4C1QA

Crystal structure of the prdm9 set domain in complex with h3k4me2 and adohcy.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
173
structure length
173
Chain Sequence
b'AMSQDDDYLYCEKCQNFFIDSCPNHGPPLFVKDSMVDRGHPNHSVLSLPPGLRISPSGIPEAGLGVWNEASDLPVGLHFGPYEGQITEDEEAANSGYSWLITKGRNCYEYVDGQDESQANWMRYVNCARDDEEQNLVAFQYHRKIFYRTCRVIRPGCELLVWYGDEYGQELGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HISTONE-LYSINE N-METHYLTRANSFERASE PRDM9
publication title Molecular Basis for the Regulation of the H3K4 Methyltransferase Activity of Prdm9.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/peptide
total genus 43
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4c1qA00
3OXGA 3F9YA 5KJNA 5KJKA 1H3IA 3FPDA 4LDGA 3RAYA 3OXLA 5EG2A 3CBOA 4YPAA 5T0KA 5KJLA 1ML9A 4C1QA 3KMJA 4BUPA 3S7FA 3M59A 2F69A 4O30A 3F9WA 4AU7A 4MI5A 3M57A 5CCLA 4YNDA 2QPWA 3QWVA 3MO2A 2W5ZA 3SWCA 4E47A 3CBMA 4NVQA 5CCMA 3M56A 5JJ0A 3OOIA 3RQ4A 3F9ZA 1ZKKA 5F6LA 5F6KC 5EX0A 3S7DA 1MVXA 4O6FA 3SW9A 4QENA 5KJMA 3OXFA 3QWWA 5EX3A 3KMTA 4JDSA 4NJ5A 4IJ8A 3OS5A 3TG5A 5JIYA 3PDNA 5TH7A 3EP0A 3RJWA 3M58A 3M53A 5CPRB 5TEGA 4YNPA 3CBPA 3S8PA 4Z4PA 3QWPA 4I51A 2G46A 2R3AA 4IJDA 2O8JA 3MO5A 3N71A 5ARGA 3KMAA 3RIBA 5JINA 3K5KA 3MO0A 3BO5A 5F5EA 3S7JA 3VV0A 5AYFA 2IGQA 4J8OA 4FMUA 1N6CA 1XQHA 3DB5A 3M5AA 4JLGA 3IHXA 3S7BA 5LSZA 4RZ0A 2W5YA 3M54A 4QEPA 1MVHA 3MEKA 5T0MA 4MI0A 5HQ8A 4YPEA 4J7FA 5TTFA 4WUYA 3DALA 5F59A 3OPEA 5JHNA 4QEOA 4YPUA 2RFIA 4YNMA 2JV0A 3M55A 3HNAA 1MT6A 1MUFA 1PEGA 1N3JA 5LSXA 3VUZA 1N6AA 4J7IA 2BQZA 3RU0A 1O9SA 3F9XA 5T5GA 4H12A 5HI7A 4J83A 3TG4A 5ARFA
chains in the Genus database with same CATH superfamily
