4MI0A

Human enhancer of zeste (drosophila) homolog 2(ezh2)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
210
structure length
208
Chain Sequence
YQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the catalytic domain of EZH2 reveals conformational plasticity in cofactor and substrate binding sites and explains oncogenic mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase EZH2
total genus 46
structure length 208
sequence length 210
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF18264 preSET_CXC CXC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4mi0A00
3QWWA 5EX3A 5F5EA 2G46A 4H12A 1MVHA 2QPWA 3MEKA 4QEOA 3TG4A 3QWPA 2BQZA 3KMAA 3KMJA 3S7JA 2IGQA 3FPDA 3RJWA 5JIYA 4J8OA 5HQ8A 4QEPA 4IJ8A 4YNMA 3PDNA 4E47A 3F9XA 1N3JA 3M54A 4J83A 4LDGA 5TEGA 4NVQA 5HI7A 3CBMA 3SW9A 3CBOA 5F6KC 2RFIA 5LSZA 5ARGA 3BO5A 4MI5A 4IJDA 2O8JA 5F6LA 5ARFA 5T0KA 3RQ4A 3TG5A 5F59A 3OPEA 4C1QA 3OXGA 3CBPA 3M59A 3M55A 5AYFA 4Z4PA 2W5YA 4I51A 3F9YA 3OS5A 5KJNA 5LSXA 3RAYA 4AU7A 3S7BA 3RU0A 3VUZA 4YPEA 2W5ZA 3OXFA 5KJMA 5CCLA 3F9ZA 3MO0A 3M56A 3S8PA 1N6CA 1MUFA 4NJ5A 4QENA 4WUYA 3N71A 3DB5A 5TH7A 5JHNA 5TTFA 1MVXA 4O30A 5EX0A 4FMUA 5JINA 3MO5A 1O9SA 3K5KA 5EG2A 3KMTA 4RZ0A 4J7FA 3EP0A 3IHXA 4BUPA 2JV0A 4YPAA 3S7DA 3F9WA 4J7IA 4JLGA 1N6AA 3S7FA 4YNDA 3M57A 3VV0A 1ZKKA 1PEGA 3HNAA 5CCMA 5CPRB 5KJKA 1MT6A 5T5GA 5KJLA 3M58A 2R3AA 4YNPA 3RIBA 5T0MA 2F69A 3DALA 1ML9A 3M53A 5JJ0A 1H3IA 3QWVA 4JDSA 3OOIA 4MI0A 4YPUA 3MO2A 3OXLA 1XQHA 4O6FA 3SWCA 3M5AA
chains in the Genus database with same CATH superfamily
3QWWA 5EX3A 5F5EA 2G46A 4H12A 1MVHA 2QPWA 3MEKA 4QEOA 3TG4A 3QWPA 2BQZA 3KMAA 3KMJA 3S7JA 2IGQA 3FPDA 3RJWA 5JIYA 4J8OA 5HQ8A 4QEPA 4IJ8A 4YNMA 3PDNA 4E47A 3F9XA 1N3JA 3M54A 4J83A 4LDGA 5TEGA 4NVQA 5HI7A 3CBMA 3SW9A 3CBOA 5F6KC 2RFIA 5LSZA 5ARGA 3BO5A 4MI5A 4IJDA 2O8JA 5F6LA 5ARFA 5T0KA 3RQ4A 3TG5A 5F59A 3OPEA 4C1QA 3OXGA 3CBPA 3M59A 3M55A 5AYFA 4Z4PA 2W5YA 4I51A 3F9YA 3OS5A 5KJNA 5LSXA 3RAYA 4AU7A 3S7BA 3RU0A 3VUZA 4YPEA 2W5ZA 3OXFA 5KJMA 5CCLA 3F9ZA 3MO0A 3M56A 3S8PA 1N6CA 1MUFA 4NJ5A 4QENA 4WUYA 3N71A 3DB5A 5TH7A 5JHNA 5TTFA 1MVXA 4O30A 5EX0A 4FMUA 5JINA 3MO5A 1O9SA 3K5KA 5EG2A 3KMTA 4RZ0A 4J7FA 3EP0A 3IHXA 4BUPA 2JV0A 4YPAA 3S7DA 3F9WA 4J7IA 4JLGA 1N6AA 3S7FA 4YNDA 3M57A 3VV0A 1ZKKA 1PEGA 3HNAA 5CCMA 5CPRB 5KJKA 1MT6A 5T5GA 5KJLA 3M58A 2R3AA 4YNPA 3RIBA 5T0MA 2F69A 3DALA 1ML9A 3M53A 5JJ0A 1H3IA 3QWVA 4JDSA 3OOIA 4MI0A 4YPUA 3MO2A 3OXLA 1XQHA 4O6FA 3SWCA 3M5AA
chains in the Genus database with same CATH topology
