5TH7A

Complex of setd8 with ms453
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
143
structure length
143
Chain Sequence
KAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKSGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords N-lysine methyltransferase KMT5A
publication title Structure-Based Design of a Covalent Inhibitor of the SET Domain-Containing Protein 8 (SETD8) Lysine Methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5th7A00
3M58A 3QWVA 4J8OA 5EG2A 2G46A 1N6AA 4JDSA 3OXLA 5T5GA 4WUYA 3OXFA 1N6CA 3F9YA 3BO5A 4FMUA 5TEGA 2RFIA 5F6LA 5F59A 3VUZA 3RIBA 3S7DA 5KJKA 3RU0A 3QWPA 3SW9A 3KMTA 4QEPA 5T0KA 3M5AA 4NJ5A 4QENA 1PEGA 1MVHA 1O9SA 3MO0A 3RQ4A 5LSXA 5CCMA 3DALA 3OXGA 3M59A 3K5KA 5KJLA 5ARGA 3M57A 4NVQA 3F9ZA 3TG4A 3M54A 3OS5A 4YPUA 5JJ0A 3M56A 5CPRB 3EP0A 5F6KC 3PDNA 1H3IA 4J7FA 2W5YA 4I51A 3CBMA 2R3AA 5T0MA 3RJWA 5CCLA 1MVXA 3OPEA 2IGQA 3QWWA 3HNAA 4MI5A 4IJ8A 4YPEA 3MO5A 4MI0A 1ML9A 5EX3A 3CBOA 4YNMA 2JV0A 3KMJA 1MUFA 4QEOA 4E47A 4IJDA 1XQHA 5KJMA 1ZKKA 5EX0A 5LSZA 5JIYA 5HI7A 3TG5A 3M55A 4C1QA 3MO2A 5F5EA 2BQZA 2QPWA 3S7FA 2W5ZA 3S8PA 3SWCA 3F9XA 2O8JA 3N71A 3VV0A 3S7JA 4RZ0A 5TH7A 3MEKA 1MT6A 3FPDA 5HQ8A 3KMAA 4O30A 3OOIA 3CBPA 4H12A 4BUPA 4JLGA 5JINA 5TTFA 4YNDA 3S7BA 4YPAA 5ARFA 3F9WA 4O6FA 3IHXA 5KJNA 3M53A 4J7IA 3RAYA 4AU7A 4J83A 5AYFA 4LDGA 1N3JA 4Z4PA 5JHNA 3DB5A 2F69A 4YNPA
chains in the Genus database with same CATH superfamily
3M58A 3QWVA 4J8OA 5EG2A 2G46A 1N6AA 4JDSA 3OXLA 5T5GA 4WUYA 3OXFA 1N6CA 3F9YA 3BO5A 4FMUA 5TEGA 2RFIA 5F6LA 5F59A 3VUZA 3RIBA 3S7DA 5KJKA 3RU0A 3QWPA 3SW9A 3KMTA 4QEPA 5T0KA 3M5AA 4NJ5A 4QENA 1PEGA 1MVHA 1O9SA 3MO0A 3RQ4A 5LSXA 5CCMA 3DALA 3OXGA 3M59A 3K5KA 5KJLA 5ARGA 3M57A 4NVQA 3F9ZA 3TG4A 3M54A 3OS5A 4YPUA 5JJ0A 3M56A 5CPRB 3EP0A 5F6KC 3PDNA 1H3IA 4J7FA 2W5YA 4I51A 3CBMA 2R3AA 5T0MA 3RJWA 5CCLA 1MVXA 3OPEA 2IGQA 3QWWA 3HNAA 4MI5A 4IJ8A 4YPEA 3MO5A 4MI0A 1ML9A 5EX3A 3CBOA 4YNMA 2JV0A 3KMJA 1MUFA 4QEOA 4E47A 4IJDA 1XQHA 5KJMA 1ZKKA 5EX0A 5LSZA 5JIYA 5HI7A 3TG5A 3M55A 4C1QA 3MO2A 5F5EA 2BQZA 2QPWA 3S7FA 2W5ZA 3S8PA 3SWCA 3F9XA 2O8JA 3N71A 3VV0A 3S7JA 4RZ0A 5TH7A 3MEKA 1MT6A 3FPDA 5HQ8A 3KMAA 4O30A 3OOIA 3CBPA 4H12A 4BUPA 4JLGA 5JINA 5TTFA 4YNDA 3S7BA 4YPAA 5ARFA 3F9WA 4O6FA 3IHXA 5KJNA 3M53A 4J7IA 3RAYA 4AU7A 4J83A 5AYFA 4LDGA 1N3JA 4Z4PA 5JHNA 3DB5A 2F69A 4YNPA
chains in the Genus database with same CATH topology