3OXGA 3F9YA 5KJNA 5KJKA 1H3IA 3FPDA 4LDGA 3RAYA 3OXLA 5EG2A 3CBOA 4YPAA 5T0KA 5KJLA 1ML9A 4C1QA 3KMJA 4BUPA 3S7FA 3M59A 2F69A 4O30A 3F9WA 4AU7A 4MI5A 3M57A 5CCLA 4YNDA 2QPWA 3QWVA 3MO2A 2W5ZA 3SWCA 4E47A 3CBMA 4NVQA 5CCMA 3M56A 5JJ0A 3OOIA 3RQ4A 3F9ZA 1ZKKA 5F6LA 5F6KC 5EX0A 3S7DA 1MVXA 4O6FA 3SW9A 4QENA 5KJMA 3OXFA 3QWWA 5EX3A 3KMTA 4JDSA 4NJ5A 4IJ8A 3OS5A 3TG5A 5JIYA 3PDNA 5TH7A 3EP0A 3RJWA 3M58A 3M53A 5CPRB 5TEGA 4YNPA 3CBPA 3S8PA 4Z4PA 3QWPA 4I51A 2G46A 2R3AA 4IJDA 2O8JA 3MO5A 3N71A 5ARGA 3KMAA 3RIBA 5JINA 3K5KA 3MO0A 3BO5A 5F5EA 3S7JA 3VV0A 5AYFA 2IGQA 4J8OA 4FMUA 1N6CA 1XQHA 3DB5A 3M5AA 4JLGA 3IHXA 3S7BA 5LSZA 4RZ0A 2W5YA 3M54A 4QEPA 1MVHA 3MEKA 5T0MA 4MI0A 5HQ8A 4YPEA 4J7FA 5TTFA 4WUYA 3DALA 5F59A 3OPEA 5JHNA 4QEOA 4YPUA 2RFIA 4YNMA 2JV0A 3M55A 3HNAA 1MT6A 1MUFA 1PEGA 1N3JA 5LSXA 3VUZA 1N6AA 4J7IA 2BQZA 3RU0A 1O9SA 3F9XA 5T5GA 4H12A 5HI7A 4J83A 3TG4A 5ARFA
chains in the Genus database with same CATH topology
3OXGA 3F9YA 5KJNA 5KJKA 1H3IA 3FPDA 4LDGA 3RAYA 3OXLA 5EG2A 3CBOA 4YPAA 5T0KA 5KJLA 1ML9A 4C1QA 3KMJA 4BUPA 3S7FA 3M59A 2F69A 4O30A 3F9WA 4AU7A 4MI5A 3M57A 5CCLA 4YNDA 2QPWA 3QWVA 3MO2A 2W5ZA 3SWCA 4E47A 3CBMA 4NVQA 5CCMA 3M56A 5JJ0A 3OOIA 3RQ4A 3F9ZA 1ZKKA 5F6LA 5F6KC 5EX0A 3S7DA 1MVXA 4O6FA 3SW9A 4QENA 5KJMA 3OXFA 3QWWA 5EX3A 3KMTA 4JDSA 4NJ5A 4IJ8A 3OS5A 3TG5A 5JIYA 3PDNA 5TH7A 3EP0A 3RJWA 3M58A 3M53A 5CPRB 5TEGA 4YNPA 3CBPA 3S8PA 4Z4PA 3QWPA 4I51A 2G46A 2R3AA 4IJDA 2O8JA 3MO5A 3N71A 5ARGA 3KMAA 3RIBA 5JINA 3K5KA 3MO0A 3BO5A 5F5EA 3S7JA 3VV0A 5AYFA 2IGQA 4J8OA 4FMUA 1N6CA 1XQHA 3DB5A 3M5AA 4JLGA 3IHXA 3S7BA 5LSZA 4RZ0A 2W5YA 3M54A 4QEPA 1MVHA 3MEKA 5T0MA 4MI0A 5HQ8A 4YPEA 4J7FA 5TTFA 4WUYA 3DALA 5F59A 3OPEA 5JHNA 4QEOA 4YPUA 2RFIA 4YNMA 2JV0A 3M55A 3HNAA 1MT6A 1MUFA 1PEGA 1N3JA 5LSXA 3VUZA 1N6AA 4J7IA 2BQZA 3RU0A 1O9SA 3F9XA 5T5GA 4H12A 5HI7A 4J83A 3TG4A 5ARFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OXG A;  3F9Y A;  5KJN A;  5KJK A;  1H3I A;  3FPD A;  4LDG A;  3RAY A;  3OXL A;  5EG2 A;  3CBO A;  4YPA A;  5T0K A;  5KJL A;  1ML9 A;  4C1Q A;  3KMJ A;  4BUP A;  3S7F A;  3M59 A;  2F69 A;  4O30 A;  3F9W A;  4AU7 A;  4MI5 A;  3M57 A;  5CCL A;  4YND A;  2QPW A;  3QWV A;  3MO2 A;  2W5Z A;  3SWC A;  4E47 A;  3CBM A;  