4MI0A

Human enhancer of zeste (drosophila) homolog 2(ezh2)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
210
structure length
208
Chain Sequence
YQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase EZH2
publication title Structure of the catalytic domain of EZH2 reveals conformational plasticity in cofactor and substrate binding sites and explains oncogenic mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 46
structure length 208
sequence length 210
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF18264 preSET_CXC CXC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4mi0A00
4H12A 3MO2A 5ARGA 1N6AA 4O30A 5EX0A 3F9YA 4YNDA 4JDSA 1ZKKA 3KMTA 3IHXA 4LDGA 2W5YA 5KJMA 3DB5A 3M56A 2IGQA 3SW9A 3OS5A 1O9SA 5JIYA 5F59A 3OPEA 3S7JA 1H3IA 2W5ZA 4AU7A 1N3JA 3KMAA 3BO5A 3M57A 3PDNA 4YPEA 5T0MA 4J83A 4YPAA 3OOIA 4I51A 2F69A 4QEOA 4NVQA 5KJKA 3SWCA 1PEGA 4J8OA 4J7FA 5F5EA 5JHNA 5AYFA 3M53A 3TG4A 3HNAA 5EG2A 5EX3A 2G46A 3N71A 5ARFA 3QWVA 5TEGA 3CBOA 3CBMA 5LSXA 4QEPA 3OXGA 1MVXA 5CCLA 2JV0A 3KMJA 4MI5A 3EP0A 4IJDA 5T5GA 3VUZA 5JJ0A 4YNPA 5CCMA 5KJLA 4YPUA 4WUYA 3FPDA 1MUFA 3OXLA 3RJWA 4E47A 5TTFA 3S8PA 3M58A 3K5KA 1XQHA 3MO5A 4O6FA 2R3AA 3MO0A 3RIBA 4BUPA 1MT6A 4NJ5A 3QWPA 3TG5A 3M5AA 5HI7A 3F9XA 3F9ZA 3M55A 4J7IA 1MVHA 3RU0A 3RQ4A 4IJ8A 3CBPA 5T0KA 5CPRB 5F6LA 3M54A 4JLGA 4RZ0A 4Z4PA 3F9WA 3S7DA 4QENA 3S7BA 5F6KC 3QWWA 3S7FA 5TH7A 3M59A 4FMUA 2BQZA 1ML9A 3OXFA 3RAYA 5KJNA 3VV0A 2O8JA 2RFIA 5JINA 3DALA 4YNMA 3MEKA 2QPWA 5HQ8A 5LSZA 4C1QA 4MI0A 1N6CA
chains in the Genus database with same CATH superfamily
4H12A 3MO2A 5ARGA 1N6AA 4O30A 5EX0A 3F9YA 4YNDA 4JDSA 1ZKKA 3KMTA 3IHXA 4LDGA 2W5YA 5KJMA 3DB5A 3M56A 2IGQA 3SW9A 3OS5A 1O9SA 5JIYA 5F59A 3OPEA 3S7JA 1H3IA 2W5ZA 4AU7A 1N3JA 3KMAA 3BO5A 3M57A 3PDNA 4YPEA 5T0MA 4J83A 4YPAA 3OOIA 4I51A 2F69A 4QEOA 4NVQA 5KJKA 3SWCA 1PEGA 4J8OA 4J7FA 5F5EA 5JHNA 5AYFA 3M53A 3TG4A 3HNAA 5EG2A 5EX3A 2G46A 3N71A 5ARFA 3QWVA 5TEGA 3CBOA 3CBMA 5LSXA 4QEPA 3OXGA 1MVXA 5CCLA 2JV0A 3KMJA 4MI5A 3EP0A 4IJDA 5T5GA 3VUZA 5JJ0A 4YNPA 5CCMA 5KJLA 4YPUA 4WUYA 3FPDA 1MUFA 3OXLA 3RJWA 4E47A 5TTFA 3S8PA 3M58A 3K5KA 1XQHA 3MO5A 4O6FA 2R3AA 3MO0A 3RIBA 4BUPA 1MT6A 4NJ5A 3QWPA 3TG5A 3M5AA 5HI7A 3F9XA 3F9ZA 3M55A 4J7IA 1MVHA 3RU0A 3RQ4A 4IJ8A 3CBPA 5T0KA 5CPRB 5F6LA 3M54A 4JLGA 4RZ0A 4Z4PA 3F9WA 3S7DA 4QENA 3S7BA 5F6KC 3QWWA 3S7FA 5TH7A 3M59A 4FMUA 2BQZA 1ML9A 3OXFA 3RAYA 5KJNA 3VV0A 2O8JA 2RFIA 5JINA 3DALA 4YNMA 3MEKA 2QPWA 5HQ8A 5LSZA 4C1QA 4MI0A 1N6CA
chains in the Genus database with same CATH topology
