4QENA

Crystal structure of kryptonite in complex with mchh dna and sah
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
526
structure length
472
Chain Sequence
LEPHLKVTKCLRLFNKQYLLCVQAKLSRPDLKGVTEMIKAKAILYPRKIIGDLPGIDVGHRFFSRAEMCAVGFHNHWLNGIDYMSMEYEKEYSNYKLPLAVSIVMSGQYEDDLDNADTVTYTGQGGHNLTGNKRQIKDQLLERGNLALKHCCEYNVPVRVTRGHNCKSSYTKRVYTYDGLYKVEKFWAQKGVSGFTVYKYRLKRLEGQPELTTDIEGLVCEDISGGLEFKGIPATNRVDDSPVSPTSGFTYIKSLIIEPNVIIPKSSTGCNCRGSCTDSKKCACAKLNGGNFPYVDLNDGRLIESRDVVFECGPHCGCGPKCVNRTSQKRLRFNLEVFRSAKKGWAVRSWEYIPAGSPVCEYIGVVRRTADVNEYIFEIDCPEFCIDAGSTGNFARFINHSCEPNLFVQCVLSSHQDIRLARVVLFAADNISPMQELTYDYGYALDSVHGPDGKVKQLACYCGALNCRKRLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of DNA Methylation-Directed Histone Methylation by KRYPTONITE.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription/dna
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific SUV
total genus 135
structure length 472
sequence length 526
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2014-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF02182 SAD_SRA SAD/SRA domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4qenA03
4NJ5A 4IJ8A 1MVHA 1XQHA 3SWCA 2BQZA 3M57A 5T0KA 2W5YA 4J7IA 4BUPA 4YNMA 4QENA 2R3AA 5F6LA 1O9SA 3RAYA 3S7BA 3RIBA 5KJMA 3OXLA 5EG2A 2G46A 3M54A 3CBPA 3MO5A 1N3JA 4O6FA 5EX3A 4IJDA 5AYFA 5JJ0A 3M53A 4J83A 4AU7A 5KJKA 3OPEA 1MVXA 3OXGA 5T5GA 4MI0A 3QWVA 5F5EA 4C1QA 2O8JA 3EP0A 3FPDA 3S8PA 3S7JA 2RFIA 4J7FA 4J8OA 4YPAA 5F59A 4I51A 4QEPA 3N71A 3M5AA 3M56A 5CPRB 1PEGA 5JHNA 4YNDA 3F9WA 5T0MA 5HI7A 1N6AA 5LSZA 4JLGA 3K5KA 3DALA 3OOIA 3SW9A 3MO2A 5JIYA 3BO5A 4RZ0A 3HNAA 3QWWA 5ARGA 3MEKA 3TG4A 1N6CA 3F9XA 3MO0A 5CCMA 3M55A 3KMAA 3OXFA 4H12A 3OS5A 3IHXA 5KJNA 2QPWA 2IGQA 1ZKKA 1H3IA 5JINA 4YNPA 3M59A 3RJWA 4FMUA 4WUYA 4O30A 3RQ4A 1ML9A 3F9YA 3TG5A 3F9ZA 2JV0A 4NVQA 5TEGA 5TTFA 4QEOA 3DB5A 3QWPA 3VV0A 5ARFA 3RU0A 1MUFA 4Z4PA 5EX0A 3CBMA 3PDNA 2F69A 5TH7A 4MI5A 3S7DA 2W5ZA 5LSXA 4YPUA 5F6KC 5KJLA 5HQ8A 3KMTA 5CCLA 3M58A 1MT6A 3VUZA 4YPEA 3CBOA 4LDGA 3S7FA 3KMJA 4E47A 4JDSA
