5TH7A

Complex of setd8 with ms453
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
143
structure length
143
Chain Sequence
KAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKSGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Based Design of a Covalent Inhibitor of the SET Domain-Containing Protein 8 (SETD8) Lysine Methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords N-lysine methyltransferase KMT5A
total genus 38
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5th7A00
4LDGA 3DALA 3OXGA 3SW9A 5JJ0A 3RAYA 5KJLA 3M56A 4WUYA 3IHXA 5LSXA 3S8PA 3RJWA 4I51A 3M59A 4BUPA 3F9YA 4C1QA 2R3AA 3QWWA 5TTFA 3S7FA 4YPUA 3KMJA 5TH7A 4YNPA 1MUFA 5EX3A 5JINA 5F59A 2W5ZA 3BO5A 3RIBA 5KJMA 4FMUA 4RZ0A 5ARGA 3RU0A 1N6AA 3SWCA 4JLGA 4QENA 2JV0A 3M55A 5LSZA 3OXFA 2O8JA 2RFIA 4E47A 3TG5A 5HQ8A 3S7JA 4MI0A 3M54A 3M5AA 4NVQA 3QWPA 4IJDA 3CBPA 5JIYA 4JDSA 4O6FA 2BQZA 3MO5A 1N6CA 2F69A 5CPRB 3TG4A 4Z4PA 3F9ZA 3KMTA 4J7IA 3F9XA 3S7BA 5F5EA 1XQHA 3EP0A 5F6KC 3M58A 3PDNA 4YNDA 3OOIA 3N71A 5EX0A 5KJKA 4J83A 1MVXA 5EG2A 5T5GA 5CCMA 3QWVA 3VV0A 4YPEA 1ML9A 4MI5A 5TEGA 3DB5A 3CBOA 5F6LA 3M53A 5CCLA 3FPDA 4O30A 3RQ4A 4J8OA 5ARFA 2QPWA 1ZKKA 3OXLA 5T0MA 3S7DA 1H3IA 3HNAA 4YPAA 3VUZA 4QEPA 5KJNA 3CBMA 3F9WA 2W5YA 4IJ8A 4J7FA 1N3JA 3MO0A 3M57A 3MO2A 4AU7A 4QEOA 1PEGA 1O9SA 5T0KA 3KMAA 4H12A 3MEKA 5AYFA 5HI7A 3OPEA 5JHNA 4YNMA 1MT6A 1MVHA 2IGQA 4NJ5A 3OS5A 2G46A 3K5KA
chains in the Genus database with same CATH superfamily
4LDGA 3DALA 3OXGA 3SW9A 5JJ0A 3RAYA 5KJLA 3M56A 4WUYA 3IHXA 5LSXA 3S8PA 3RJWA 4I51A 3M59A 4BUPA 3F9YA 4C1QA 2R3AA 3QWWA 5TTFA 3S7FA 4YPUA 3KMJA 5TH7A 4YNPA 1MUFA 5EX3A 5JINA 5F59A 2W5ZA 3BO5A 3RIBA 5KJMA 4FMUA 4RZ0A 5ARGA 3RU0A 1N6AA 3SWCA 4JLGA 4QENA 2JV0A 3M55A 5LSZA 3OXFA 2O8JA 2RFIA 4E47A 3TG5A 5HQ8A 3S7JA 4MI0A 3M54A 3M5AA 4NVQA 3QWPA 4IJDA 3CBPA 5JIYA 4JDSA 4O6FA 2BQZA 3MO5A 1N6CA 2F69A 5CPRB 3TG4A 4Z4PA 3F9ZA 3KMTA 4J7IA 3F9XA 3S7BA 5F5EA 1XQHA 3EP0A 5F6KC 3M58A 3PDNA 4YNDA 3OOIA 3N71A 5EX0A 5KJKA 4J83A 1MVXA 5EG2A 5T5GA 5CCMA 3QWVA 3VV0A 4YPEA 1ML9A 4MI5A 5TEGA 3DB5A 3CBOA 5F6LA 3M53A 5CCLA 3FPDA 4O30A 3RQ4A 4J8OA 5ARFA 2QPWA 1ZKKA 3OXLA 5T0MA 3S7DA 1H3IA 3HNAA 4YPAA 3VUZA 4QEPA 5KJNA 3CBMA 3F9WA 2W5YA 4IJ8A 4J7FA 1N3JA 3MO0A 3M57A 3MO2A 4AU7A 4QEOA 1PEGA 1O9SA 5T0KA 3KMAA 4H12A 3MEKA 5AYFA 5HI7A 3OPEA 5JHNA 4YNMA 1MT6A 1MVHA 2IGQA 4NJ5A 3OS5A 2G46A 3K5KA
chains in the Genus database with same CATH topology
