4QENA

Crystal structure of kryptonite in complex with mchh dna and sah
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
526
structure length
472
Chain Sequence
b'LEPHLKVTKCLRLFNKQYLLCVQAKLSRPDLKGVTEMIKAKAILYPRKIIGDLPGIDVGHRFFSRAEMCAVGFHNHWLNGIDYMSMEYEKEYSNYKLPLAVSIVMSGQYEDDLDNADTVTYTGQGGHNLTGNKRQIKDQLLERGNLALKHCCEYNVPVRVTRGHNCKSSYTKRVYTYDGLYKVEKFWAQKGVSGFTVYKYRLKRLEGQPELTTDIEGLVCEDISGGLEFKGIPATNRVDDSPVSPTSGFTYIKSLIIEPNVIIPKSSTGCNCRGSCTDSKKCACAKLNGGNFPYVDLNDGRLIESRDVVFECGPHCGCGPKCVNRTSQKRLRFNLEVFRSAKKGWAVRSWEYIPAGSPVCEYIGVVRRTADVNEYIFEIDCPEFCIDAGSTGNFARFINHSCEPNLFVQCVLSSHQDIRLARVVLFAADNISPMQELTYDYGYALDSVHGPDGKVKQLACYCGALNCRKRLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific SUV
molecule tags Transcription/dna
source organism Arabidopsis thaliana
publication title Mechanism of DNA Methylation-Directed Histone Methylation by KRYPTONITE.
pubmed doi rcsb
total genus 135
structure length 472
sequence length 526
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2014-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF02182 SAD_SRA SAD/SRA domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4qenA03
3K5KA 4O30A 4BUPA 4JDSA 4IJ8A 3CBPA 2IGQA 4YPAA 3RQ4A 3PDNA 4O6FA 5ARFA 3RIBA 1ML9A 4FMUA 5EX3A 3OXGA 4YNMA 3RJWA 2W5YA 4C1QA 4QENA 5F6LA 5TTFA 3OOIA 3TG4A 3VUZA 3KMAA 1N6AA 4NJ5A 5LSZA 3M57A 5CPRB 5F59A 3MO2A 4J7IA 5HQ8A 5JJ0A 2BQZA 3BO5A 4I51A 5KJMA 3OPEA 2F69A 2QPWA 3OXLA 3F9WA 3OXFA 3QWPA 5KJNA 1ZKKA 4J83A 3SW9A 3M56A 4WUYA 3M53A 3M58A 3TG5A 3DALA 4YPEA 3HNAA 3F9XA 1O9SA 5KJKA 2O8JA 3SWCA 5EX0A 4YNPA 5JHNA 3M55A 5T5GA 3M54A 2RFIA 5CCLA 1MT6A 1PEGA 3MO5A 3DB5A 3MEKA 5LSXA 3OS5A 3EP0A 1MVXA 2R3AA 3QWWA 4YNDA 2W5ZA 5KJLA 4LDGA 5JIYA 3S7BA 1XQHA 4MI5A 4RZ0A 2JV0A 1H3IA 5CCMA 5F6KC 5TH7A 4YPUA 3KMTA 4E47A 4MI0A 4Z4PA 5T0MA 3VV0A 1N6CA 3S7DA 4JLGA 1MVHA 3FPDA 5AYFA 3MO0A 4NVQA 4H12A 5JINA 3QWVA 4QEPA 3F9ZA 3CBOA 3IHXA 4QEOA 4AU7A 1MUFA 5EG2A 2G46A 3F9YA 5HI7A 5TEGA 3KMJA 1N3JA 3CBMA 3M59A 3RAYA 4J7FA 4J8OA 3S8PA 3M5AA 5F5EA 3RU0A 5T0KA 3S7FA 3N71A 3S7JA 5ARGA 4IJDA
