5TH7A

Complex of setd8 with ms453
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
143
structure length
143
Chain Sequence
KAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKSGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-lysine methyltransferase KMT5A
publication title Structure-Based Design of a Covalent Inhibitor of the SET Domain-Containing Protein 8 (SETD8) Lysine Methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 38
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5th7A00
4YNMA 3M56A 3S7FA 5EX0A 3RQ4A 3F9ZA 3OOIA 5F6LA 5T0KA 3TG5A 4BUPA 3QWWA 4YNDA 4Z4PA 5TTFA 3QWVA 1MT6A 3M53A 5CCLA 3CBMA 4MI5A 5JJ0A 1MUFA 1XQHA 3TG4A 3CBPA 4E47A 4RZ0A 3DALA 3MO2A 5ARGA 4AU7A 5LSXA 4LDGA 2QPWA 4MI0A 3RU0A 5JHNA 3S7JA 4C1QA 3KMAA 4O6FA 3N71A 4YNPA 5JIYA 5KJKA 3K5KA 1N6AA 3EP0A 3M57A 4NJ5A 3OPEA 5KJMA 3M5AA 2IGQA 4IJDA 3OS5A 3F9WA 3S7BA 5F5EA 3S7DA 3M59A 5KJNA 1MVHA 3QWPA 4JDSA 4YPAA 4YPEA 3F9XA 5ARFA 3RAYA 3S8PA 3OXFA 5EX3A 4J7FA 1O9SA 3HNAA 4QEPA 3FPDA 5HQ8A 2F69A 1N6CA 4O30A 5T0MA 4I51A 3M54A 4NVQA 3IHXA 3OXLA 4QENA 4H12A 1PEGA 3VV0A 3SWCA 3PDNA 4J8OA 3KMJA 3MO5A 3MO0A 2O8JA 3VUZA 1ML9A 3F9YA 5EG2A 3RJWA 4IJ8A 4J7IA 5TEGA 2R3AA 2BQZA 5KJLA 3M55A 2W5YA 1H3IA 3RIBA 5CCMA 2JV0A 5TH7A 1MVXA 4WUYA 2W5ZA 4J83A 4JLGA 3M58A 5JINA 4QEOA 2G46A 4FMUA 3BO5A 5T5GA 3KMTA 5CPRB 3SW9A 2RFIA 1ZKKA 3DB5A 5AYFA 4YPUA 1N3JA 3OXGA 5LSZA 5HI7A 3CBOA 5F59A 3MEKA 5F6KC
chains in the Genus database with same CATH superfamily
4YNMA 3M56A 3S7FA 5EX0A 3RQ4A 3F9ZA 3OOIA 5F6LA 5T0KA 3TG5A 4BUPA 3QWWA 4YNDA 4Z4PA 5TTFA 3QWVA 1MT6A 3M53A 5CCLA 3CBMA 4MI5A 5JJ0A 1MUFA 1XQHA 3TG4A 3CBPA 4E47A 4RZ0A 3DALA 3MO2A 5ARGA 4AU7A 5LSXA 4LDGA 2QPWA 4MI0A 3RU0A 5JHNA 3S7JA 4C1QA 3KMAA 4O6FA 3N71A 4YNPA 5JIYA 5KJKA 3K5KA 1N6AA 3EP0A 3M57A 4NJ5A 3OPEA 5KJMA 3M5AA 2IGQA 4IJDA 3OS5A 3F9WA 3S7BA 5F5EA 3S7DA 3M59A 5KJNA 1MVHA 3QWPA 4JDSA 4YPAA 4YPEA 3F9XA 5ARFA 3RAYA 3S8PA 3OXFA 5EX3A 4J7FA 1O9SA 3HNAA 4QEPA 3FPDA 5HQ8A 2F69A 1N6CA 4O30A 5T0MA 4I51A 3M54A 4NVQA 3IHXA 3OXLA 4QENA 4H12A 1PEGA 3VV0A 3SWCA 3PDNA 4J8OA 3KMJA 3MO5A 3MO0A 2O8JA 3VUZA 1ML9A 3F9YA 5EG2A 3RJWA 4IJ8A 4J7IA 5TEGA 2R3AA 2BQZA 5KJLA 3M55A 2W5YA 1H3IA 3RIBA 5CCMA 2JV0A 5TH7A 1MVXA 4WUYA 2W5ZA 4J83A 4JLGA 3M58A 5JINA 4QEOA 2G46A 4FMUA 3BO5A 5T5GA 3KMTA 5CPRB 3SW9A 2RFIA 1ZKKA 3DB5A 5AYFA 4YPUA 1N3JA 3OXGA 5LSZA 5HI7A 3CBOA 5F59A 3MEKA 5F6KC
chains in the Genus database with same CATH topology
