5TH7A

Complex of setd8 with ms453
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
143
structure length
143
Chain Sequence
b'KAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKSGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-lysine methyltransferase KMT5A
molecule tags Transferase
source organism Homo sapiens
publication title Structure-Based Design of a Covalent Inhibitor of the SET Domain-Containing Protein 8 (SETD8) Lysine Methyltransferase.
pubmed doi rcsb
total genus 38
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5th7A00
5T0KA 4BUPA 5KJMA 5T0MA 2R3AA 3TG4A 4JDSA 1MT6A 4YPEA 4YNMA 5EX0A 1ML9A 3MO0A 2G46A 4NVQA 3RQ4A 5KJKA 4NJ5A 5EG2A 3S8PA 2W5ZA 4AU7A 3RIBA 3MO5A 3QWVA 3OS5A 5F6KC 5ARFA 4QEPA 3M59A 5CCLA 3IHXA 3M55A 5JIYA 4IJDA 3OXLA 1MUFA 4YPAA 2JV0A 4O30A 3CBPA 3K5KA 3CBOA 5ARGA 3OPEA 4J83A 3F9WA 4Z4PA 3M58A 1XQHA 3M5AA 3F9ZA 5TEGA 3S7FA 3M54A 4J7FA 3KMAA 4YPUA 5LSXA 5T5GA 5HQ8A 4IJ8A 3QWPA 1MVHA 4E47A 4I51A 5TH7A 4J7IA 4LDGA 4YNPA 3OOIA 4RZ0A 3F9YA 5F5EA 3PDNA 3DALA 3FPDA 3SWCA 3SW9A 3RU0A 4QENA 1O9SA 3TG5A 3RAYA 5CCMA 3OXFA 5JHNA 3MO2A 4MI5A 1ZKKA 3S7JA 3N71A 2BQZA 3DB5A 3KMTA 3OXGA 1MVXA 4H12A 4WUYA 2F69A 4FMUA 5KJNA 5CPRB 5LSZA 5F59A 4O6FA 4C1QA 3QWWA 3CBMA 3M56A 2O8JA 5HI7A 2W5YA 5JINA 2RFIA 3VV0A 4JLGA 3EP0A 4J8OA 4MI0A 3MEKA 1H3IA 3BO5A 2QPWA 5JJ0A 3S7DA 3F9XA 1N6CA 1N3JA 3S7BA 3M53A 1PEGA 5KJLA 3HNAA 3RJWA 3M57A 5F6LA 2IGQA 5EX3A 5TTFA 5AYFA 3KMJA 3VUZA 4YNDA 1N6AA 4QEOA
chains in the Genus database with same CATH superfamily
5T0KA 4BUPA 5KJMA 5T0MA 2R3AA 3TG4A 4JDSA 1MT6A 4YPEA 4YNMA 5EX0A 1ML9A 3MO0A 2G46A 4NVQA 3RQ4A 5KJKA 4NJ5A 5EG2A 3S8PA 2W5ZA 4AU7A 3RIBA 3MO5A 3QWVA 3OS5A 5F6KC 5ARFA 4QEPA 3M59A 5CCLA 3IHXA 3M55A 5JIYA 4IJDA 3OXLA 1MUFA 4YPAA 2JV0A 4O30A 3CBPA 3K5KA 3CBOA 5ARGA 3OPEA 4J83A 3F9WA 4Z4PA 3M58A 1XQHA 3M5AA 3F9ZA 5TEGA 3S7FA 3M54A 4J7FA 3KMAA 4YPUA 5LSXA 5T5GA 5HQ8A 4IJ8A 3QWPA 1MVHA 4E47A 4I51A 5TH7A 4J7IA 4LDGA 4YNPA 3OOIA 4RZ0A 3F9YA 5F5EA 3PDNA 3DALA 3FPDA 3SWCA 3SW9A 3RU0A 4QENA 1O9SA 3TG5A 3RAYA 5CCMA 3OXFA 5JHNA 3MO2A 4MI5A 1ZKKA 3S7JA 3N71A 2BQZA 3DB5A 3KMTA 3OXGA 1MVXA 4H12A 4WUYA 2F69A 4FMUA 5KJNA 5CPRB 5LSZA 5F59A 4O6FA 4C1QA 3QWWA 3CBMA 3M56A 2O8JA 5HI7A 2W5YA 5JINA 2RFIA 3VV0A 4JLGA 3EP0A 4J8OA 4MI0A 3MEKA 1H3IA 3BO5A 2QPWA 5JJ0A 3S7DA 3F9XA 1N6CA 1N3JA 3S7BA 3M53A 1PEGA 5KJLA 3HNAA 3RJWA 3M57A 5F6LA 2IGQA 5EX3A 5TTFA 5AYFA 3KMJA 3VUZA 4YNDA 1N6AA 4QEOA
chains in the Genus database with same CATH topology