chains in the Genus database with same CATH superfamily
4NJ5A 4IJ8A 1MVHA 1XQHA 3SWCA 2BQZA 3M57A 5T0KA 2W5YA 4J7IA 4BUPA 4YNMA 4QENA 2R3AA 5F6LA 1O9SA 3RAYA 3S7BA 3RIBA 5KJMA 3OXLA 5EG2A 2G46A 3M54A 3CBPA 3MO5A 1N3JA 4O6FA 5EX3A 4IJDA 5AYFA 5JJ0A 3M53A 4J83A 4AU7A 5KJKA 3OPEA 1MVXA 3OXGA 5T5GA 4MI0A 3QWVA 5F5EA 4C1QA 2O8JA 3EP0A 3FPDA 3S8PA 3S7JA 2RFIA 4J7FA 4J8OA 4YPAA 5F59A 4I51A 4QEPA 3N71A 3M5AA 3M56A 5CPRB 1PEGA 5JHNA 4YNDA 3F9WA 5T0MA 5HI7A 1N6AA 5LSZA 4JLGA 3K5KA 3DALA 3OOIA 3SW9A 3MO2A 5JIYA 3BO5A 4RZ0A 3HNAA 3QWWA 5ARGA 3MEKA 3TG4A 1N6CA 3F9XA 3MO0A 5CCMA 3M55A 3KMAA 3OXFA 4H12A 3OS5A 3IHXA 5KJNA 2QPWA 2IGQA 1ZKKA 1H3IA 5JINA 4YNPA 3M59A 3RJWA 4FMUA 4WUYA 4O30A 3RQ4A 1ML9A 3F9YA 3TG5A 3F9ZA 2JV0A 4NVQA 5TEGA 5TTFA 4QEOA 3DB5A 3QWPA 3VV0A 5ARFA 3RU0A 1MUFA 4Z4PA 5EX0A 3CBMA 3PDNA 2F69A 5TH7A 4MI5A 3S7DA 2W5ZA 5LSXA 4YPUA 5F6KC 5KJLA 5HQ8A 3KMTA 5CCLA 3M58A 1MT6A 3VUZA 4YPEA 3CBOA 4LDGA 3S7FA 3KMJA 4E47A 4JDSA
chains in the Genus database with same CATH topology
4NJ5A 4IJ8A 1MVHA 1XQHA 3SWCA 2BQZA 3M57A 5T0KA 2W5YA 4J7IA 4BUPA 4YNMA 4QENA 2R3AA 5F6LA 1O9SA 3RAYA 3S7BA 3RIBA 5KJMA 3OXLA 5EG2A 2G46A 3M54A 3CBPA 3MO5A 1N3JA 4O6FA 5EX3A 4IJDA 5AYFA 5JJ0A 3M53A 4J83A 4AU7A 5KJKA 3OPEA 1MVXA 3OXGA 5T5GA 4MI0A 3QWVA 5F5EA 4C1QA 2O8JA 3EP0A 3FPDA 3S8PA 3S7JA 2RFIA 4J7FA 4J8OA 4YPAA 5F59A 4I51A 4QEPA 3N71A 3M5AA 3M56A 5CPRB 1PEGA 5JHNA 4YNDA 3F9WA 5T0MA 5HI7A 1N6AA 5LSZA 4JLGA 3K5KA 3DALA 3OOIA 3SW9A 3MO2A 5JIYA 3BO5A 4RZ0A 3HNAA 3QWWA 5ARGA 3MEKA 3TG4A 1N6CA 3F9XA 3MO0A 5CCMA 3M55A 3KMAA 3OXFA 4H12A 3OS5A 3IHXA 5KJNA 2QPWA 2IGQA 1ZKKA 1H3IA 5JINA 4YNPA 3M59A 3RJWA 4FMUA 4WUYA 4O30A 3RQ4A 1ML9A 3F9YA 3TG5A 3F9ZA 2JV0A 4NVQA 5TEGA 5TTFA 4QEOA 3DB5A 3QWPA 3VV0A 5ARFA 3RU0A 1MUFA 4Z4PA 5EX0A 3CBMA 3PDNA 2F69A 5TH7A 4MI5A 3S7DA 2W5ZA 5LSXA 4YPUA 5F6KC 5KJLA 5HQ8A 3KMTA 5CCLA 3M58A 1MT6A 3VUZA 4YPEA 3CBOA 4LDGA 3S7FA 3KMJA 4E47A 4JDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NJ5 A;  4IJ8 A;  1MVH A;  1XQH A;  3SWC A;  2BQZ A;  3M57 A;  5T0K A;  2W5Y A;  4J7I A;  