5TH7A

Complex of setd8 with ms453
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
143
structure length
143
Chain Sequence
KAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKSGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-lysine methyltransferase KMT5A
publication title Structure-Based Design of a Covalent Inhibitor of the SET Domain-Containing Protein 8 (SETD8) Lysine Methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 38
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5th7A00
5JHNA 3DALA 3M56A 1XQHA 3K5KA 1PEGA 4JDSA 5HI7A 4O6FA 4E47A 3M53A 5KJMA 3M55A 3BO5A 1N6CA 5AYFA 5TEGA 3S7JA 2O8JA 2QPWA 3M59A 5KJNA 5CCLA 1N3JA 5F59A 3MO2A 4H12A 4QENA 4YPEA 4NJ5A 3RU0A 4MI5A 3RQ4A 4O30A 4NVQA 5ARGA 4IJDA 3OPEA 4J7FA 5KJLA 3N71A 3S8PA 3SW9A 3RIBA 4BUPA 5JINA 3KMAA 5EX0A 3MO5A 4MI0A 5EG2A 3S7DA 5KJKA 3S7BA 5CPRB 2IGQA 5T5GA 5F6KC 3M57A 3F9XA 4JLGA 3F9WA 5LSZA 3DB5A 3F9YA 3OXGA 3QWPA 4I51A 3SWCA 3S7FA 5T0MA 5TTFA 3F9ZA 2F69A 3M58A 5TH7A 4J83A 1MUFA 5CCMA 3KMTA 3MO0A 2JV0A 5JIYA 3CBPA 2RFIA 4IJ8A 3RJWA 4YNDA 4J8OA 4Z4PA 3QWVA 3EP0A 1MVXA 3TG5A 1MT6A 2W5YA 3HNAA 3VV0A 3TG4A 5ARFA 1O9SA 4LDGA 4QEPA 1H3IA 4FMUA 2G46A 3M5AA 3KMJA 4J7IA 5EX3A 4AU7A 4YNPA 3CBMA 3IHXA 4YPUA 5LSXA 4QEOA 1ZKKA 3FPDA 3MEKA 5F6LA 3VUZA 3OS5A 5JJ0A 4YNMA 4WUYA 1ML9A 1N6AA 2W5ZA 3OXFA 3OOIA 3RAYA 4YPAA 5F5EA 2R3AA 1MVHA 3CBOA 3M54A 4RZ0A 5T0KA 4C1QA 5HQ8A 3OXLA 2BQZA 3QWWA 3PDNA
chains in the Genus database with same CATH superfamily
5JHNA 3DALA 3M56A 1XQHA 3K5KA 1PEGA 4JDSA 5HI7A 4O6FA 4E47A 3M53A 5KJMA 3M55A 3BO5A 1N6CA 5AYFA 5TEGA 3S7JA 2O8JA 2QPWA 3M59A 5KJNA 5CCLA 1N3JA 5F59A 3MO2A 4H12A 4QENA 4YPEA 4NJ5A 3RU0A 4MI5A 3RQ4A 4O30A 4NVQA 5ARGA 4IJDA 3OPEA 4J7FA 5KJLA 3N71A 3S8PA 3SW9A 3RIBA 4BUPA 5JINA 3KMAA 5EX0A 3MO5A 4MI0A 5EG2A 3S7DA 5KJKA 3S7BA 5CPRB 2IGQA 5T5GA 5F6KC 3M57A 3F9XA 4JLGA 3F9WA 5LSZA 3DB5A 3F9YA 3OXGA 3QWPA 4I51A 3SWCA 3S7FA 5T0MA 5TTFA 3F9ZA 2F69A 3M58A 5TH7A 4J83A 1MUFA 5CCMA 3KMTA 3MO0A 2JV0A 5JIYA 3CBPA 2RFIA 4IJ8A 3RJWA 4YNDA 4J8OA 4Z4PA 3QWVA 3EP0A 1MVXA 3TG5A 1MT6A 2W5YA 3HNAA 3VV0A 3TG4A 5ARFA 1O9SA 4LDGA 4QEPA 1H3IA 4FMUA 2G46A 3M5AA 3KMJA 4J7IA 5EX3A 4AU7A 4YNPA 3CBMA 3IHXA 4YPUA 5LSXA 4QEOA 1ZKKA 3FPDA 3MEKA 5F6LA 3VUZA 3OS5A 5JJ0A 4YNMA 4WUYA 1ML9A 1N6AA 2W5ZA 3OXFA 3OOIA 3RAYA 4YPAA 5F5EA 2R3AA 1MVHA 3CBOA 3M54A 4RZ0A 5T0KA 4C1QA 5HQ8A 3OXLA 2BQZA 3QWWA 3PDNA
chains in the Genus database with same CATH topology
