4MI0A

Human enhancer of zeste (drosophila) homolog 2(ezh2)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
210
structure length
208
Chain Sequence
b'YQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase EZH2
molecule tags Transferase
source organism Homo sapiens
publication title Structure of the catalytic domain of EZH2 reveals conformational plasticity in cofactor and substrate binding sites and explains oncogenic mutations.
pubmed doi rcsb
total genus 46
structure length 208
sequence length 210
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF18264 preSET_CXC CXC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4mi0A00
3S8PA 1XQHA 4RZ0A 3S7FA 4MI0A 3F9WA 5F59A 3RU0A 3KMAA 3RJWA 3M59A 2BQZA 3VUZA 3F9ZA 3MEKA 3BO5A 3KMJA 2F69A 3SW9A 3M54A 1PEGA 1N6AA 5KJNA 1MUFA 3RQ4A 3SWCA 5T5GA 5KJMA 3CBMA 3OPEA 5CPRB 4LDGA 5TTFA 4QENA 4I51A 2W5YA 3QWPA 3M56A 1ZKKA 3CBOA 3M53A 3M58A 3OOIA 1N3JA 4YNPA 1H3IA 3MO2A 3EP0A 1N6CA 5ARFA 5T0MA 3DALA 4J83A 5KJLA 3QWVA 1MVHA 4J7IA 5JHNA 2O8JA 2R3AA 4NVQA 3OXLA 3CBPA 3IHXA 4JDSA 4YPAA 5ARGA 4O6FA 5AYFA 5CCMA 5KJKA 5LSZA 5EX3A 3OXGA 4J8OA 3M57A 3S7JA 4MI5A 5T0KA 4AU7A 3RAYA 3M55A 4YNMA 3MO5A 2QPWA 3OXFA 1MT6A 5TEGA 3OS5A 3N71A 3TG5A 2W5ZA 1O9SA 4BUPA 5F6LA 4QEOA 5JINA 5JIYA 5F5EA 1MVXA 5TH7A 4IJ8A 3K5KA 1ML9A 3M5AA 4IJDA 3HNAA 4J7FA 2RFIA 4QEPA 4C1QA 3TG4A 5CCLA 4JLGA 2G46A 3S7BA 2JV0A 3QWWA 4NJ5A 4E47A 3KMTA 4O30A 4WUYA 4YNDA 3FPDA 5LSXA 5F6KC 3MO0A 5EX0A 4YPEA 3S7DA 2IGQA 3PDNA 4H12A 3RIBA 4Z4PA 3DB5A 4YPUA 5HQ8A 5JJ0A 3F9XA 5HI7A 4FMUA 3F9YA 3VV0A 5EG2A
chains in the Genus database with same CATH superfamily
3S8PA 1XQHA 4RZ0A 3S7FA 4MI0A 3F9WA 5F59A 3RU0A 3KMAA 3RJWA 3M59A 2BQZA 3VUZA 3F9ZA 3MEKA 3BO5A 3KMJA 2F69A 3SW9A 3M54A 1PEGA 1N6AA 5KJNA 1MUFA 3RQ4A 3SWCA 5T5GA 5KJMA 3CBMA 3OPEA 5CPRB 4LDGA 5TTFA 4QENA 4I51A 2W5YA 3QWPA 3M56A 1ZKKA 3CBOA 3M53A 3M58A 3OOIA 1N3JA 4YNPA 1H3IA 3MO2A 3EP0A 1N6CA 5ARFA 5T0MA 3DALA 4J83A 5KJLA 3QWVA 1MVHA 4J7IA 5JHNA 2O8JA 2R3AA 4NVQA 3OXLA 3CBPA 3IHXA 4JDSA 4YPAA 5ARGA 4O6FA 5AYFA 5CCMA 5KJKA 5LSZA 5EX3A 3OXGA 4J8OA 3M57A 3S7JA 4MI5A 5T0KA 4AU7A 3RAYA 3M55A 4YNMA 3MO5A 2QPWA 3OXFA 1MT6A 5TEGA 3OS5A 3N71A 3TG5A 2W5ZA 1O9SA 4BUPA 5F6LA 4QEOA 5JINA 5JIYA 5F5EA 1MVXA 5TH7A 4IJ8A 3K5KA 1ML9A 3M5AA 4IJDA 3HNAA 4J7FA 2RFIA 4QEPA 4C1QA 3TG4A 5CCLA 4JLGA 2G46A 3S7BA 2JV0A 3QWWA 4NJ5A 4E47A 3KMTA 4O30A 4WUYA 4YNDA 3FPDA 5LSXA 5F6KC 3MO0A 5EX0A 4YPEA 3S7DA 2IGQA 3PDNA 4H12A 3RIBA 4Z4PA 3DB5A 4YPUA 5HQ8A 5JJ0A 3F9XA 5HI7A 4FMUA 3F9YA 3VV0A 5EG2A
chains in the Genus database with same CATH topology