5T0KA 4BUPA 5KJMA 5T0MA 2R3AA 3TG4A 4JDSA 1MT6A 4YPEA 4YNMA 5EX0A 1ML9A 3MO0A 2G46A 4NVQA 3RQ4A 5KJKA 4NJ5A 5EG2A 3S8PA 2W5ZA 4AU7A 3RIBA 3MO5A 3QWVA 3OS5A 5F6KC 5ARFA 4QEPA 3M59A 5CCLA 3IHXA 3M55A 5JIYA 4IJDA 3OXLA 1MUFA 4YPAA 2JV0A 4O30A 3CBPA 3K5KA 3CBOA 5ARGA 3OPEA 4J83A 3F9WA 4Z4PA 3M58A 1XQHA 3M5AA 3F9ZA 5TEGA 3S7FA 3M54A 4J7FA 3KMAA 4YPUA 5LSXA 5T5GA 5HQ8A 4IJ8A 3QWPA 1MVHA 4E47A 4I51A 5TH7A 4J7IA 4LDGA 4YNPA 3OOIA 4RZ0A 3F9YA 5F5EA 3PDNA 3DALA 3FPDA 3SWCA 3SW9A 3RU0A 4QENA 1O9SA 3TG5A 3RAYA 5CCMA 3OXFA 5JHNA 3MO2A 4MI5A 1ZKKA 3S7JA 3N71A 2BQZA 3DB5A 3KMTA 3OXGA 1MVXA 4H12A 4WUYA 2F69A 4FMUA 5KJNA 5CPRB 5LSZA 5F59A 4O6FA 4C1QA 3QWWA 3CBMA 3M56A 2O8JA 5HI7A 2W5YA 5JINA 2RFIA 3VV0A 4JLGA 3EP0A 4J8OA 4MI0A 3MEKA 1H3IA 3BO5A 2QPWA 5JJ0A 3S7DA 3F9XA 1N6CA 1N3JA 3S7BA 3M53A 1PEGA 5KJLA 3HNAA 3RJWA 3M57A 5F6LA 2IGQA 5EX3A 5TTFA 5AYFA 3KMJA 3VUZA 4YNDA 1N6AA 4QEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T0K A;  4BUP A;  5KJM A;  5T0M A;  2R3A A;  3TG4 A;  4JDS A;  1MT6 A;  4YPE A;  4YNM A;  5EX0 A;  1ML9 A;  3MO0 A;  2G46 A;  4NVQ A;  3RQ4 A;  5KJK A;  4NJ5 A;  5EG2 A;  3S8P A;  2W5Z A;  4AU7 A;  3RIB A;  3MO5 A;  3QWV A;  3OS5 A;  5F6K C;  5ARF A;  4QEP A;  3M59 A;  5CCL A;  3IHX A;  3M55 A;  5JIY A;  4IJD A;  3OXL A;  1MUF A;  4YPA A;  2JV0 A;  4O30 A;  3CBP A;  3K5K A;  3CBO A;  5ARG A;  3OPE A;  4J83 A;  3F9W A;  4Z4P A;  3M58 A;  1XQH A;  3M5A A;  3F9Z A;  5TEG A;  3S7F A;  3M54 A;  4J7F A;  3KMA A;  4YPU A;  5LSX A;  5T5G A;  5HQ8 A;  4IJ8 A;  3QWP A;  1MVH A;  4E47 A;  4I51 A;  5TH7 A;  4J7I A;  4LDG A;  4YNP A;  3OOI A;  4RZ0 A;  3F9Y A;  5F5E A;  3PDN A;  3DAL A;  3FPD A;  3SWC A;  3SW9 A;  3RU0 A;  4QEN A;  1O9S A;  3TG5 A;  3RAY A;  5CCM A;  3OXF A;  5JHN A;  3MO2 A;  4MI5 A;  1ZKK A;  3S7J A;  3N71 A;  2BQZ A;  3DB5 A;  3KMT A;  3OXG A;  1MVX A;  4H12 A;  4WUY A;  2F69 A;  4FMU A;  5KJN A;  5CPR B;  5LSZ A;  5F59 A;  4O6F A;  4C1Q A;  3QWW A;  3CBM A;  3M56 A;  2O8J A;  5HI7 A;  2W5Y A;  5JIN A;  2RFI A;  3VV0 A;  4JLG A;  3EP0 A;  4J8O A;  4MI0 A;  3MEK A;  1H3I A;  3BO5 A;  2QPW A;  5JJ0 A;  3S7D A;  3F9X A;  1N6C A;  1N3J A;  3S7B A;  3M53 A;  1PEG A;  5KJL A;  3HNA A;  3RJW A;  3M57 A;  5F6L A;  2IGQ A;  5EX3 A;  5TTF A;  5AYF A;  3KMJ A;  3VUZ A;  4YND A;  1N6A A;  4QEO A; 
#chains in the Genus database with same CATH topology