4H12A 3MO2A 5ARGA 1N6AA 4O30A 5EX0A 3F9YA 4YNDA 4JDSA 1ZKKA 3KMTA 3IHXA 4LDGA 2W5YA 5KJMA 3DB5A 3M56A 2IGQA 3SW9A 3OS5A 1O9SA 5JIYA 5F59A 3OPEA 3S7JA 1H3IA 2W5ZA 4AU7A 1N3JA 3KMAA 3BO5A 3M57A 3PDNA 4YPEA 5T0MA 4J83A 4YPAA 3OOIA 4I51A 2F69A 4QEOA 4NVQA 5KJKA 3SWCA 1PEGA 4J8OA 4J7FA 5F5EA 5JHNA 5AYFA 3M53A 3TG4A 3HNAA 5EG2A 5EX3A 2G46A 3N71A 5ARFA 3QWVA 5TEGA 3CBOA 3CBMA 5LSXA 4QEPA 3OXGA 1MVXA 5CCLA 2JV0A 3KMJA 4MI5A 3EP0A 4IJDA 5T5GA 3VUZA 5JJ0A 4YNPA 5CCMA 5KJLA 4YPUA 4WUYA 3FPDA 1MUFA 3OXLA 3RJWA 4E47A 5TTFA 3S8PA 3M58A 3K5KA 1XQHA 3MO5A 4O6FA 2R3AA 3MO0A 3RIBA 4BUPA 1MT6A 4NJ5A 3QWPA 3TG5A 3M5AA 5HI7A 3F9XA 3F9ZA 3M55A 4J7IA 1MVHA 3RU0A 3RQ4A 4IJ8A 3CBPA 5T0KA 5CPRB 5F6LA 3M54A 4JLGA 4RZ0A 4Z4PA 3F9WA 3S7DA 4QENA 3S7BA 5F6KC 3QWWA 3S7FA 5TH7A 3M59A 4FMUA 2BQZA 1ML9A 3OXFA 3RAYA 5KJNA 3VV0A 2O8JA 2RFIA 5JINA 3DALA 4YNMA 3MEKA 2QPWA 5HQ8A 5LSZA 4C1QA 4MI0A 1N6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H12 A;  3MO2 A;  5ARG A;  1N6A A;  4O30 A;  5EX0 A;  3F9Y A;  4YND A;  4JDS A;  1ZKK A;  3KMT A;  3IHX A;  4LDG A;  2W5Y A;  5KJM A;  3DB5 A;  3M56 A;  2IGQ A;  3SW9 A;  3OS5 A;  1O9S A;  5JIY A;  5F59 A;  3OPE A;  3S7J A;  1H3I A;  2W5Z A;  4AU7 A;  1N3J A;  3KMA A;  3BO5 A;  3M57 A;  3PDN A;  4YPE A;  5T0M A;  4J83 A;  4YPA A;  3OOI A;  4I51 A;  2F69 A;  4QEO A;  4NVQ A;  5KJK A;  3SWC A;  1PEG A;  4J8O A;  4J7F A;  5F5E A;  5JHN A;  5AYF A;  3M53 A;  3TG4 A;  3HNA A;  5EG2 A;  5EX3 A;  2G46 A;  3N71 A;  5ARF A;  3QWV A;  5TEG A;  3CBO A;  3CBM A;  5LSX A;  4QEP A;  3OXG A;  1MVX A;  5CCL A;  2JV0 A;  3KMJ A;  4MI5 A;  3EP0 A;  4IJD A;  5T5G A;  3VUZ A;  5JJ0 A;  4YNP A;  5CCM A;  5KJL A;  4YPU A;  4WUY A;  3FPD A;  1MUF A;  3OXL A;  3RJW A;  4E47 A;  5TTF A;  3S8P A;  3M58 A;  3K5K A;  1XQH A;  3MO5 A;  4O6F A;  2R3A A;  3MO0 A;  3RIB A;  4BUP A;  1MT6 A;  4NJ5 A;  3QWP A;  3TG5 A;  3M5A A;  5HI7 A;  3F9X A;  3F9Z A;  3M55 A;  4J7I A;  1MVH A;  3RU0 A;  3RQ4 A;  4IJ8 A;  3CBP A;  5T0K A;  5CPR B;  5F6L A;  3M54 A;  4JLG A;  4RZ0 A;  4Z4P A;  3F9W A;  3S7D A;  4QEN A;  3S7B A;  5F6K C;  3QWW A;  3S7F A;  5TH7 A;  3M59 A;  4FMU A;  2BQZ A;  1ML9 A;  3OXF A;  3RAY A;  5KJN A;  3VV0 A;  2O8J A;  2RFI A;  5JIN A;  3DAL A;  4YNM A;  3MEK A;  2QPW A;  5HQ8 A;  5LSZ A;  4C1Q A;  4MI0 A;  1N6C A; 
#chains in the Genus database with same CATH topology
