  1N6C A;  4LDG A;  1H3I A;  5KJK A;  4JDS A;  3K5K A;  1XQH A;  3M53 A;  5JJ0 A;  5EG2 A;  4E47 A;  4YND A;  3M59 A;  3KMA A;  3FPD A;  5HQ8 A;  3VUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...