5JHNA 3DALA 3M56A 1XQHA 3K5KA 1PEGA 4JDSA 5HI7A 4O6FA 4E47A 3M53A 5KJMA 3M55A 3BO5A 1N6CA 5AYFA 5TEGA 3S7JA 2O8JA 2QPWA 3M59A 5KJNA 5CCLA 1N3JA 5F59A 3MO2A 4H12A 4QENA 4YPEA 4NJ5A 3RU0A 4MI5A 3RQ4A 4O30A 4NVQA 5ARGA 4IJDA 3OPEA 4J7FA 5KJLA 3N71A 3S8PA 3SW9A 3RIBA 4BUPA 5JINA 3KMAA 5EX0A 3MO5A 4MI0A 5EG2A 3S7DA 5KJKA 3S7BA 5CPRB 2IGQA 5T5GA 5F6KC 3M57A 3F9XA 4JLGA 3F9WA 5LSZA 3DB5A 3F9YA 3OXGA 3QWPA 4I51A 3SWCA 3S7FA 5T0MA 5TTFA 3F9ZA 2F69A 3M58A 5TH7A 4J83A 1MUFA 5CCMA 3KMTA 3MO0A 2JV0A 5JIYA 3CBPA 2RFIA 4IJ8A 3RJWA 4YNDA 4J8OA 4Z4PA 3QWVA 3EP0A 1MVXA 3TG5A 1MT6A 2W5YA 3HNAA 3VV0A 3TG4A 5ARFA 1O9SA 4LDGA 4QEPA 1H3IA 4FMUA 2G46A 3M5AA 3KMJA 4J7IA 5EX3A 4AU7A 4YNPA 3CBMA 3IHXA 4YPUA 5LSXA 4QEOA 1ZKKA 3FPDA 3MEKA 5F6LA 3VUZA 3OS5A 5JJ0A 4YNMA 4WUYA 1ML9A 1N6AA 2W5ZA 3OXFA 3OOIA 3RAYA 4YPAA 5F5EA 2R3AA 1MVHA 3CBOA 3M54A 4RZ0A 5T0KA 4C1QA 5HQ8A 3OXLA 2BQZA 3QWWA 3PDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JHN A;  3DAL A;  3M56 A;  1XQH A;  3K5K A;  1PEG A;  4JDS A;  5HI7 A;  4O6F A;  4E47 A;  3M53 A;  5KJM A;  3M55 A;  3BO5 A;  1N6C A;  5AYF A;  5TEG A;  3S7J A;  2O8J A;  2QPW A;  3M59 A;  5KJN A;  5CCL A;  1N3J A;  5F59 A;  3MO2 A;  4H12 A;  4QEN A;  4YPE A;  4NJ5 A;  3RU0 A;  4MI5 A;  3RQ4 A;  4O30 A;  4NVQ A;  5ARG A;  4IJD A;  3OPE A;  4J7F A;  5KJL A;  3N71 A;  3S8P A;  3SW9 A;  3RIB A;  4BUP A;  5JIN A;  3KMA A;  5EX0 A;  3MO5 A;  4MI0 A;  5EG2 A;  3S7D A;  5KJK A;  3S7B A;  5CPR B;  2IGQ A;  5T5G A;  5F6K C;  3M57 A;  3F9X A;  4JLG A;  3F9W A;  5LSZ A;  3DB5 A;  3F9Y A;  3OXG A;  3QWP A;  4I51 A;  3SWC A;  3S7F A;  5T0M A;  5TTF A;  3F9Z A;  2F69 A;  3M58 A;  5TH7 A;  4J83 A;  1MUF A;  5CCM A;  3KMT A;  3MO0 A;  2JV0 A;  5JIY A;  3CBP A;  2RFI A;  4IJ8 A;  3RJW A;  4YND A;  4J8O A;  4Z4P A;  3QWV A;  3EP0 A;  1MVX A;  3TG5 A;  1MT6 A;  2W5Y A;  3HNA A;  3VV0 A;  3TG4 A;  5ARF A;  1O9S A;  4LDG A;  4QEP A;  1H3I A;  4FMU A;  2G46 A;  3M5A A;  3KMJ A;  4J7I A;  5EX3 A;  4AU7 A;  4YNP A;  3CBM A;  3IHX A;  4YPU A;  5LSX A;  4QEO A;  1ZKK A;  3FPD A;  3MEK A;  5F6L A;  3VUZ A;  3OS5 A;  5JJ0 A;  4YNM A;  4WUY A;  1ML9 A;  1N6A A;  2W5Z A;  3OXF A;  3OOI A;  3RAY A;  4YPA A;  5F5E A;  2R3A A;  1MVH A;  3CBO A;  3M54 A;  4RZ0 A;  5T0K A;  4C1Q A;  5HQ8 A;  3OXL A;  2BQZ A;  3QWW A;  3PDN A; 
#chains in the Genus database with same CATH topology