chains in the Genus database with same CATH superfamily
3K5KA 4O30A 4BUPA 4JDSA 4IJ8A 3CBPA 2IGQA 4YPAA 3RQ4A 3PDNA 4O6FA 5ARFA 3RIBA 1ML9A 4FMUA 5EX3A 3OXGA 4YNMA 3RJWA 2W5YA 4C1QA 4QENA 5F6LA 5TTFA 3OOIA 3TG4A 3VUZA 3KMAA 1N6AA 4NJ5A 5LSZA 3M57A 5CPRB 5F59A 3MO2A 4J7IA 5HQ8A 5JJ0A 2BQZA 3BO5A 4I51A 5KJMA 3OPEA 2F69A 2QPWA 3OXLA 3F9WA 3OXFA 3QWPA 5KJNA 1ZKKA 4J83A 3SW9A 3M56A 4WUYA 3M53A 3M58A 3TG5A 3DALA 4YPEA 3HNAA 3F9XA 1O9SA 5KJKA 2O8JA 3SWCA 5EX0A 4YNPA 5JHNA 3M55A 5T5GA 3M54A 2RFIA 5CCLA 1MT6A 1PEGA 3MO5A 3DB5A 3MEKA 5LSXA 3OS5A 3EP0A 1MVXA 2R3AA 3QWWA 4YNDA 2W5ZA 5KJLA 4LDGA 5JIYA 3S7BA 1XQHA 4MI5A 4RZ0A 2JV0A 1H3IA 5CCMA 5F6KC 5TH7A 4YPUA 3KMTA 4E47A 4MI0A 4Z4PA 5T0MA 3VV0A 1N6CA 3S7DA 4JLGA 1MVHA 3FPDA 5AYFA 3MO0A 4NVQA 4H12A 5JINA 3QWVA 4QEPA 3F9ZA 3CBOA 3IHXA 4QEOA 4AU7A 1MUFA 5EG2A 2G46A 3F9YA 5HI7A 5TEGA 3KMJA 1N3JA 3CBMA 3M59A 3RAYA 4J7FA 4J8OA 3S8PA 3M5AA 5F5EA 3RU0A 5T0KA 3S7FA 3N71A 3S7JA 5ARGA 4IJDA
chains in the Genus database with same CATH topology
3K5KA 4O30A 4BUPA 4JDSA 4IJ8A 3CBPA 2IGQA 4YPAA 3RQ4A 3PDNA 4O6FA 5ARFA 3RIBA 1ML9A 4FMUA 5EX3A 3OXGA 4YNMA 3RJWA 2W5YA 4C1QA 4QENA 5F6LA 5TTFA 3OOIA 3TG4A 3VUZA 3KMAA 1N6AA 4NJ5A 5LSZA 3M57A 5CPRB 5F59A 3MO2A 4J7IA 5HQ8A 5JJ0A 2BQZA 3BO5A 4I51A 5KJMA 3OPEA 2F69A 2QPWA 3OXLA 3F9WA 3OXFA 3QWPA 5KJNA 1ZKKA 4J83A 3SW9A 3M56A 4WUYA 3M53A 3M58A 3TG5A 3DALA 4YPEA 3HNAA 3F9XA 1O9SA 5KJKA 2O8JA 3SWCA 5EX0A 4YNPA 5JHNA 3M55A 5T5GA 3M54A 2RFIA 5CCLA 1MT6A 1PEGA 3MO5A 3DB5A 3MEKA 5LSXA 3OS5A 3EP0A 1MVXA 2R3AA 3QWWA 4YNDA 2W5ZA 5KJLA 4LDGA 5JIYA 3S7BA 1XQHA 4MI5A 4RZ0A 2JV0A 1H3IA 5CCMA 5F6KC 5TH7A 4YPUA 3KMTA 4E47A 4MI0A 4Z4PA 5T0MA 3VV0A 1N6CA 3S7DA 4JLGA 1MVHA 3FPDA 5AYFA 3MO0A 4NVQA 4H12A 5JINA 3QWVA 4QEPA 3F9ZA 3CBOA 3IHXA 4QEOA 4AU7A 1MUFA 5EG2A 2G46A 3F9YA 5HI7A 5TEGA 3KMJA 1N3JA 3CBMA 3M59A 3RAYA 4J7FA 4J8OA 3S8PA 3M5AA 5F5EA 3RU0A 5T0KA 3S7FA 3N71A 3S7JA 5ARGA 4IJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K5K A;  4O30 A;  4BUP A;  4JDS A;  4IJ8 A;  3CBP A;  2IGQ A;  4YPA A;  3RQ4 A;  3PDN A;  