 4H12 A;  3MO2 A;  5ARG A;  1N6A A;  4O30 A;  5EX0 A;  3F9Y A;  4YND A;  4JDS A;  1ZKK A;  3KMT A;  3IHX A;  4LDG A;  2W5Y A;  5KJM A;  3DB5 A;  3M56 A;  2IGQ A;  3SW9 A;  3OS5 A;  1O9S A;  5JIY A;  5F59 A;  3OPE A;  3S7J A;  1H3I A;  2W5Z A;  4AU7 A;  1N3J A;  3KMA A;  3BO5 A;  3M57 A;  3PDN A;  4YPE A;  5T0M A;  4J83 A;  4YPA A;  3OOI A;  4I51 A;  2F69 A;  4QEO A;  4NVQ A;  5KJK A;  3SWC A;  1PEG A;  4J8O A;  4J7F A;  5F5E A;  5JHN A;  5AYF A;  3M53 A;  3TG4 A;  3HNA A;  5EG2 A;  5EX3 A;  2G46 A;  3N71 A;  5ARF A;  3QWV A;  5TEG A;  3CBO A;  3CBM A;  5LSX A;  4QEP A;  3OXG A;  1MVX A;  5CCL A;  2JV0 A;  3KMJ A;  4MI5 A;  3EP0 A;  4IJD A;  5T5G A;  3VUZ A;  5JJ0 A;  4YNP A;  5CCM A;  5KJL A;  4YPU A;  4WUY A;  3FPD A;  1MUF A;  3OXL A;  3RJW A;  4E47 A;  5TTF A;  3S8P A;  3M58 A;  3K5K A;  1XQH A;  3MO5 A;  4O6F A;  2R3A A;  3MO0 A;  3RIB A;  4BUP A;  1MT6 A;  4NJ5 A;  3QWP A;  3TG5 A;  3M5A A;  5HI7 A;  3F9X A;  3F9Z A;  3M55 A;  4J7I A;  1MVH A;  3RU0 A;  3RQ4 A;  4IJ8 A;  3CBP A;  5T0K A;  5CPR B;  5F6L A;  3M54 A;  4JLG A;  4RZ0 A;  4Z4P A;  3F9W A;  3S7D A;  4QEN A;  3S7B A;  5F6K C;  3QWW A;  3S7F A;  5TH7 A;  3M59 A;  4FMU A;  2BQZ A;  1ML9 A;  3OXF A;  3RAY A;  5KJN A;  3VV0 A;  2O8J A;  2RFI A;  5JIN A;  3DAL A;  4YNM A;  3MEK A;  2QPW A;  5HQ8 A;  5LSZ A;  4C1Q A;  4MI0 A;  1N6C A; 
#chains in the Genus database with same CATH homology
 4H12 A;  3MO2 A;  5ARG A;  1N6A A;  4O30 A;  5EX0 A;  3F9Y A;  4YND A;  4JDS A;  1ZKK A;  3KMT A;  3IHX A;  4LDG A;  2W5Y A;  5KJM A;  3DB5 A;  3M56 A;  2IGQ A;  3SW9 A;  3OS5 A;  1O9S A;  5JIY A;  5F59 A;  3OPE A;  3S7J A;  1H3I A;  2W5Z A;  4AU7 A;  1N3J A;  3KMA A;  3BO5 A;  3M57 A;  3PDN A;  4YPE A;  5T0M A;  4J83 A;  4YPA A;  3OOI A;  4I51 A;  2F69 A;  4QEO A;  4NVQ A;  5KJK A;  3SWC A;  1PEG A;  4J8O A;  4J7F A;  5F5E A;  5JHN A;  5AYF A;  3M53 A;  3TG4 A;  3HNA A;  5EG2 A;  5EX3 A;  2G46 A;  3N71 A;  5ARF A;  3QWV A;  5TEG A;  3CBO A;  3CBM A;  5LSX A;  4QEP A;  3OXG A;  1MVX A;  5CCL A;  2JV0 A;  3KMJ A;  4MI5 A;  3EP0 A;  4IJD A;  5T5G A;  3VUZ A;  5JJ0 A;  4YNP A;  5CCM A;  5KJL A;  4YPU A;  4WUY A;  3FPD A;  1MUF A;  3OXL A;  3RJW A;  4E47 A;  5TTF A;  3S8P A;  3M58 A;  3K5K A;  1XQH A;  3MO5 A;  4O6F A;  2R3A A;  3MO0 A;  3RIB A;  4BUP A;  1MT6 A;  4NJ5 A;  3QWP A;  3TG5 A;  3M5A A;  5HI7 A;  3F9X A;  3F9Z A;  3M55 A;  4J7I A;  1MVH A;  3RU0 A;  3RQ4 A;  4IJ8 A;  3CBP A;  5T0K A;  5CPR B;  5F6L A;  3M54 A;  4JLG A;  4RZ0 A;  4Z4P A;  3F9W A;  3S7D A;  4QEN A;  3S7B A;  5F6K C;  3QWW A;  3S7F A;  5TH7 A;  3M59 A;  4FMU A;  2BQZ A;  1ML9 A;  3OXF A;  3RAY A;  5KJN A;  3VV0 A;  2O8J A;  2RFI A;  5JIN A;  3DAL A;  4YNM A;  3MEK A;  2QPW A;  5HQ8 A;  5LSZ A;  4C1Q A;  4MI0 A;  1N6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...