3M58A 3QWVA 4J8OA 5EG2A 2G46A 1N6AA 4JDSA 3OXLA 5T5GA 4WUYA 3OXFA 1N6CA 3F9YA 3BO5A 4FMUA 5TEGA 2RFIA 5F6LA 5F59A 3VUZA 3RIBA 3S7DA 5KJKA 3RU0A 3QWPA 3SW9A 3KMTA 4QEPA 5T0KA 3M5AA 4NJ5A 4QENA 1PEGA 1MVHA 1O9SA 3MO0A 3RQ4A 5LSXA 5CCMA 3DALA 3OXGA 3M59A 3K5KA 5KJLA 5ARGA 3M57A 4NVQA 3F9ZA 3TG4A 3M54A 3OS5A 4YPUA 5JJ0A 3M56A 5CPRB 3EP0A 5F6KC 3PDNA 1H3IA 4J7FA 2W5YA 4I51A 3CBMA 2R3AA 5T0MA 3RJWA 5CCLA 1MVXA 3OPEA 2IGQA 3QWWA 3HNAA 4MI5A 4IJ8A 4YPEA 3MO5A 4MI0A 1ML9A 5EX3A 3CBOA 4YNMA 2JV0A 3KMJA 1MUFA 4QEOA 4E47A 4IJDA 1XQHA 5KJMA 1ZKKA 5EX0A 5LSZA 5JIYA 5HI7A 3TG5A 3M55A 4C1QA 3MO2A 5F5EA 2BQZA 2QPWA 3S7FA 2W5ZA 3S8PA 3SWCA 3F9XA 2O8JA 3N71A 3VV0A 3S7JA 4RZ0A 5TH7A 3MEKA 1MT6A 3FPDA 5HQ8A 3KMAA 4O30A 3OOIA 3CBPA 4H12A 4BUPA 4JLGA 5JINA 5TTFA 4YNDA 3S7BA 4YPAA 5ARFA 3F9WA 4O6FA 3IHXA 5KJNA 3M53A 4J7IA 3RAYA 4AU7A 4J83A 5AYFA 4LDGA 1N3JA 4Z4PA 5JHNA 3DB5A 2F69A 4YNPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M58 A;  3QWV A;  4J8O A;  5EG2 A;  2G46 A;  1N6A A;  4JDS A;  3OXL A;  5T5G A;  4WUY A;  3OXF A;  1N6C A;  3F9Y A;  3BO5 A;  4FMU A;  5TEG A;  2RFI A;  5F6L A;  5F59 A;  3VUZ A;  3RIB A;  3S7D A;  5KJK A;  3RU0 A;  3QWP A;  3SW9 A;  3KMT A;  4QEP A;  5T0K A;  3M5A A;  4NJ5 A;  4QEN A;  1PEG A;  1MVH A;  1O9S A;  3MO0 A;  3RQ4 A;  5LSX A;  5CCM A;  3DAL A;  3OXG A;  3M59 A;  3K5K A;  5KJL A;  5ARG A;  3M57 A;  4NVQ A;  3F9Z A;  3TG4 A;  3M54 A;  3OS5 A;  4YPU A;  5JJ0 A;  3M56 A;  5CPR B;  3EP0 A;  5F6K C;  3PDN A;  1H3I A;  4J7F A;  2W5Y A;  4I51 A;  3CBM A;  2R3A A;  5T0M A;  3RJW A;  5CCL A;  1MVX A;  3OPE A;  2IGQ A;  3QWW A;  3HNA A;  4MI5 A;  4IJ8 A;  4YPE A;  3MO5 A;  4MI0 A;  1ML9 A;  5EX3 A;  3CBO A;  4YNM A;  2JV0 A;  3KMJ A;  1MUF A;  4QEO A;  4E47 A;  4IJD A;  1XQH A;  5KJM A;  1ZKK A;  5EX0 A;  5LSZ A;  5JIY A;  5HI7 A;  3TG5 A;  3M55 A;  4C1Q A;  3MO2 A;  5F5E A;  2BQZ A;  2QPW A;  3S7F A;  2W5Z A;  3S8P A;  3SWC A;  3F9X A;  2O8J A;  3N71 A;  3VV0 A;  3S7J A;  4RZ0 A;  5TH7 A;  3MEK A;  1MT6 A;  3FPD A;  5HQ8 A;  3KMA A;  4O30 A;  3OOI A;  3CBP A;  4H12 A;  4BUP A;  4JLG A;  5JIN A;  5TTF A;  4YND A;  3S7B A;  4YPA A;  5ARF A;  3F9W A;  4O6F A;  3IHX A;  5KJN A;  3M53 A;  4J7I A;  3RAY A;  4AU7 A;  4J83 A;  5AYF A;  4LDG A;  1N3J A;  4Z4P A;  5JHN A;  3DB5 A;  2F69 A;  4YNP A; 
#chains in the Genus database with same CATH topology