4LDGA 3DALA 3OXGA 3SW9A 5JJ0A 3RAYA 5KJLA 3M56A 4WUYA 3IHXA 5LSXA 3S8PA 3RJWA 4I51A 3M59A 4BUPA 3F9YA 4C1QA 2R3AA 3QWWA 5TTFA 3S7FA 4YPUA 3KMJA 5TH7A 4YNPA 1MUFA 5EX3A 5JINA 5F59A 2W5ZA 3BO5A 3RIBA 5KJMA 4FMUA 4RZ0A 5ARGA 3RU0A 1N6AA 3SWCA 4JLGA 4QENA 2JV0A 3M55A 5LSZA 3OXFA 2O8JA 2RFIA 4E47A 3TG5A 5HQ8A 3S7JA 4MI0A 3M54A 3M5AA 4NVQA 3QWPA 4IJDA 3CBPA 5JIYA 4JDSA 4O6FA 2BQZA 3MO5A 1N6CA 2F69A 5CPRB 3TG4A 4Z4PA 3F9ZA 3KMTA 4J7IA 3F9XA 3S7BA 5F5EA 1XQHA 3EP0A 5F6KC 3M58A 3PDNA 4YNDA 3OOIA 3N71A 5EX0A 5KJKA 4J83A 1MVXA 5EG2A 5T5GA 5CCMA 3QWVA 3VV0A 4YPEA 1ML9A 4MI5A 5TEGA 3DB5A 3CBOA 5F6LA 3M53A 5CCLA 3FPDA 4O30A 3RQ4A 4J8OA 5ARFA 2QPWA 1ZKKA 3OXLA 5T0MA 3S7DA 1H3IA 3HNAA 4YPAA 3VUZA 4QEPA 5KJNA 3CBMA 3F9WA 2W5YA 4IJ8A 4J7FA 1N3JA 3MO0A 3M57A 3MO2A 4AU7A 4QEOA 1PEGA 1O9SA 5T0KA 3KMAA 4H12A 3MEKA 5AYFA 5HI7A 3OPEA 5JHNA 4YNMA 1MT6A 1MVHA 2IGQA 4NJ5A 3OS5A 2G46A 3K5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LDG A;  3DAL A;  3OXG A;  3SW9 A;  5JJ0 A;  3RAY A;  5KJL A;  3M56 A;  4WUY A;  3IHX A;  5LSX A;  3S8P A;  3RJW A;  4I51 A;  3M59 A;  4BUP A;  3F9Y A;  4C1Q A;  2R3A A;  3QWW A;  5TTF A;  3S7F A;  4YPU A;  3KMJ A;  5TH7 A;  4YNP A;  1MUF A;  5EX3 A;  5JIN A;  5F59 A;  2W5Z A;  3BO5 A;  3RIB A;  5KJM A;  4FMU A;  4RZ0 A;  5ARG A;  3RU0 A;  1N6A A;  3SWC A;  4JLG A;  4QEN A;  2JV0 A;  3M55 A;  5LSZ A;  3OXF A;  2O8J A;  2RFI A;  4E47 A;  3TG5 A;  5HQ8 A;  3S7J A;  4MI0 A;  3M54 A;  3M5A A;  4NVQ A;  3QWP A;  4IJD A;  3CBP A;  5JIY A;  4JDS A;  4O6F A;  2BQZ A;  3MO5 A;  1N6C A;  2F69 A;  5CPR B;  3TG4 A;  4Z4P A;  3F9Z A;  3KMT A;  4J7I A;  3F9X A;  3S7B A;  5F5E A;  1XQH A;  3EP0 A;  5F6K C;  3M58 A;  3PDN A;  4YND A;  3OOI A;  3N71 A;  5EX0 A;  5KJK A;  4J83 A;  1MVX A;  5EG2 A;  5T5G A;  5CCM A;  3QWV A;  3VV0 A;  4YPE A;  1ML9 A;  4MI5 A;  5TEG A;  3DB5 A;  3CBO A;  5F6L A;  3M53 A;  5CCL A;  3FPD A;  4O30 A;  3RQ4 A;  4J8O A;  5ARF A;  2QPW A;  1ZKK A;  3OXL A;  5T0M A;  3S7D A;  1H3I A;  3HNA A;  4YPA A;  3VUZ A;  4QEP A;  5KJN A;  3CBM A;  3F9W A;  2W5Y A;  4IJ8 A;  4J7F A;  1N3J A;  3MO0 A;  3M57 A;  3MO2 A;  4AU7 A;  4QEO A;  1PEG A;  1O9S A;  5T0K A;  3KMA A;  4H12 A;  3MEK A;  5AYF A;  5HI7 A;  3OPE A;  5JHN A;  4YNM A;  1MT6 A;  1MVH A;  2IGQ A;  4NJ5 A;  3OS5 A;  2G46 A;  3K5K A; 
#chains in the Genus database with same CATH topology