3S8PA 1XQHA 4RZ0A 3S7FA 4MI0A 3F9WA 5F59A 3RU0A 3KMAA 3RJWA 3M59A 2BQZA 3VUZA 3F9ZA 3MEKA 3BO5A 3KMJA 2F69A 3SW9A 3M54A 1PEGA 1N6AA 5KJNA 1MUFA 3RQ4A 3SWCA 5T5GA 5KJMA 3CBMA 3OPEA 5CPRB 4LDGA 5TTFA 4QENA 4I51A 2W5YA 3QWPA 3M56A 1ZKKA 3CBOA 3M53A 3M58A 3OOIA 1N3JA 4YNPA 1H3IA 3MO2A 3EP0A 1N6CA 5ARFA 5T0MA 3DALA 4J83A 5KJLA 3QWVA 1MVHA 4J7IA 5JHNA 2O8JA 2R3AA 4NVQA 3OXLA 3CBPA 3IHXA 4JDSA 4YPAA 5ARGA 4O6FA 5AYFA 5CCMA 5KJKA 5LSZA 5EX3A 3OXGA 4J8OA 3M57A 3S7JA 4MI5A 5T0KA 4AU7A 3RAYA 3M55A 4YNMA 3MO5A 2QPWA 3OXFA 1MT6A 5TEGA 3OS5A 3N71A 3TG5A 2W5ZA 1O9SA 4BUPA 5F6LA 4QEOA 5JINA 5JIYA 5F5EA 1MVXA 5TH7A 4IJ8A 3K5KA 1ML9A 3M5AA 4IJDA 3HNAA 4J7FA 2RFIA 4QEPA 4C1QA 3TG4A 5CCLA 4JLGA 2G46A 3S7BA 2JV0A 3QWWA 4NJ5A 4E47A 3KMTA 4O30A 4WUYA 4YNDA 3FPDA 5LSXA 5F6KC 3MO0A 5EX0A 4YPEA 3S7DA 2IGQA 3PDNA 4H12A 3RIBA 4Z4PA 3DB5A 4YPUA 5HQ8A 5JJ0A 3F9XA 5HI7A 4FMUA 3F9YA 3VV0A 5EG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S8P A;  1XQH A;  4RZ0 A;  3S7F A;  4MI0 A;  3F9W A;  5F59 A;  3RU0 A;  3KMA A;  3RJW A;  3M59 A;  2BQZ A;  3VUZ A;  3F9Z A;  3MEK A;  3BO5 A;  3KMJ A;  2F69 A;  3SW9 A;  3M54 A;  1PEG A;  1N6A A;  5KJN A;  1MUF A;  3RQ4 A;  3SWC A;  5T5G A;  5KJM A;  3CBM A;  3OPE A;  5CPR B;  4LDG A;  5TTF A;  4QEN A;  4I51 A;  2W5Y A;  3QWP A;  3M56 A;  1ZKK A;  3CBO A;  3M53 A;  3M58 A;  3OOI A;  1N3J A;  4YNP A;  1H3I A;  3MO2 A;  3EP0 A;  1N6C A;  5ARF A;  5T0M A;  3DAL A;  4J83 A;  5KJL A;  3QWV A;  1MVH A;  4J7I A;  5JHN A;  2O8J A;  2R3A A;  4NVQ A;  3OXL A;  3CBP A;  3IHX A;  4JDS A;  4YPA A;  5ARG A;  4O6F A;  5AYF A;  5CCM A;  5KJK A;  5LSZ A;  5EX3 A;  3OXG A;  4J8O A;  3M57 A;  3S7J A;  4MI5 A;  5T0K A;  4AU7 A;  3RAY A;  3M55 A;  4YNM A;  3MO5 A;  2QPW A;  3OXF A;  1MT6 A;  5TEG A;  3OS5 A;  3N71 A;  3TG5 A;  2W5Z A;  1O9S A;  4BUP A;  5F6L A;  4QEO A;  5JIN A;  5JIY A;  5F5E A;  1MVX A;  5TH7 A;  4IJ8 A;  3K5K A;  1ML9 A;  3M5A A;  4IJD A;  3HNA A;  4J7F A;  2RFI A;  4QEP A;  4C1Q A;  3TG4 A;  5CCL A;  4JLG A;  2G46 A;  3S7B A;  2JV0 A;  3QWW A;  4NJ5 A;  4E47 A;  3KMT A;  4O30 A;  4WUY A;  4YND A;  3FPD A;  5LSX A;  5F6K C;  3MO0 A;  5EX0 A;  4YPE A;  3S7D A;  2IGQ A;  3PDN A;  4H12 A;  3RIB A;  4Z4P A;  3DB5 A;  4YPU A;  5HQ8 A;  5JJ0 A;  3F9X A;  5HI7 A;  4FMU A;  3F9Y A;  3VV0 A;  5EG2 A; 
#chains in the Genus database with same CATH topology