3QWWA 5EX3A 5F5EA 2G46A 4H12A 1MVHA 2QPWA 3MEKA 4QEOA 3TG4A 3QWPA 2BQZA 3KMAA 3KMJA 3S7JA 2IGQA 3FPDA 3RJWA 5JIYA 4J8OA 5HQ8A 4QEPA 4IJ8A 4YNMA 3PDNA 4E47A 3F9XA 1N3JA 3M54A 4J83A 4LDGA 5TEGA 4NVQA 5HI7A 3CBMA 3SW9A 3CBOA 5F6KC 2RFIA 5LSZA 5ARGA 3BO5A 4MI5A 4IJDA 2O8JA 5F6LA 5ARFA 5T0KA 3RQ4A 3TG5A 5F59A 3OPEA 4C1QA 3OXGA 3CBPA 3M59A 3M55A 5AYFA 4Z4PA 2W5YA 4I51A 3F9YA 3OS5A 5KJNA 5LSXA 3RAYA 4AU7A 3S7BA 3RU0A 3VUZA 4YPEA 2W5ZA 3OXFA 5KJMA 5CCLA 3F9ZA 3MO0A 3M56A 3S8PA 1N6CA 1MUFA 4NJ5A 4QENA 4WUYA 3N71A 3DB5A 5TH7A 5JHNA 5TTFA 1MVXA 4O30A 5EX0A 4FMUA 5JINA 3MO5A 1O9SA 3K5KA 5EG2A 3KMTA 4RZ0A 4J7FA 3EP0A 3IHXA 4BUPA 2JV0A 4YPAA 3S7DA 3F9WA 4J7IA 4JLGA 1N6AA 3S7FA 4YNDA 3M57A 3VV0A 1ZKKA 1PEGA 3HNAA 5CCMA 5CPRB 5KJKA 1MT6A 5T5GA 5KJLA 3M58A 2R3AA 4YNPA 3RIBA 5T0MA 2F69A 3DALA 1ML9A 3M53A 5JJ0A 1H3IA 3QWVA 4JDSA 3OOIA 4MI0A 4YPUA 3MO2A 3OXLA 1XQHA 4O6FA 3SWCA 3M5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWW A;  5EX3 A;  5F5E A;  2G46 A;  4H12 A;  1MVH A;  2QPW A;  3MEK A;  4QEO A;  3TG4 A;  3QWP A;  2BQZ A;  3KMA A;  3KMJ A;  3S7J A;  2IGQ A;  3FPD A;  3RJW A;  5JIY A;  4J8O A;  5HQ8 A;  4QEP A;  4IJ8 A;  4YNM A;  3PDN A;  4E47 A;  3F9X A;  1N3J A;  3M54 A;  4J83 A;  4LDG A;  5TEG A;  4NVQ A;  5HI7 A;  3CBM A;  3SW9 A;  3CBO A;  5F6K C;  2RFI A;  5LSZ A;  5ARG A;  3BO5 A;  4MI5 A;  4IJD A;  2O8J A;  5F6L A;  5ARF A;  5T0K A;  3RQ4 A;  3TG5 A;  5F59 A;  3OPE A;  4C1Q A;  3OXG A;  3CBP A;  3M59 A;  3M55 A;  5AYF A;  4Z4P A;  2W5Y A;  4I51 A;  3F9Y A;  3OS5 A;  5KJN A;  5LSX A;  3RAY A;  4AU7 A;  3S7B A;  3RU0 A;  3VUZ A;  4YPE A;  2W5Z A;  3OXF A;  5KJM A;  5CCL A;  3F9Z A;  3MO0 A;  3M56 A;  3S8P A;  1N6C A;  1MUF A;  4NJ5 A;  4QEN A;  4WUY A;  3N71 A;  3DB5 A;  5TH7 A;  5JHN A;  5TTF A;  1MVX A;  4O30 A;  5EX0 A;  4FMU A;  5JIN A;  3MO5 A;  1O9S A;  3K5K A;  5EG2 A;  3KMT A;  4RZ0 A;  4J7F A;  3EP0 A;  3IHX A;  4BUP A;  2JV0 A;  4YPA A;  3S7D A;  3F9W A;  4J7I A;  4JLG A;  1N6A A;  3S7F A;  4YND A;  3M57 A;  3VV0 A;  1ZKK A;  1PEG A;  3HNA A;  5CCM A;  5CPR B;  5KJK A;  1MT6 A;  5T5G A;  5KJL A;  3M58 A;  2R3A A;  4YNP A;  3RIB A;  5T0M A;  2F69 A;  3DAL A;  1ML9 A;  3M53 A;  5JJ0 A;  1H3I A;  3QWV A;  4JDS A;  3OOI A;  4MI0 A;  4YPU A;  3MO2 A;  3OXL A;  1XQH A;  4O6F A;  3SWC A;  3M5A A; 
#chains in the Genus database with same CATH topology