4NVQ A;  5CCM A;  3M56 A;  5JJ0 A;  3OOI A;  3RQ4 A;  3F9Z A;  1ZKK A;  5F6L A;  5F6K C;  5EX0 A;  3S7D A;  1MVX A;  4O6F A;  3SW9 A;  4QEN A;  5KJM A;  3OXF A;  3QWW A;  5EX3 A;  3KMT A;  4JDS A;  4NJ5 A;  4IJ8 A;  3OS5 A;  3TG5 A;  5JIY A;  3PDN A;  5TH7 A;  3EP0 A;  3RJW A;  3M58 A;  3M53 A;  5CPR B;  5TEG A;  4YNP A;  3CBP A;  3S8P A;  4Z4P A;  3QWP A;  4I51 A;  2G46 A;  2R3A A;  4IJD A;  2O8J A;  3MO5 A;  3N71 A;  5ARG A;  3KMA A;  3RIB A;  5JIN A;  3K5K A;  3MO0 A;  3BO5 A;  5F5E A;  3S7J A;  3VV0 A;  5AYF A;  2IGQ A;  4J8O A;  4FMU A;  1N6C A;  1XQH A;  3DB5 A;  3M5A A;  4JLG A;  3IHX A;  3S7B A;  5LSZ A;  4RZ0 A;  2W5Y A;  3M54 A;  4QEP A;  1MVH A;  3MEK A;  5T0M A;  4MI0 A;  5HQ8 A;  4YPE A;  4J7F A;  5TTF A;  4WUY A;  3DAL A;  5F59 A;  3OPE A;  5JHN A;  4QEO A;  4YPU A;  2RFI A;  4YNM A;  2JV0 A;  3M55 A;  3HNA A;  1MT6 A;  1MUF A;  1PEG A;  1N3J A;  5LSX A;  3VUZ A;  1N6A A;  4J7I A;  2BQZ A;  3RU0 A;  1O9S A;  3F9X A;  5T5G A;  4H12 A;  5HI7 A;  4J83 A;  3TG4 A;  5ARF A; 
#chains in the Genus database with same CATH topology
 3OXG A;  3F9Y A;  5KJN A;  5KJK A;  1H3I A;  3FPD A;  4LDG A;  3RAY A;  3OXL A;  5EG2 A;  3CBO A;  4YPA A;  5T0K A;  5KJL A;  1ML9 A;  4C1Q A;  3KMJ A;  4BUP A;  3S7F A;  3M59 A;  2F69 A;  4O30 A;  3F9W A;  4AU7 A;  4MI5 A;  3M57 A;  5CCL A;  4YND A;  2QPW A;  3QWV A;  3MO2 A;  2W5Z A;  3SWC A;  4E47 A;  3CBM A;  4NVQ A;  5CCM A;  3M56 A;  5JJ0 A;  3OOI A;  3RQ4 A;  3F9Z A;  1ZKK A;  5F6L A;  5F6K C;  5EX0 A;  3S7D A;  1MVX A;  4O6F A;  3SW9 A;  4QEN A;  5KJM A;  3OXF A;  3QWW A;  5EX3 A;  3KMT A;  4JDS A;  4NJ5 A;  4IJ8 A;  3OS5 A;  3TG5 A;  5JIY A;  3PDN A;  5TH7 A;  3EP0 A;  3RJW A;  3M58 A;  3M53 A;  5CPR B;  5TEG A;  4YNP A;  3CBP A;  3S8P A;  4Z4P A;  3QWP A;  4I51 A;  2G46 A;  2R3A A;  4IJD A;  2O8J A;  3MO5 A;  3N71 A;  5ARG A;  3KMA A;  3RIB A;  5JIN A;  3K5K A;  3MO0 A;  3BO5 A;  5F5E A;  3S7J A;  3VV0 A;  5AYF A;  2IGQ A;  4J8O A;  4FMU A;  1N6C A;  1XQH A;  3DB5 A;  3M5A A;  4JLG A;  3IHX A;  3S7B A;  5LSZ A;  4RZ0 A;  2W5Y A;  3M54 A;  4QEP A;  1MVH A;  3MEK A;  5T0M A;  4MI0 A;  5HQ8 A;  4YPE A;  4J7F A;  5TTF A;  4WUY A;  3DAL A;  5F59 A;  3OPE A;  5JHN A;  4QEO A;  4YPU A;  2RFI A;  4YNM A;  2JV0 A;  3M55 A;  3HNA A;  1MT6 A;  1MUF A;  1PEG A;  1N3J A;  5LSX A;  3VUZ A;  1N6A A;  4J7I A;  2BQZ A;  3RU0 A;  1O9S A;  3F9X A;  5T5G A;  4H12 A;  5HI7 A;  4J83 A;  3TG4 A;  5ARF A; 
#chains in the Genus database with same CATH homology
 3OXG A;  3F9Y A;  5KJN A;  5KJK A;  1H3I A;  3FPD A;  4LDG A;  3RAY A;  3OXL A;  5EG2 A;  3CBO A;  4YPA A;  5T0K A;  5KJL A;  1ML9 A;  4C1Q A;  3KMJ A;  4BUP A;  3S7F A;  3M59 A;  2F69 A;  4O30 A;  3F9W A;  4AU7 A;  4MI5 A;  3M57 A;  5CCL A;  4YND A;  2QPW A;  3QWV A;  3MO2 A;  2W5Z A;  3SWC A;  4E47 A;  3CBM A;  4NVQ A;  5CCM A;  3M56 A;  5JJ0 A;  3OOI A;  3RQ4 A;  3F9Z A;  1ZKK A;  5F6L A;  5F6K C;  5EX0 A;  3S7D A;  1MVX A;  4O6F A;  3SW9 A;  4QEN A;  5KJM A;  3OXF A;  3QWW A;  5EX3 A;  3KMT A;  4JDS A;  4NJ5 A;  4IJ8 A;  3OS5 A;  3TG5 A;  5JIY A;  3PDN A;  5TH7 A;  3EP0 A;  3RJW A;  3M58 A;  3M53 A;  5CPR B;  5TEG A;  4YNP A;  3CBP A;  3S8P A;  4Z4P A;  3QWP A;  4I51 A;  2G46 A;  2R3A A;  4IJD A;  2O8J A;  3MO5 A;  3N71 A;  5ARG A;  3KMA A;  3RIB A;  5JIN A;  3K5K A;  3MO0 A;  3BO5 A;  5F5E A;  3S7J A;  3VV0 A;  5AYF A;  2IGQ A;  4J8O A;  4FMU A;  1N6C A;  1XQH A;  3DB5 A;  3M5A A;  4JLG A;  3IHX A;  3S7B A;  5LSZ A;  4RZ0 A;  2W5Y A;  3M54 A;  4QEP A;  1MVH A;  3MEK A;  5T0M A;  4MI0 A;  5HQ8 A;  4YPE A;  4J7F A;  5TTF A;  4WUY A;  3DAL A;  5F59 A;  3OPE A;  5JHN A;  4QEO A;  4YPU A;  2RFI A;  4YNM A;  2JV0 A;  3M55 A;  3HNA A;  1MT6 A;  1MUF A;  1PEG A;  1N3J A;  5LSX A;  3VUZ A;  1N6A A;  4J7I A;  2BQZ A;  3RU0 A;  1O9S A;  3F9X A;  5T5G A;  4H12 A;  5HI7 A;  4J83 A;  3TG4 A;  5ARF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...