 3S8P A;  1XQH A;  4RZ0 A;  3S7F A;  4MI0 A;  3F9W A;  5F59 A;  3RU0 A;  3KMA A;  3RJW A;  3M59 A;  2BQZ A;  3VUZ A;  3F9Z A;  3MEK A;  3BO5 A;  3KMJ A;  2F69 A;  3SW9 A;  3M54 A;  1PEG A;  1N6A A;  5KJN A;  1MUF A;  3RQ4 A;  3SWC A;  5T5G A;  5KJM A;  3CBM A;  3OPE A;  5CPR B;  4LDG A;  5TTF A;  4QEN A;  4I51 A;  2W5Y A;  3QWP A;  3M56 A;  1ZKK A;  3CBO A;  3M53 A;  3M58 A;  3OOI A;  1N3J A;  4YNP A;  1H3I A;  3MO2 A;  3EP0 A;  1N6C A;  5ARF A;  5T0M A;  3DAL A;  4J83 A;  5KJL A;  3QWV A;  1MVH A;  4J7I A;  5JHN A;  2O8J A;  2R3A A;  4NVQ A;  3OXL A;  3CBP A;  3IHX A;  4JDS A;  4YPA A;  5ARG A;  4O6F A;  5AYF A;  5CCM A;  5KJK A;  5LSZ A;  5EX3 A;  3OXG A;  4J8O A;  3M57 A;  3S7J A;  4MI5 A;  5T0K A;  4AU7 A;  3RAY A;  3M55 A;  4YNM A;  3MO5 A;  2QPW A;  3OXF A;  1MT6 A;  5TEG A;  3OS5 A;  3N71 A;  3TG5 A;  2W5Z A;  1O9S A;  4BUP A;  5F6L A;  4QEO A;  5JIN A;  5JIY A;  5F5E A;  1MVX A;  5TH7 A;  4IJ8 A;  3K5K A;  1ML9 A;  3M5A A;  4IJD A;  3HNA A;  4J7F A;  2RFI A;  4QEP A;  4C1Q A;  3TG4 A;  5CCL A;  4JLG A;  2G46 A;  3S7B A;  2JV0 A;  3QWW A;  4NJ5 A;  4E47 A;  3KMT A;  4O30 A;  4WUY A;  4YND A;  3FPD A;  5LSX A;  5F6K C;  3MO0 A;  5EX0 A;  4YPE A;  3S7D A;  2IGQ A;  3PDN A;  4H12 A;  3RIB A;  4Z4P A;  3DB5 A;  4YPU A;  5HQ8 A;  5JJ0 A;  3F9X A;  5HI7 A;  4FMU A;  3F9Y A;  3VV0 A;  5EG2 A; 
#chains in the Genus database with same CATH homology
 3S8P A;  1XQH A;  4RZ0 A;  3S7F A;  4MI0 A;  3F9W A;  5F59 A;  3RU0 A;  3KMA A;  3RJW A;  3M59 A;  2BQZ A;  3VUZ A;  3F9Z A;  3MEK A;  3BO5 A;  3KMJ A;  2F69 A;  3SW9 A;  3M54 A;  1PEG A;  1N6A A;  5KJN A;  1MUF A;  3RQ4 A;  3SWC A;  5T5G A;  5KJM A;  3CBM A;  3OPE A;  5CPR B;  4LDG A;  5TTF A;  4QEN A;  4I51 A;  2W5Y A;  3QWP A;  3M56 A;  1ZKK A;  3CBO A;  3M53 A;  3M58 A;  3OOI A;  1N3J A;  4YNP A;  1H3I A;  3MO2 A;  3EP0 A;  1N6C A;  5ARF A;  5T0M A;  3DAL A;  4J83 A;  5KJL A;  3QWV A;  1MVH A;  4J7I A;  5JHN A;  2O8J A;  2R3A A;  4NVQ A;  3OXL A;  3CBP A;  3IHX A;  4JDS A;  4YPA A;  5ARG A;  4O6F A;  5AYF A;  5CCM A;  5KJK A;  5LSZ A;  5EX3 A;  3OXG A;  4J8O A;  3M57 A;  3S7J A;  4MI5 A;  5T0K A;  4AU7 A;  3RAY A;  3M55 A;  4YNM A;  3MO5 A;  2QPW A;  3OXF A;  1MT6 A;  5TEG A;  3OS5 A;  3N71 A;  3TG5 A;  2W5Z A;  1O9S A;  4BUP A;  5F6L A;  4QEO A;  5JIN A;  5JIY A;  5F5E A;  1MVX A;  5TH7 A;  4IJ8 A;  3K5K A;  1ML9 A;  3M5A A;  4IJD A;  3HNA A;  4J7F A;  2RFI A;  4QEP A;  4C1Q A;  3TG4 A;  5CCL A;  4JLG A;  2G46 A;  3S7B A;  2JV0 A;  3QWW A;  4NJ5 A;  4E47 A;  3KMT A;  4O30 A;  4WUY A;  4YND A;  3FPD A;  5LSX A;  5F6K C;  3MO0 A;  5EX0 A;  4YPE A;  3S7D A;  2IGQ A;  3PDN A;  4H12 A;  3RIB A;  4Z4P A;  3DB5 A;  4YPU A;  5HQ8 A;  5JJ0 A;  3F9X A;  5HI7 A;  4FMU A;  3F9Y A;  3VV0 A;  5EG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...