4BUP A;  4YNM A;  4QEN A;  2R3A A;  5F6L A;  1O9S A;  3RAY A;  3S7B A;  3RIB A;  5KJM A;  3OXL A;  5EG2 A;  2G46 A;  3M54 A;  3CBP A;  3MO5 A;  1N3J A;  4O6F A;  5EX3 A;  4IJD A;  5AYF A;  5JJ0 A;  3M53 A;  4J83 A;  4AU7 A;  5KJK A;  3OPE A;  1MVX A;  3OXG A;  5T5G A;  4MI0 A;  3QWV A;  5F5E A;  4C1Q A;  2O8J A;  3EP0 A;  3FPD A;  3S8P A;  3S7J A;  2RFI A;  4J7F A;  4J8O A;  4YPA A;  5F59 A;  4I51 A;  4QEP A;  3N71 A;  3M5A A;  3M56 A;  5CPR B;  1PEG A;  5JHN A;  4YND A;  3F9W A;  5T0M A;  5HI7 A;  1N6A A;  5LSZ A;  4JLG A;  3K5K A;  3DAL A;  3OOI A;  3SW9 A;  3MO2 A;  5JIY A;  3BO5 A;  4RZ0 A;  3HNA A;  3QWW A;  5ARG A;  3MEK A;  3TG4 A;  1N6C A;  3F9X A;  3MO0 A;  5CCM A;  3M55 A;  3KMA A;  3OXF A;  4H12 A;  3OS5 A;  3IHX A;  5KJN A;  2QPW A;  2IGQ A;  1ZKK A;  1H3I A;  5JIN A;  4YNP A;  3M59 A;  3RJW A;  4FMU A;  4WUY A;  4O30 A;  3RQ4 A;  1ML9 A;  3F9Y A;  3TG5 A;  3F9Z A;  2JV0 A;  4NVQ A;  5TEG A;  5TTF A;  4QEO A;  3DB5 A;  3QWP A;  3VV0 A;  5ARF A;  3RU0 A;  1MUF A;  4Z4P A;  5EX0 A;  3CBM A;  3PDN A;  2F69 A;  5TH7 A;  4MI5 A;  3S7D A;  2W5Z A;  5LSX A;  4YPU A;  5F6K C;  5KJL A;  5HQ8 A;  3KMT A;  5CCL A;  3M58 A;  1MT6 A;  3VUZ A;  4YPE A;  3CBO A;  4LDG A;  3S7F A;  3KMJ A;  4E47 A;  4JDS A; 
#chains in the Genus database with same CATH topology
 4NJ5 A;  4IJ8 A;  1MVH A;  1XQH A;  3SWC A;  2BQZ A;  3M57 A;  5T0K A;  2W5Y A;  4J7I A;  4BUP A;  4YNM A;  4QEN A;  2R3A A;  5F6L A;  1O9S A;  3RAY A;  3S7B A;  3RIB A;  5KJM A;  3OXL A;  5EG2 A;  2G46 A;  3M54 A;  3CBP A;  3MO5 A;  1N3J A;  4O6F A;  5EX3 A;  4IJD A;  5AYF A;  5JJ0 A;  3M53 A;  4J83 A;  4AU7 A;  5KJK A;  3OPE A;  1MVX A;  3OXG A;  5T5G A;  4MI0 A;  3QWV A;  5F5E A;  4C1Q A;  2O8J A;  3EP0 A;  3FPD A;  3S8P A;  3S7J A;  2RFI A;  4J7F A;  4J8O A;  4YPA A;  5F59 A;  4I51 A;  4QEP A;  3N71 A;  3M5A A;  3M56 A;  5CPR B;  1PEG A;  5JHN A;  4YND A;  3F9W A;  5T0M A;  5HI7 A;  1N6A A;  5LSZ A;  4JLG A;  3K5K A;  3DAL A;  3OOI A;  3SW9 A;  3MO2 A;  5JIY A;  3BO5 A;  4RZ0 A;  3HNA A;  3QWW A;  5ARG A;  3MEK A;  