 5JHN A;  3DAL A;  3M56 A;  1XQH A;  3K5K A;  1PEG A;  4JDS A;  5HI7 A;  4O6F A;  4E47 A;  3M53 A;  5KJM A;  3M55 A;  3BO5 A;  1N6C A;  5AYF A;  5TEG A;  3S7J A;  2O8J A;  2QPW A;  3M59 A;  5KJN A;  5CCL A;  1N3J A;  5F59 A;  3MO2 A;  4H12 A;  4QEN A;  4YPE A;  4NJ5 A;  3RU0 A;  4MI5 A;  3RQ4 A;  4O30 A;  4NVQ A;  5ARG A;  4IJD A;  3OPE A;  4J7F A;  5KJL A;  3N71 A;  3S8P A;  3SW9 A;  3RIB A;  4BUP A;  5JIN A;  3KMA A;  5EX0 A;  3MO5 A;  4MI0 A;  5EG2 A;  3S7D A;  5KJK A;  3S7B A;  5CPR B;  2IGQ A;  5T5G A;  5F6K C;  3M57 A;  3F9X A;  4JLG A;  3F9W A;  5LSZ A;  3DB5 A;  3F9Y A;  3OXG A;  3QWP A;  4I51 A;  3SWC A;  3S7F A;  5T0M A;  5TTF A;  3F9Z A;  2F69 A;  3M58 A;  5TH7 A;  4J83 A;  1MUF A;  5CCM A;  3KMT A;  3MO0 A;  2JV0 A;  5JIY A;  3CBP A;  2RFI A;  4IJ8 A;  3RJW A;  4YND A;  4J8O A;  4Z4P A;  3QWV A;  3EP0 A;  1MVX A;  3TG5 A;  1MT6 A;  2W5Y A;  3HNA A;  3VV0 A;  3TG4 A;  5ARF A;  1O9S A;  4LDG A;  4QEP A;  1H3I A;  4FMU A;  2G46 A;  3M5A A;  3KMJ A;  4J7I A;  5EX3 A;  4AU7 A;  4YNP A;  3CBM A;  3IHX A;  4YPU A;  5LSX A;  4QEO A;  1ZKK A;  3FPD A;  3MEK A;  5F6L A;  3VUZ A;  3OS5 A;  5JJ0 A;  4YNM A;  4WUY A;  1ML9 A;  1N6A A;  2W5Z A;  3OXF A;  3OOI A;  3RAY A;  4YPA A;  5F5E A;  2R3A A;  1MVH A;  3CBO A;  3M54 A;  4RZ0 A;  5T0K A;  4C1Q A;  5HQ8 A;  3OXL A;  2BQZ A;  3QWW A;  3PDN A; 
#chains in the Genus database with same CATH homology
 5JHN A;  3DAL A;  3M56 A;  1XQH A;  3K5K A;  1PEG A;  4JDS A;  5HI7 A;  4O6F A;  4E47 A;  3M53 A;  5KJM A;  3M55 A;  3BO5 A;  1N6C A;  5AYF A;  5TEG A;  3S7J A;  2O8J A;  2QPW A;  3M59 A;  5KJN A;  5CCL A;  1N3J A;  5F59 A;  3MO2 A;  4H12 A;  4QEN A;  4YPE A;  4NJ5 A;  3RU0 A;  4MI5 A;  3RQ4 A;  4O30 A;  4NVQ A;  5ARG A;  4IJD A;  3OPE A;  4J7F A;  5KJL A;  3N71 A;  3S8P A;  3SW9 A;  3RIB A;  4BUP A;  5JIN A;  3KMA A;  5EX0 A;  3MO5 A;  4MI0 A;  5EG2 A;  3S7D A;  5KJK A;  3S7B A;  5CPR B;  2IGQ A;  5T5G A;  5F6K C;  3M57 A;  3F9X A;  4JLG A;  3F9W A;  5LSZ A;  3DB5 A;  3F9Y A;  3OXG A;  3QWP A;  4I51 A;  3SWC A;  3S7F A;  5T0M A;  5TTF A;  3F9Z A;  2F69 A;  3M58 A;  5TH7 A;  4J83 A;  1MUF A;  5CCM A;  3KMT A;  3MO0 A;  2JV0 A;  5JIY A;  3CBP A;  2RFI A;  4IJ8 A;  3RJW A;  4YND A;  4J8O A;  4Z4P A;  3QWV A;  3EP0 A;  1MVX A;  3TG5 A;  1MT6 A;  2W5Y A;  3HNA A;  3VV0 A;  3TG4 A;  5ARF A;  1O9S A;  4LDG A;  4QEP A;  1H3I A;  4FMU A;  2G46 A;  3M5A A;  3KMJ A;  4J7I A;  5EX3 A;  4AU7 A;  4YNP A;  3CBM A;  3IHX A;  4YPU A;  5LSX A;  4QEO A;  1ZKK A;  3FPD A;  3MEK A;  5F6L A;  3VUZ A;  3OS5 A;  5JJ0 A;  4YNM A;  4WUY A;  1ML9 A;  1N6A A;  2W5Z A;  3OXF A;  3OOI A;  3RAY A;  4YPA A;  5F5E A;  2R3A A;  1MVH A;  3CBO A;  3M54 A;  4RZ0 A;  5T0K A;  4C1Q A;  5HQ8 A;  3OXL A;  2BQZ A;  3QWW A;  3PDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...