4YNMA 3M56A 3S7FA 5EX0A 3RQ4A 3F9ZA 3OOIA 5F6LA 5T0KA 3TG5A 4BUPA 3QWWA 4YNDA 4Z4PA 5TTFA 3QWVA 1MT6A 3M53A 5CCLA 3CBMA 4MI5A 5JJ0A 1MUFA 1XQHA 3TG4A 3CBPA 4E47A 4RZ0A 3DALA 3MO2A 5ARGA 4AU7A 5LSXA 4LDGA 2QPWA 4MI0A 3RU0A 5JHNA 3S7JA 4C1QA 3KMAA 4O6FA 3N71A 4YNPA 5JIYA 5KJKA 3K5KA 1N6AA 3EP0A 3M57A 4NJ5A 3OPEA 5KJMA 3M5AA 2IGQA 4IJDA 3OS5A 3F9WA 3S7BA 5F5EA 3S7DA 3M59A 5KJNA 1MVHA 3QWPA 4JDSA 4YPAA 4YPEA 3F9XA 5ARFA 3RAYA 3S8PA 3OXFA 5EX3A 4J7FA 1O9SA 3HNAA 4QEPA 3FPDA 5HQ8A 2F69A 1N6CA 4O30A 5T0MA 4I51A 3M54A 4NVQA 3IHXA 3OXLA 4QENA 4H12A 1PEGA 3VV0A 3SWCA 3PDNA 4J8OA 3KMJA 3MO5A 3MO0A 2O8JA 3VUZA 1ML9A 3F9YA 5EG2A 3RJWA 4IJ8A 4J7IA 5TEGA 2R3AA 2BQZA 5KJLA 3M55A 2W5YA 1H3IA 3RIBA 5CCMA 2JV0A 5TH7A 1MVXA 4WUYA 2W5ZA 4J83A 4JLGA 3M58A 5JINA 4QEOA 2G46A 4FMUA 3BO5A 5T5GA 3KMTA 5CPRB 3SW9A 2RFIA 1ZKKA 3DB5A 5AYFA 4YPUA 1N3JA 3OXGA 5LSZA 5HI7A 3CBOA 5F59A 3MEKA 5F6KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YNM A;  3M56 A;  3S7F A;  5EX0 A;  3RQ4 A;  3F9Z A;  3OOI A;  5F6L A;  5T0K A;  3TG5 A;  4BUP A;  3QWW A;  4YND A;  4Z4P A;  5TTF A;  3QWV A;  1MT6 A;  3M53 A;  5CCL A;  3CBM A;  4MI5 A;  5JJ0 A;  1MUF A;  1XQH A;  3TG4 A;  3CBP A;  4E47 A;  4RZ0 A;  3DAL A;  3MO2 A;  5ARG A;  4AU7 A;  5LSX A;  4LDG A;  2QPW A;  4MI0 A;  3RU0 A;  5JHN A;  3S7J A;  4C1Q A;  3KMA A;  4O6F A;  3N71 A;  4YNP A;  5JIY A;  5KJK A;  3K5K A;  1N6A A;  3EP0 A;  3M57 A;  4NJ5 A;  3OPE A;  5KJM A;  3M5A A;  2IGQ A;  4IJD A;  3OS5 A;  3F9W A;  3S7B A;  5F5E A;  3S7D A;  3M59 A;  5KJN A;  1MVH A;  3QWP A;  4JDS A;  4YPA A;  4YPE A;  3F9X A;  5ARF A;  3RAY A;  3S8P A;  3OXF A;  5EX3 A;  4J7F A;  1O9S A;  3HNA A;  4QEP A;  3FPD A;  5HQ8 A;  2F69 A;  1N6C A;  4O30 A;  5T0M A;  4I51 A;  3M54 A;  4NVQ A;  3IHX A;  3OXL A;  4QEN A;  4H12 A;  1PEG A;  3VV0 A;  3SWC A;  3PDN A;  4J8O A;  3KMJ A;  3MO5 A;  3MO0 A;  2O8J A;  3VUZ A;  1ML9 A;  3F9Y A;  5EG2 A;  3RJW A;  4IJ8 A;  4J7I A;  5TEG A;  2R3A A;  2BQZ A;  5KJL A;  3M55 A;  2W5Y A;  1H3I A;  3RIB A;  5CCM A;  2JV0 A;  5TH7 A;  1MVX A;  4WUY A;  2W5Z A;  4J83 A;  4JLG A;  3M58 A;  5JIN A;  4QEO A;  2G46 A;  4FMU A;  3BO5 A;  5T5G A;  3KMT A;  5CPR B;  3SW9 A;  2RFI A;  1ZKK A;  3DB5 A;  5AYF A;  4YPU A;  1N3J A;  3OXG A;  5LSZ A;  5HI7 A;  3CBO A;  5F59 A;  3MEK A;  5F6K C; 
#chains in the Genus database with same CATH topology