4O6F A;  5ARF A;  3RIB A;  1ML9 A;  4FMU A;  5EX3 A;  3OXG A;  4YNM A;  3RJW A;  2W5Y A;  4C1Q A;  4QEN A;  5F6L A;  5TTF A;  3OOI A;  3TG4 A;  3VUZ A;  3KMA A;  1N6A A;  4NJ5 A;  5LSZ A;  3M57 A;  5CPR B;  5F59 A;  3MO2 A;  4J7I A;  5HQ8 A;  5JJ0 A;  2BQZ A;  3BO5 A;  4I51 A;  5KJM A;  3OPE A;  2F69 A;  2QPW A;  3OXL A;  3F9W A;  3OXF A;  3QWP A;  5KJN A;  1ZKK A;  4J83 A;  3SW9 A;  3M56 A;  4WUY A;  3M53 A;  3M58 A;  3TG5 A;  3DAL A;  4YPE A;  3HNA A;  3F9X A;  1O9S A;  5KJK A;  2O8J A;  3SWC A;  5EX0 A;  4YNP A;  5JHN A;  3M55 A;  5T5G A;  3M54 A;  2RFI A;  5CCL A;  1MT6 A;  1PEG A;  3MO5 A;  3DB5 A;  3MEK A;  5LSX A;  3OS5 A;  3EP0 A;  1MVX A;  2R3A A;  3QWW A;  4YND A;  2W5Z A;  5KJL A;  4LDG A;  5JIY A;  3S7B A;  1XQH A;  4MI5 A;  4RZ0 A;  2JV0 A;  1H3I A;  5CCM A;  5F6K C;  5TH7 A;  4YPU A;  3KMT A;  4E47 A;  4MI0 A;  4Z4P A;  5T0M A;  3VV0 A;  1N6C A;  3S7D A;  4JLG A;  1MVH A;  3FPD A;  5AYF A;  3MO0 A;  4NVQ A;  4H12 A;  5JIN A;  3QWV A;  4QEP A;  3F9Z A;  3CBO A;  3IHX A;  4QEO A;  4AU7 A;  1MUF A;  5EG2 A;  2G46 A;  3F9Y A;  5HI7 A;  5TEG A;  3KMJ A;  1N3J A;  3CBM A;  3M59 A;  3RAY A;  4J7F A;  4J8O A;  3S8P A;  3M5A A;  5F5E A;  3RU0 A;  5T0K A;  3S7F A;  3N71 A;  3S7J A;  5ARG A;  4IJD A; 
#chains in the Genus database with same CATH topology
 3K5K A;  4O30 A;  4BUP A;  4JDS A;  4IJ8 A;  3CBP A;  2IGQ A;  4YPA A;  3RQ4 A;  3PDN A;  4O6F A;  5ARF A;  3RIB A;  1ML9 A;  4FMU A;  5EX3 A;  3OXG A;  4YNM A;  3RJW A;  2W5Y A;  4C1Q A;  4QEN A;  5F6L A;  5TTF A;  3OOI A;  3TG4 A;  3VUZ A;  3KMA A;  1N6A A;  4NJ5 A;  5LSZ A;  3M57 A;  5CPR B;  5F59 A;  3MO2 A;  4J7I A;  5HQ8 A;  5JJ0 A;  2BQZ A;  3BO5 A;  4I51 A;  5KJM A;  3OPE A;  2F69 A;  2QPW A;  3OXL A;  3F9W A;  3OXF A;  3QWP A;  5KJN A;  1ZKK A;  4J83 A;  3SW9 A;  3M56 A;  4WUY A;  3M53 A;  3M58 A;  3TG5 A;  3DAL A;  4YPE A;  3HNA A;  3F9X A;  1O9S A;  5KJK A;  2O8J A;  3SWC A;  5EX0 A;  4YNP A;  5JHN A;  3M55 A;  5T5G A;  3M54 A;  2RFI A;  5CCL A;  1MT6 A;  1PEG A;  3MO5 A;  3DB5 A;  3MEK A;  5LSX A;  3OS5 A;  