4MI0A

Human enhancer of zeste (drosophila) homolog 2(ezh2)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
210
structure length
208
Chain Sequence
YQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase EZH2
publication title Structure of the catalytic domain of EZH2 reveals conformational plasticity in cofactor and substrate binding sites and explains oncogenic mutations.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 208
sequence length 210
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF18264 preSET_CXC CXC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4mi0A00
3QWVA 4MI0A 5JINA 3OXGA 5HI7A 1MT6A 5TH7A 3VUZA 4NVQA 5EX3A 4MI5A 3F9ZA 5LSZA 1O9SA 4IJDA 3CBOA 4O30A 4WUYA 3TG5A 2O8JA 3DALA 2G46A 1MUFA 4O6FA 3TG4A 4JLGA 3EP0A 4FMUA 3BO5A 3SW9A 1MVHA 3DB5A 4BUPA 2RFIA 4JDSA 4LDGA 4J7FA 3QWPA 3RAYA 3M57A 3QWWA 3F9WA 3OOIA 4QENA 4YPEA 2W5YA 2F69A 5AYFA 5F6KC 4QEOA 3M58A 5T0MA 4RZ0A 1N3JA 5CCMA 5EG2A 4J7IA 3S7JA 5KJLA 3KMJA 5JIYA 3F9XA 5F59A 3SWCA 5TTFA 3IHXA 4QEPA 3S7FA 5KJNA 3MO5A 1H3IA 3MEKA 5JJ0A 3F9YA 5KJMA 3MO0A 4YNPA 2QPWA 5EX0A 4J8OA 3RU0A 3K5KA 4AU7A 4IJ8A 3M54A 2IGQA 4Z4PA 3M56A 5LSXA 4YPAA 2W5ZA 5CPRB 1ZKKA 5ARFA 3N71A 3KMAA 1XQHA 3MO2A 1PEGA 4YNMA 3OXLA 3OXFA 2R3AA 3HNAA 3M55A 1MVXA 1ML9A 2BQZA 5T0KA 3M5AA 4C1QA 3M53A 3OS5A 5TEGA 5CCLA 5KJKA 3FPDA 4H12A 4YNDA 3S8PA 3S7DA 3CBPA 4YPUA 3CBMA 3OPEA 5F5EA 5F6LA 3KMTA 5HQ8A 5JHNA 1N6AA 3RJWA 3RQ4A 3PDNA 3S7BA 3M59A 5ARGA 4E47A 5T5GA 4I51A 4NJ5A 3VV0A 1N6CA 4J83A 3RIBA 2JV0A
chains in the Genus database with same CATH superfamily
3QWVA 4MI0A 5JINA 3OXGA 5HI7A 1MT6A 5TH7A 3VUZA 4NVQA 5EX3A 4MI5A 3F9ZA 5LSZA 1O9SA 4IJDA 3CBOA 4O30A 4WUYA 3TG5A 2O8JA 3DALA 2G46A 1MUFA 4O6FA 3TG4A 4JLGA 3EP0A 4FMUA 3BO5A 3SW9A 1MVHA 3DB5A 4BUPA 2RFIA 4JDSA 4LDGA 4J7FA 3QWPA 3RAYA 3M57A 3QWWA 3F9WA 3OOIA 4QENA 4YPEA 2W5YA 2F69A 5AYFA 5F6KC 4QEOA 3M58A 5T0MA 4RZ0A 1N3JA 5CCMA 5EG2A 4J7IA 3S7JA 5KJLA 3KMJA 5JIYA 3F9XA 5F59A 3SWCA 5TTFA 3IHXA 4QEPA 3S7FA 5KJNA 3MO5A 1H3IA 3MEKA 5JJ0A 3F9YA 5KJMA 3MO0A 4YNPA 2QPWA 5EX0A 4J8OA 3RU0A 3K5KA 4AU7A 4IJ8A 3M54A 2IGQA 4Z4PA 3M56A 5LSXA 4YPAA 2W5ZA 5CPRB 1ZKKA 5ARFA 3N71A 3KMAA 1XQHA 3MO2A 1PEGA 4YNMA 3OXLA 3OXFA 2R3AA 3HNAA 3M55A 1MVXA 1ML9A 2BQZA 5T0KA 3M5AA 4C1QA 3M53A 3OS5A 5TEGA 5CCLA 5KJKA 3FPDA 4H12A 4YNDA 3S8PA 3S7DA 3CBPA 4YPUA 3CBMA 3OPEA 5F5EA 5F6LA 3KMTA 5HQ8A 5JHNA 1N6AA 3RJWA 3RQ4A 3PDNA 3S7BA 3M59A 5ARGA 4E47A 5T5GA 4I51A 4NJ5A 3VV0A 1N6CA 4J83A 3RIBA 2JV0A
chains in the Genus database with same CATH topology
3QWVA 4MI0A 5JINA 3OXGA 5HI7A 1MT6A 5TH7A 3VUZA 4NVQA 5EX3A 4MI5A 3F9ZA 5LSZA 1O9SA 4IJDA 3CBOA 4O30A 4WUYA 3TG5A 2O8JA 3DALA 2G46A 1MUFA 4O6FA 3TG4A 4JLGA 3EP0A 4FMUA 3BO5A 3SW9A 1MVHA 3DB5A 4BUPA 2RFIA 4JDSA 4LDGA 4J7FA 3QWPA 3RAYA 3M57A 3QWWA 3F9WA 3OOIA 4QENA 4YPEA 2W5YA 2F69A 5AYFA 5F6KC 4QEOA 3M58A 5T0MA 4RZ0A 1N3JA 5CCMA 5EG2A 4J7IA 3S7JA 5KJLA 3KMJA 5JIYA 3F9XA 5F59A 3SWCA 5TTFA 3IHXA 4QEPA 3S7FA 5KJNA 3MO5A 1H3IA 3MEKA 5JJ0A 3F9YA 5KJMA 3MO0A 4YNPA 2QPWA 5EX0A 4J8OA 3RU0A 3K5KA 4AU7A 4IJ8A 3M54A 2IGQA 4Z4PA 3M56A 5LSXA 4YPAA 2W5ZA 5CPRB 1ZKKA 5ARFA 3N71A 3KMAA 1XQHA 3MO2A 1PEGA 4YNMA 3OXLA 3OXFA 2R3AA 3HNAA 3M55A 1MVXA 1ML9A 2BQZA 5T0KA 3M5AA 4C1QA 3M53A 3OS5A 5TEGA 5CCLA 5KJKA 3FPDA 4H12A 4YNDA 3S8PA 3S7DA 3CBPA 4YPUA 3CBMA 3OPEA 5F5EA 5F6LA 3KMTA 5HQ8A 5JHNA 1N6AA 3RJWA 3RQ4A 3PDNA 3S7BA 3M59A 5ARGA 4E47A 5T5GA 4I51A 4NJ5A 3VV0A 1N6CA 4J83A 3RIBA 2JV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWV A;  4MI0 A;  5JIN A;  3OXG A;  5HI7 A;  1MT6 A;  5TH7 A;  3VUZ A;  4NVQ A;  5EX3 A;  4MI5 A;  3F9Z A;  5LSZ A;  1O9S A;  4IJD A;  3CBO A;  4O30 A;  4WUY A;  3TG5 A;  2O8J A;  3DAL A;  2G46 A;  1MUF A;  4O6F A;  3TG4 A;  4JLG A;  3EP0 A;  4FMU A;  3BO5 A;  3SW9 A;  1MVH A;  3DB5 A;  4BUP A;  2RFI A;  4JDS A;  4LDG A;  4J7F A;  3QWP A;  3RAY A;  3M57 A;  3QWW A;  3F9W A;  3OOI A;  4QEN A;  4YPE A;  2W5Y A;  2F69 A;  5AYF A;  5F6K C;  4QEO A;  3M58 A;  5T0M A;  4RZ0 A;  1N3J A;  5CCM A;  5EG2 A;  4J7I A;  3S7J A;  5KJL A;  3KMJ A;  5JIY A;  3F9X A;  5F59 A;  3SWC A;  5TTF A;  3IHX A;  4QEP A;  3S7F A;  5KJN A;  3MO5 A;  1H3I A;  3MEK A;  5JJ0 A;  3F9Y A;  5KJM A;  3MO0 A;  4YNP A;  2QPW A;  5EX0 A;  4J8O A;  3RU0 A;  3K5K A;  4AU7 A;  4IJ8 A;  3M54 A;  2IGQ A;  4Z4P A;  3M56 A;  5LSX A;  4YPA A;  2W5Z A;  5CPR B;  1ZKK A;  5ARF A;  3N71 A;  3KMA A;  1XQH A;  3MO2 A;  1PEG A;  4YNM A;  3OXL A;  3OXF A;  2R3A A;  3HNA A;  3M55 A;  1MVX A;  1ML9 A;  2BQZ A;  5T0K A;  3M5A A;  4C1Q A;  3M53 A;  3OS5 A;  5TEG A;  5CCL A;  5KJK A;  3FPD A;  4H12 A;  4YND A;  3S8P A;  3S7D A;  3CBP A;  4YPU A;  3CBM A;  3OPE A;  5F5E A;  5F6L A;  3KMT A;  5HQ8 A;  5JHN A;  1N6A A;  3RJW A;  3RQ4 A;  3PDN A;  3S7B A;  3M59 A;  5ARG A;  4E47 A;  5T5G A;  4I51 A;  4NJ5 A;  3VV0 A;  1N6C A;  4J83 A;  3RIB A;  2JV0 A; 
#chains in the Genus database with same CATH topology