 5T0K A;  4BUP A;  5KJM A;  5T0M A;  2R3A A;  3TG4 A;  4JDS A;  1MT6 A;  4YPE A;  4YNM A;  5EX0 A;  1ML9 A;  3MO0 A;  2G46 A;  4NVQ A;  3RQ4 A;  5KJK A;  4NJ5 A;  5EG2 A;  3S8P A;  2W5Z A;  4AU7 A;  3RIB A;  3MO5 A;  3QWV A;  3OS5 A;  5F6K C;  5ARF A;  4QEP A;  3M59 A;  5CCL A;  3IHX A;  3M55 A;  5JIY A;  4IJD A;  3OXL A;  1MUF A;  4YPA A;  2JV0 A;  4O30 A;  3CBP A;  3K5K A;  3CBO A;  5ARG A;  3OPE A;  4J83 A;  3F9W A;  4Z4P A;  3M58 A;  1XQH A;  3M5A A;  3F9Z A;  5TEG A;  3S7F A;  3M54 A;  4J7F A;  3KMA A;  4YPU A;  5LSX A;  5T5G A;  5HQ8 A;  4IJ8 A;  3QWP A;  1MVH A;  4E47 A;  4I51 A;  5TH7 A;  4J7I A;  4LDG A;  4YNP A;  3OOI A;  4RZ0 A;  3F9Y A;  5F5E A;  3PDN A;  3DAL A;  3FPD A;  3SWC A;  3SW9 A;  3RU0 A;  4QEN A;  1O9S A;  3TG5 A;  3RAY A;  5CCM A;  3OXF A;  5JHN A;  3MO2 A;  4MI5 A;  1ZKK A;  3S7J A;  3N71 A;  2BQZ A;  3DB5 A;  3KMT A;  3OXG A;  1MVX A;  4H12 A;  4WUY A;  2F69 A;  4FMU A;  5KJN A;  5CPR B;  5LSZ A;  5F59 A;  4O6F A;  4C1Q A;  3QWW A;  3CBM A;  3M56 A;  2O8J A;  5HI7 A;  2W5Y A;  5JIN A;  2RFI A;  3VV0 A;  4JLG A;  3EP0 A;  4J8O A;  4MI0 A;  3MEK A;  1H3I A;  3BO5 A;  2QPW A;  5JJ0 A;  3S7D A;  3F9X A;  1N6C A;  1N3J A;  3S7B A;  3M53 A;  1PEG A;  5KJL A;  3HNA A;  3RJW A;  3M57 A;  5F6L A;  2IGQ A;  5EX3 A;  5TTF A;  5AYF A;  3KMJ A;  3VUZ A;  4YND A;  1N6A A;  4QEO A; 
#chains in the Genus database with same CATH homology
 5T0K A;  4BUP A;  5KJM A;  5T0M A;  2R3A A;  3TG4 A;  4JDS A;  1MT6 A;  4YPE A;  4YNM A;  5EX0 A;  1ML9 A;  3MO0 A;  2G46 A;  4NVQ A;  3RQ4 A;  5KJK A;  4NJ5 A;  5EG2 A;  3S8P A;  2W5Z A;  4AU7 A;  3RIB A;  3MO5 A;  3QWV A;  3OS5 A;  5F6K C;  5ARF A;  4QEP A;  3M59 A;  5CCL A;  3IHX A;  3M55 A;  5JIY A;  4IJD A;  3OXL A;  1MUF A;  4YPA A;  2JV0 A;  4O30 A;  3CBP A;  3K5K A;  3CBO A;  5ARG A;  3OPE A;  4J83 A;  3F9W A;  4Z4P A;  3M58 A;  1XQH A;  3M5A A;  3F9Z A;  5TEG A;  3S7F A;  3M54 A;  4J7F A;  3KMA A;  4YPU A;  5LSX A;  5T5G A;  5HQ8 A;  4IJ8 A;  3QWP A;  1MVH A;  4E47 A;  4I51 A;  5TH7 A;  4J7I A;  4LDG A;  4YNP A;  3OOI A;  4RZ0 A;  3F9Y A;  5F5E A;  3PDN A;  3DAL A;  3FPD A;  3SWC A;  3SW9 A;  3RU0 A;  4QEN A;  1O9S A;  3TG5 A;  3RAY A;  5CCM A;  3OXF A;  5JHN A;  3MO2 A;  4MI5 A;  1ZKK A;  3S7J A;  3N71 A;  2BQZ A;  3DB5 A;  3KMT A;  3OXG A;  1MVX A;  4H12 A;  4WUY A;  2F69 A;  4FMU A;  5KJN A;  5CPR B;  5LSZ A;  5F59 A;  4O6F A;  4C1Q A;  3QWW A;  3CBM A;  3M56 A;  2O8J A;  5HI7 A;  2W5Y A;  5JIN A;  2RFI A;  3VV0 A;  4JLG A;  3EP0 A;  4J8O A;  4MI0 A;  3MEK A;  1H3I A;  3BO5 A;  2QPW A;  5JJ0 A;  3S7D A;  3F9X A;  1N6C A;  1N3J A;  3S7B A;  3M53 A;  1PEG A;  5KJL A;  3HNA A;  3RJW A;  3M57 A;  5F6L A;  2IGQ A;  5EX3 A;  5TTF A;  5AYF A;  3KMJ A;  3VUZ A;  4YND A;  1N6A A;  4QEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...