 3M58 A;  3QWV A;  4J8O A;  5EG2 A;  2G46 A;  1N6A A;  4JDS A;  3OXL A;  5T5G A;  4WUY A;  3OXF A;  1N6C A;  3F9Y A;  3BO5 A;  4FMU A;  5TEG A;  2RFI A;  5F6L A;  5F59 A;  3VUZ A;  3RIB A;  3S7D A;  5KJK A;  3RU0 A;  3QWP A;  3SW9 A;  3KMT A;  4QEP A;  5T0K A;  3M5A A;  4NJ5 A;  4QEN A;  1PEG A;  1MVH A;  1O9S A;  3MO0 A;  3RQ4 A;  5LSX A;  5CCM A;  3DAL A;  3OXG A;  3M59 A;  3K5K A;  5KJL A;  5ARG A;  3M57 A;  4NVQ A;  3F9Z A;  3TG4 A;  3M54 A;  3OS5 A;  4YPU A;  5JJ0 A;  3M56 A;  5CPR B;  3EP0 A;  5F6K C;  3PDN A;  1H3I A;  4J7F A;  2W5Y A;  4I51 A;  3CBM A;  2R3A A;  5T0M A;  3RJW A;  5CCL A;  1MVX A;  3OPE A;  2IGQ A;  3QWW A;  3HNA A;  4MI5 A;  4IJ8 A;  4YPE A;  3MO5 A;  4MI0 A;  1ML9 A;  5EX3 A;  3CBO A;  4YNM A;  2JV0 A;  3KMJ A;  1MUF A;  4QEO A;  4E47 A;  4IJD A;  1XQH A;  5KJM A;  1ZKK A;  5EX0 A;  5LSZ A;  5JIY A;  5HI7 A;  3TG5 A;  3M55 A;  4C1Q A;  3MO2 A;  5F5E A;  2BQZ A;  2QPW A;  3S7F A;  2W5Z A;  3S8P A;  3SWC A;  3F9X A;  2O8J A;  3N71 A;  3VV0 A;  3S7J A;  4RZ0 A;  5TH7 A;  3MEK A;  1MT6 A;  3FPD A;  5HQ8 A;  3KMA A;  4O30 A;  3OOI A;  3CBP A;  4H12 A;  4BUP A;  4JLG A;  5JIN A;  5TTF A;  4YND A;  3S7B A;  4YPA A;  5ARF A;  3F9W A;  4O6F A;  3IHX A;  5KJN A;  3M53 A;  4J7I A;  3RAY A;  4AU7 A;  4J83 A;  5AYF A;  4LDG A;  1N3J A;  4Z4P A;  5JHN A;  3DB5 A;  2F69 A;  4YNP A; 
#chains in the Genus database with same CATH homology
 3M58 A;  3QWV A;  4J8O A;  5EG2 A;  2G46 A;  1N6A A;  4JDS A;  3OXL A;  5T5G A;  4WUY A;  3OXF A;  1N6C A;  3F9Y A;  3BO5 A;  4FMU A;  5TEG A;  2RFI A;  5F6L A;  5F59 A;  3VUZ A;  3RIB A;  3S7D A;  5KJK A;  3RU0 A;  3QWP A;  3SW9 A;  3KMT A;  4QEP A;  5T0K A;  3M5A A;  4NJ5 A;  4QEN A;  1PEG A;  1MVH A;  1O9S A;  3MO0 A;  3RQ4 A;  5LSX A;  5CCM A;  3DAL A;  3OXG A;  3M59 A;  3K5K A;  5KJL A;  5ARG A;  3M57 A;  4NVQ A;  3F9Z A;  3TG4 A;  3M54 A;  3OS5 A;  4YPU A;  5JJ0 A;  3M56 A;  5CPR B;  3EP0 A;  5F6K C;  3PDN A;  1H3I A;  4J7F A;  2W5Y A;  4I51 A;  3CBM A;  2R3A A;  5T0M A;  3RJW A;  5CCL A;  1MVX A;  3OPE A;  2IGQ A;  3QWW A;  3HNA A;  4MI5 A;  4IJ8 A;  4YPE A;  3MO5 A;  4MI0 A;  1ML9 A;  5EX3 A;  3CBO A;  4YNM A;  2JV0 A;  3KMJ A;  1MUF A;  4QEO A;  4E47 A;  4IJD A;  1XQH A;  5KJM A;  1ZKK A;  5EX0 A;  5LSZ A;  5JIY A;  5HI7 A;  3TG5 A;  3M55 A;  4C1Q A;  3MO2 A;  5F5E A;  2BQZ A;  2QPW A;  3S7F A;  2W5Z A;  3S8P A;  3SWC A;  3F9X A;  2O8J A;  3N71 A;  3VV0 A;  3S7J A;  4RZ0 A;  5TH7 A;  3MEK A;  1MT6 A;  3FPD A;  5HQ8 A;  3KMA A;  4O30 A;  3OOI A;  3CBP A;  4H12 A;  4BUP A;  4JLG A;  5JIN A;  5TTF A;  4YND A;  3S7B A;  4YPA A;  5ARF A;  3F9W A;  4O6F A;  3IHX A;  5KJN A;  3M53 A;  4J7I A;  3RAY A;  4AU7 A;  4J83 A;  5AYF A;  4LDG A;  1N3J A;  4Z4P A;  5JHN A;  3DB5 A;  2F69 A;  4YNP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...