3EP0 A;  1MVX A;  2R3A A;  3QWW A;  4YND A;  2W5Z A;  5KJL A;  4LDG A;  5JIY A;  3S7B A;  1XQH A;  4MI5 A;  4RZ0 A;  2JV0 A;  1H3I A;  5CCM A;  5F6K C;  5TH7 A;  4YPU A;  3KMT A;  4E47 A;  4MI0 A;  4Z4P A;  5T0M A;  3VV0 A;  1N6C A;  3S7D A;  4JLG A;  1MVH A;  3FPD A;  5AYF A;  3MO0 A;  4NVQ A;  4H12 A;  5JIN A;  3QWV A;  4QEP A;  3F9Z A;  3CBO A;  3IHX A;  4QEO A;  4AU7 A;  1MUF A;  5EG2 A;  2G46 A;  3F9Y A;  5HI7 A;  5TEG A;  3KMJ A;  1N3J A;  3CBM A;  3M59 A;  3RAY A;  4J7F A;  4J8O A;  3S8P A;  3M5A A;  5F5E A;  3RU0 A;  5T0K A;  3S7F A;  3N71 A;  3S7J A;  5ARG A;  4IJD A; 
#chains in the Genus database with same CATH homology
 3K5K A;  4O30 A;  4BUP A;  4JDS A;  4IJ8 A;  3CBP A;  2IGQ A;  4YPA A;  3RQ4 A;  3PDN A;  4O6F A;  5ARF A;  3RIB A;  1ML9 A;  4FMU A;  5EX3 A;  3OXG A;  4YNM A;  3RJW A;  2W5Y A;  4C1Q A;  4QEN A;  5F6L A;  5TTF A;  3OOI A;  3TG4 A;  3VUZ A;  3KMA A;  1N6A A;  4NJ5 A;  5LSZ A;  3M57 A;  5CPR B;  5F59 A;  3MO2 A;  4J7I A;  5HQ8 A;  5JJ0 A;  2BQZ A;  3BO5 A;  4I51 A;  5KJM A;  3OPE A;  2F69 A;  2QPW A;  3OXL A;  3F9W A;  3OXF A;  3QWP A;  5KJN A;  1ZKK A;  4J83 A;  3SW9 A;  3M56 A;  4WUY A;  3M53 A;  3M58 A;  3TG5 A;  3DAL A;  4YPE A;  3HNA A;  3F9X A;  1O9S A;  5KJK A;  2O8J A;  3SWC A;  5EX0 A;  4YNP A;  5JHN A;  3M55 A;  5T5G A;  3M54 A;  2RFI A;  5CCL A;  1MT6 A;  1PEG A;  3MO5 A;  3DB5 A;  3MEK A;  5LSX A;  3OS5 A;  3EP0 A;  1MVX A;  2R3A A;  3QWW A;  4YND A;  2W5Z A;  5KJL A;  4LDG A;  5JIY A;  3S7B A;  1XQH A;  4MI5 A;  4RZ0 A;  2JV0 A;  1H3I A;  5CCM A;  5F6K C;  5TH7 A;  4YPU A;  3KMT A;  4E47 A;  4MI0 A;  4Z4P A;  5T0M A;  3VV0 A;  1N6C A;  3S7D A;  4JLG A;  1MVH A;  3FPD A;  5AYF A;  3MO0 A;  4NVQ A;  4H12 A;  5JIN A;  3QWV A;  4QEP A;  3F9Z A;  3CBO A;  3IHX A;  4QEO A;  4AU7 A;  1MUF A;  5EG2 A;  2G46 A;  3F9Y A;  5HI7 A;  5TEG A;  3KMJ A;  1N3J A;  3CBM A;  3M59 A;  3RAY A;  4J7F A;  4J8O A;  3S8P A;  3M5A A;  5F5E A;  3RU0 A;  5T0K A;  3S7F A;  3N71 A;  3S7J A;  5ARG A;  4IJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...