 3QWV A;  4MI0 A;  5JIN A;  3OXG A;  5HI7 A;  1MT6 A;  5TH7 A;  3VUZ A;  4NVQ A;  5EX3 A;  4MI5 A;  3F9Z A;  5LSZ A;  1O9S A;  4IJD A;  3CBO A;  4O30 A;  4WUY A;  3TG5 A;  2O8J A;  3DAL A;  2G46 A;  1MUF A;  4O6F A;  3TG4 A;  4JLG A;  3EP0 A;  4FMU A;  3BO5 A;  3SW9 A;  1MVH A;  3DB5 A;  4BUP A;  2RFI A;  4JDS A;  4LDG A;  4J7F A;  3QWP A;  3RAY A;  3M57 A;  3QWW A;  3F9W A;  3OOI A;  4QEN A;  4YPE A;  2W5Y A;  2F69 A;  5AYF A;  5F6K C;  4QEO A;  3M58 A;  5T0M A;  4RZ0 A;  1N3J A;  5CCM A;  5EG2 A;  4J7I A;  3S7J A;  5KJL A;  3KMJ A;  5JIY A;  3F9X A;  5F59 A;  3SWC A;  5TTF A;  3IHX A;  4QEP A;  3S7F A;  5KJN A;  3MO5 A;  1H3I A;  3MEK A;  5JJ0 A;  3F9Y A;  5KJM A;  3MO0 A;  4YNP A;  2QPW A;  5EX0 A;  4J8O A;  3RU0 A;  3K5K A;  4AU7 A;  4IJ8 A;  3M54 A;  2IGQ A;  4Z4P A;  3M56 A;  5LSX A;  4YPA A;  2W5Z A;  5CPR B;  1ZKK A;  5ARF A;  3N71 A;  3KMA A;  1XQH A;  3MO2 A;  1PEG A;  4YNM A;  3OXL A;  3OXF A;  2R3A A;  3HNA A;  3M55 A;  1MVX A;  1ML9 A;  2BQZ A;  5T0K A;  3M5A A;  4C1Q A;  3M53 A;  3OS5 A;  5TEG A;  5CCL A;  5KJK A;  3FPD A;  4H12 A;  4YND A;  3S8P A;  3S7D A;  3CBP A;  4YPU A;  3CBM A;  3OPE A;  5F5E A;  5F6L A;  3KMT A;  5HQ8 A;  5JHN A;  1N6A A;  3RJW A;  3RQ4 A;  3PDN A;  3S7B A;  3M59 A;  5ARG A;  4E47 A;  5T5G A;  4I51 A;  4NJ5 A;  3VV0 A;  1N6C A;  4J83 A;  3RIB A;  2JV0 A; 
#chains in the Genus database with same CATH homology
 3QWV A;  4MI0 A;  5JIN A;  3OXG A;  5HI7 A;  1MT6 A;  5TH7 A;  3VUZ A;  4NVQ A;  5EX3 A;  4MI5 A;  3F9Z A;  5LSZ A;  1O9S A;  4IJD A;  3CBO A;  4O30 A;  4WUY A;  3TG5 A;  2O8J A;  3DAL A;  2G46 A;  1MUF A;  4O6F A;  3TG4 A;  4JLG A;  3EP0 A;  4FMU A;  3BO5 A;  3SW9 A;  1MVH A;  3DB5 A;  4BUP A;  2RFI A;  4JDS A;  4LDG A;  4J7F A;  3QWP A;  3RAY A;  3M57 A;  3QWW A;  3F9W A;  3OOI A;  4QEN A;  4YPE A;  2W5Y A;  2F69 A;  5AYF A;  5F6K C;  4QEO A;  3M58 A;  5T0M A;  4RZ0 A;  1N3J A;  5CCM A;  5EG2 A;  4J7I A;  3S7J A;  5KJL A;  3KMJ A;  5JIY A;  3F9X A;  5F59 A;  3SWC A;  5TTF A;  3IHX A;  4QEP A;  3S7F A;  5KJN A;  3MO5 A;  1H3I A;  3MEK A;  5JJ0 A;  3F9Y A;  5KJM A;  3MO0 A;  4YNP A;  2QPW A;  5EX0 A;  4J8O A;  3RU0 A;  3K5K A;  4AU7 A;  4IJ8 A;  3M54 A;  2IGQ A;  4Z4P A;  3M56 A;  5LSX A;  4YPA A;  2W5Z A;  5CPR B;  1ZKK A;  5ARF A;  3N71 A;  3KMA A;  1XQH A;  3MO2 A;  1PEG A;  4YNM A;  3OXL A;  3OXF A;  2R3A A;  3HNA A;  3M55 A;  1MVX A;  1ML9 A;  2BQZ A;  5T0K A;  3M5A A;  4C1Q A;  3M53 A;  3OS5 A;  5TEG A;  5CCL A;  5KJK A;  3FPD A;  4H12 A;  4YND A;  3S8P A;  3S7D A;  3CBP A;  4YPU A;  3CBM A;  3OPE A;  5F5E A;  5F6L A;  3KMT A;  5HQ8 A;  5JHN A;  1N6A A;  3RJW A;  3RQ4 A;  3PDN A;  3S7B A;  3M59 A;  5ARG A;  4E47 A;  5T5G A;  4I51 A;  4NJ5 A;  3VV0 A;  1N6C A;  4J83 A;  3RIB A;  2JV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...