3TG4 A;  1N6C A;  3F9X A;  3MO0 A;  5CCM A;  3M55 A;  3KMA A;  3OXF A;  4H12 A;  3OS5 A;  3IHX A;  5KJN A;  2QPW A;  2IGQ A;  1ZKK A;  1H3I A;  5JIN A;  4YNP A;  3M59 A;  3RJW A;  4FMU A;  4WUY A;  4O30 A;  3RQ4 A;  1ML9 A;  3F9Y A;  3TG5 A;  3F9Z A;  2JV0 A;  4NVQ A;  5TEG A;  5TTF A;  4QEO A;  3DB5 A;  3QWP A;  3VV0 A;  5ARF A;  3RU0 A;  1MUF A;  4Z4P A;  5EX0 A;  3CBM A;  3PDN A;  2F69 A;  5TH7 A;  4MI5 A;  3S7D A;  2W5Z A;  5LSX A;  4YPU A;  5F6K C;  5KJL A;  5HQ8 A;  3KMT A;  5CCL A;  3M58 A;  1MT6 A;  3VUZ A;  4YPE A;  3CBO A;  4LDG A;  3S7F A;  3KMJ A;  4E47 A;  4JDS A; 
#chains in the Genus database with same CATH homology
 4NJ5 A;  4IJ8 A;  1MVH A;  1XQH A;  3SWC A;  2BQZ A;  3M57 A;  5T0K A;  2W5Y A;  4J7I A;  4BUP A;  4YNM A;  4QEN A;  2R3A A;  5F6L A;  1O9S A;  3RAY A;  3S7B A;  3RIB A;  5KJM A;  3OXL A;  5EG2 A;  2G46 A;  3M54 A;  3CBP A;  3MO5 A;  1N3J A;  4O6F A;  5EX3 A;  4IJD A;  5AYF A;  5JJ0 A;  3M53 A;  4J83 A;  4AU7 A;  5KJK A;  3OPE A;  1MVX A;  3OXG A;  5T5G A;  4MI0 A;  3QWV A;  5F5E A;  4C1Q A;  2O8J A;  3EP0 A;  3FPD A;  3S8P A;  3S7J A;  2RFI A;  4J7F A;  4J8O A;  4YPA A;  5F59 A;  4I51 A;  4QEP A;  3N71 A;  3M5A A;  3M56 A;  5CPR B;  1PEG A;  5JHN A;  4YND A;  3F9W A;  5T0M A;  5HI7 A;  1N6A A;  5LSZ A;  4JLG A;  3K5K A;  3DAL A;  3OOI A;  3SW9 A;  3MO2 A;  5JIY A;  3BO5 A;  4RZ0 A;  3HNA A;  3QWW A;  5ARG A;  3MEK A;  3TG4 A;  1N6C A;  3F9X A;  3MO0 A;  5CCM A;  3M55 A;  3KMA A;  3OXF A;  4H12 A;  3OS5 A;  3IHX A;  5KJN A;  2QPW A;  2IGQ A;  1ZKK A;  1H3I A;  5JIN A;  4YNP A;  3M59 A;  3RJW A;  4FMU A;  4WUY A;  4O30 A;  3RQ4 A;  1ML9 A;  3F9Y A;  3TG5 A;  3F9Z A;  2JV0 A;  4NVQ A;  5TEG A;  5TTF A;  4QEO A;  3DB5 A;  3QWP A;  3VV0 A;  5ARF A;  3RU0 A;  1MUF A;  4Z4P A;  5EX0 A;  3CBM A;  3PDN A;  2F69 A;  5TH7 A;  4MI5 A;  3S7D A;  2W5Z A;  5LSX A;  4YPU A;  5F6K C;  5KJL A;  5HQ8 A;  3KMT A;  5CCL A;  3M58 A;  1MT6 A;  3VUZ A;  4YPE A;  3CBO A;  4LDG A;  3S7F A;  3KMJ A;  4E47 A;  4JDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...