 4LDG A;  3DAL A;  3OXG A;  3SW9 A;  5JJ0 A;  3RAY A;  5KJL A;  3M56 A;  4WUY A;  3IHX A;  5LSX A;  3S8P A;  3RJW A;  4I51 A;  3M59 A;  4BUP A;  3F9Y A;  4C1Q A;  2R3A A;  3QWW A;  5TTF A;  3S7F A;  4YPU A;  3KMJ A;  5TH7 A;  4YNP A;  1MUF A;  5EX3 A;  5JIN A;  5F59 A;  2W5Z A;  3BO5 A;  3RIB A;  5KJM A;  4FMU A;  4RZ0 A;  5ARG A;  3RU0 A;  1N6A A;  3SWC A;  4JLG A;  4QEN A;  2JV0 A;  3M55 A;  5LSZ A;  3OXF A;  2O8J A;  2RFI A;  4E47 A;  3TG5 A;  5HQ8 A;  3S7J A;  4MI0 A;  3M54 A;  3M5A A;  4NVQ A;  3QWP A;  4IJD A;  3CBP A;  5JIY A;  4JDS A;  4O6F A;  2BQZ A;  3MO5 A;  1N6C A;  2F69 A;  5CPR B;  3TG4 A;  4Z4P A;  3F9Z A;  3KMT A;  4J7I A;  3F9X A;  3S7B A;  5F5E A;  1XQH A;  3EP0 A;  5F6K C;  3M58 A;  3PDN A;  4YND A;  3OOI A;  3N71 A;  5EX0 A;  5KJK A;  4J83 A;  1MVX A;  5EG2 A;  5T5G A;  5CCM A;  3QWV A;  3VV0 A;  4YPE A;  1ML9 A;  4MI5 A;  5TEG A;  3DB5 A;  3CBO A;  5F6L A;  3M53 A;  5CCL A;  3FPD A;  4O30 A;  3RQ4 A;  4J8O A;  5ARF A;  2QPW A;  1ZKK A;  3OXL A;  5T0M A;  3S7D A;  1H3I A;  3HNA A;  4YPA A;  3VUZ A;  4QEP A;  5KJN A;  3CBM A;  3F9W A;  2W5Y A;  4IJ8 A;  4J7F A;  1N3J A;  3MO0 A;  3M57 A;  3MO2 A;  4AU7 A;  4QEO A;  1PEG A;  1O9S A;  5T0K A;  3KMA A;  4H12 A;  3MEK A;  5AYF A;  5HI7 A;  3OPE A;  5JHN A;  4YNM A;  1MT6 A;  1MVH A;  2IGQ A;  4NJ5 A;  3OS5 A;  2G46 A;  3K5K A; 
#chains in the Genus database with same CATH homology
 4LDG A;  3DAL A;  3OXG A;  3SW9 A;  5JJ0 A;  3RAY A;  5KJL A;  3M56 A;  4WUY A;  3IHX A;  5LSX A;  3S8P A;  3RJW A;  4I51 A;  3M59 A;  4BUP A;  3F9Y A;  4C1Q A;  2R3A A;  3QWW A;  5TTF A;  3S7F A;  4YPU A;  3KMJ A;  5TH7 A;  4YNP A;  1MUF A;  5EX3 A;  5JIN A;  5F59 A;  2W5Z A;  3BO5 A;  3RIB A;  5KJM A;  4FMU A;  4RZ0 A;  5ARG A;  3RU0 A;  1N6A A;  3SWC A;  4JLG A;  4QEN A;  2JV0 A;  3M55 A;  5LSZ A;  3OXF A;  2O8J A;  2RFI A;  4E47 A;  3TG5 A;  5HQ8 A;  3S7J A;  4MI0 A;  3M54 A;  3M5A A;  4NVQ A;  3QWP A;  4IJD A;  3CBP A;  5JIY A;  4JDS A;  4O6F A;  2BQZ A;  3MO5 A;  1N6C A;  2F69 A;  5CPR B;  3TG4 A;  4Z4P A;  3F9Z A;  3KMT A;  4J7I A;  3F9X A;  3S7B A;  5F5E A;  1XQH A;  3EP0 A;  5F6K C;  3M58 A;  3PDN A;  4YND A;  3OOI A;  3N71 A;  5EX0 A;  5KJK A;  4J83 A;  1MVX A;  5EG2 A;  5T5G A;  5CCM A;  3QWV A;  3VV0 A;  4YPE A;  1ML9 A;  4MI5 A;  5TEG A;  3DB5 A;  3CBO A;  5F6L A;  3M53 A;  5CCL A;  3FPD A;  4O30 A;  3RQ4 A;  4J8O A;  5ARF A;  2QPW A;  1ZKK A;  3OXL A;  5T0M A;  3S7D A;  1H3I A;  3HNA A;  4YPA A;  3VUZ A;  4QEP A;  5KJN A;  3CBM A;  3F9W A;  2W5Y A;  4IJ8 A;  4J7F A;  1N3J A;  3MO0 A;  3M57 A;  3MO2 A;  4AU7 A;  4QEO A;  1PEG A;  1O9S A;  5T0K A;  3KMA A;  4H12 A;  3MEK A;  5AYF A;  5HI7 A;  3OPE A;  5JHN A;  4YNM A;  1MT6 A;  1MVH A;  2IGQ A;  4NJ5 A;  3OS5 A;  2G46 A;  3K5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...