 3QWW A;  5EX3 A;  5F5E A;  2G46 A;  4H12 A;  1MVH A;  2QPW A;  3MEK A;  4QEO A;  3TG4 A;  3QWP A;  2BQZ A;  3KMA A;  3KMJ A;  3S7J A;  2IGQ A;  3FPD A;  3RJW A;  5JIY A;  4J8O A;  5HQ8 A;  4QEP A;  4IJ8 A;  4YNM A;  3PDN A;  4E47 A;  3F9X A;  1N3J A;  3M54 A;  4J83 A;  4LDG A;  5TEG A;  4NVQ A;  5HI7 A;  3CBM A;  3SW9 A;  3CBO A;  5F6K C;  2RFI A;  5LSZ A;  5ARG A;  3BO5 A;  4MI5 A;  4IJD A;  2O8J A;  5F6L A;  5ARF A;  5T0K A;  3RQ4 A;  3TG5 A;  5F59 A;  3OPE A;  4C1Q A;  3OXG A;  3CBP A;  3M59 A;  3M55 A;  5AYF A;  4Z4P A;  2W5Y A;  4I51 A;  3F9Y A;  3OS5 A;  5KJN A;  5LSX A;  3RAY A;  4AU7 A;  3S7B A;  3RU0 A;  3VUZ A;  4YPE A;  2W5Z A;  3OXF A;  5KJM A;  5CCL A;  3F9Z A;  3MO0 A;  3M56 A;  3S8P A;  1N6C A;  1MUF A;  4NJ5 A;  4QEN A;  4WUY A;  3N71 A;  3DB5 A;  5TH7 A;  5JHN A;  5TTF A;  1MVX A;  4O30 A;  5EX0 A;  4FMU A;  5JIN A;  3MO5 A;  1O9S A;  3K5K A;  5EG2 A;  3KMT A;  4RZ0 A;  4J7F A;  3EP0 A;  3IHX A;  4BUP A;  2JV0 A;  4YPA A;  3S7D A;  3F9W A;  4J7I A;  4JLG A;  1N6A A;  3S7F A;  4YND A;  3M57 A;  3VV0 A;  1ZKK A;  1PEG A;  3HNA A;  5CCM A;  5CPR B;  5KJK A;  1MT6 A;  5T5G A;  5KJL A;  3M58 A;  2R3A A;  4YNP A;  3RIB A;  5T0M A;  2F69 A;  3DAL A;  1ML9 A;  3M53 A;  5JJ0 A;  1H3I A;  3QWV A;  4JDS A;  3OOI A;  4MI0 A;  4YPU A;  3MO2 A;  3OXL A;  1XQH A;  4O6F A;  3SWC A;  3M5A A; 
#chains in the Genus database with same CATH homology
 3QWW A;  5EX3 A;  5F5E A;  2G46 A;  4H12 A;  1MVH A;  2QPW A;  3MEK A;  4QEO A;  3TG4 A;  3QWP A;  2BQZ A;  3KMA A;  3KMJ A;  3S7J A;  2IGQ A;  3FPD A;  3RJW A;  5JIY A;  4J8O A;  5HQ8 A;  4QEP A;  4IJ8 A;  4YNM A;  3PDN A;  4E47 A;  3F9X A;  1N3J A;  3M54 A;  4J83 A;  4LDG A;  5TEG A;  4NVQ A;  5HI7 A;  3CBM A;  3SW9 A;  3CBO A;  5F6K C;  2RFI A;  5LSZ A;  5ARG A;  3BO5 A;  4MI5 A;  4IJD A;  2O8J A;  5F6L A;  5ARF A;  5T0K A;  3RQ4 A;  3TG5 A;  5F59 A;  3OPE A;  4C1Q A;  3OXG A;  3CBP A;  3M59 A;  3M55 A;  5AYF A;  4Z4P A;  2W5Y A;  4I51 A;  3F9Y A;  3OS5 A;  5KJN A;  5LSX A;  3RAY A;  4AU7 A;  3S7B A;  3RU0 A;  3VUZ A;  4YPE A;  2W5Z A;  3OXF A;  5KJM A;  5CCL A;  3F9Z A;  3MO0 A;  3M56 A;  3S8P A;  1N6C A;  1MUF A;  4NJ5 A;  4QEN A;  4WUY A;  3N71 A;  3DB5 A;  5TH7 A;  5JHN A;  5TTF A;  1MVX A;  4O30 A;  5EX0 A;  4FMU A;  5JIN A;  3MO5 A;  1O9S A;  3K5K A;  5EG2 A;  3KMT A;  4RZ0 A;  4J7F A;  3EP0 A;  3IHX A;  4BUP A;  2JV0 A;  4YPA A;  3S7D A;  3F9W A;  4J7I A;  4JLG A;  1N6A A;  3S7F A;  4YND A;  3M57 A;  3VV0 A;  1ZKK A;  1PEG A;  3HNA A;  5CCM A;  5CPR B;  5KJK A;  1MT6 A;  5T5G A;  5KJL A;  3M58 A;  2R3A A;  4YNP A;  3RIB A;  5T0M A;  2F69 A;  3DAL A;  1ML9 A;  3M53 A;  5JJ0 A;  1H3I A;  3QWV A;  4JDS A;  3OOI A;  4MI0 A;  4YPU A;  3MO2 A;  3OXL A;  1XQH A;  4O6F A;  3SWC A;  3M5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...