 4YNM A;  3M56 A;  3S7F A;  5EX0 A;  3RQ4 A;  3F9Z A;  3OOI A;  5F6L A;  5T0K A;  3TG5 A;  4BUP A;  3QWW A;  4YND A;  4Z4P A;  5TTF A;  3QWV A;  1MT6 A;  3M53 A;  5CCL A;  3CBM A;  4MI5 A;  5JJ0 A;  1MUF A;  1XQH A;  3TG4 A;  3CBP A;  4E47 A;  4RZ0 A;  3DAL A;  3MO2 A;  5ARG A;  4AU7 A;  5LSX A;  4LDG A;  2QPW A;  4MI0 A;  3RU0 A;  5JHN A;  3S7J A;  4C1Q A;  3KMA A;  4O6F A;  3N71 A;  4YNP A;  5JIY A;  5KJK A;  3K5K A;  1N6A A;  3EP0 A;  3M57 A;  4NJ5 A;  3OPE A;  5KJM A;  3M5A A;  2IGQ A;  4IJD A;  3OS5 A;  3F9W A;  3S7B A;  5F5E A;  3S7D A;  3M59 A;  5KJN A;  1MVH A;  3QWP A;  4JDS A;  4YPA A;  4YPE A;  3F9X A;  5ARF A;  3RAY A;  3S8P A;  3OXF A;  5EX3 A;  4J7F A;  1O9S A;  3HNA A;  4QEP A;  3FPD A;  5HQ8 A;  2F69 A;  1N6C A;  4O30 A;  5T0M A;  4I51 A;  3M54 A;  4NVQ A;  3IHX A;  3OXL A;  4QEN A;  4H12 A;  1PEG A;  3VV0 A;  3SWC A;  3PDN A;  4J8O A;  3KMJ A;  3MO5 A;  3MO0 A;  2O8J A;  3VUZ A;  1ML9 A;  3F9Y A;  5EG2 A;  3RJW A;  4IJ8 A;  4J7I A;  5TEG A;  2R3A A;  2BQZ A;  5KJL A;  3M55 A;  2W5Y A;  1H3I A;  3RIB A;  5CCM A;  2JV0 A;  5TH7 A;  1MVX A;  4WUY A;  2W5Z A;  4J83 A;  4JLG A;  3M58 A;  5JIN A;  4QEO A;  2G46 A;  4FMU A;  3BO5 A;  5T5G A;  3KMT A;  5CPR B;  3SW9 A;  2RFI A;  1ZKK A;  3DB5 A;  5AYF A;  4YPU A;  1N3J A;  3OXG A;  5LSZ A;  5HI7 A;  3CBO A;  5F59 A;  3MEK A;  5F6K C; 
#chains in the Genus database with same CATH homology
 4YNM A;  3M56 A;  3S7F A;  5EX0 A;  3RQ4 A;  3F9Z A;  3OOI A;  5F6L A;  5T0K A;  3TG5 A;  4BUP A;  3QWW A;  4YND A;  4Z4P A;  5TTF A;  3QWV A;  1MT6 A;  3M53 A;  5CCL A;  3CBM A;  4MI5 A;  5JJ0 A;  1MUF A;  1XQH A;  3TG4 A;  3CBP A;  4E47 A;  4RZ0 A;  3DAL A;  3MO2 A;  5ARG A;  4AU7 A;  5LSX A;  4LDG A;  2QPW A;  4MI0 A;  3RU0 A;  5JHN A;  3S7J A;  4C1Q A;  3KMA A;  4O6F A;  3N71 A;  4YNP A;  5JIY A;  5KJK A;  3K5K A;  1N6A A;  3EP0 A;  3M57 A;  4NJ5 A;  3OPE A;  5KJM A;  3M5A A;  2IGQ A;  4IJD A;  3OS5 A;  3F9W A;  3S7B A;  5F5E A;  3S7D A;  3M59 A;  5KJN A;  1MVH A;  3QWP A;  4JDS A;  4YPA A;  4YPE A;  3F9X A;  5ARF A;  3RAY A;  3S8P A;  3OXF A;  5EX3 A;  4J7F A;  1O9S A;  3HNA A;  4QEP A;  3FPD A;  5HQ8 A;  2F69 A;  1N6C A;  4O30 A;  5T0M A;  4I51 A;  3M54 A;  4NVQ A;  3IHX A;  3OXL A;  4QEN A;  4H12 A;  1PEG A;  3VV0 A;  3SWC A;  3PDN A;  4J8O A;  3KMJ A;  3MO5 A;  3MO0 A;  2O8J A;  3VUZ A;  1ML9 A;  3F9Y A;  5EG2 A;  3RJW A;  4IJ8 A;  4J7I A;  5TEG A;  2R3A A;  2BQZ A;  5KJL A;  3M55 A;  2W5Y A;  1H3I A;  3RIB A;  5CCM A;  2JV0 A;  5TH7 A;  1MVX A;  4WUY A;  2W5Z A;  4J83 A;  4JLG A;  3M58 A;  5JIN A;  4QEO A;  2G46 A;  4FMU A;  3BO5 A;  5T5G A;  3KMT A;  5CPR B;  3SW9 A;  2RFI A;  1ZKK A;  3DB5 A;  5AYF A;  4YPU A;  1N3J A;  3OXG A;  5LSZ A;  5HI7 A;  3CBO A;  5F59 A;  3MEK A;  5F6K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...