4QENA

Crystal structure of kryptonite in complex with mchh dna and sah
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
526
structure length
472
Chain Sequence
LEPHLKVTKCLRLFNKQYLLCVQAKLSRPDLKGVTEMIKAKAILYPRKIIGDLPGIDVGHRFFSRAEMCAVGFHNHWLNGIDYMSMEYEKEYSNYKLPLAVSIVMSGQYEDDLDNADTVTYTGQGGHNLTGNKRQIKDQLLERGNLALKHCCEYNVPVRVTRGHNCKSSYTKRVYTYDGLYKVEKFWAQKGVSGFTVYKYRLKRLEGQPELTTDIEGLVCEDISGGLEFKGIPATNRVDDSPVSPTSGFTYIKSLIIEPNVIIPKSSTGCNCRGSCTDSKKCACAKLNGGNFPYVDLNDGRLIESRDVVFECGPHCGCGPKCVNRTSQKRLRFNLEVFRSAKKGWAVRSWEYIPAGSPVCEYIGVVRRTADVNEYIFEIDCPEFCIDAGSTGNFARFINHSCEPNLFVQCVLSSHQDIRLARVVLFAADNISPMQELTYDYGYALDSVHGPDGKVKQLACYCGALNCRKRLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific SUV
publication title Mechanism of DNA Methylation-Directed Histone Methylation by KRYPTONITE.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 135
structure length 472
sequence length 526
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2014-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF02182 SAD_SRA SAD/SRA domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4qenA03
4WUYA 3MO5A 2G46A 3CBPA 3OPEA 4YNPA 5TEGA 5JINA 3N71A 3RAYA 3QWWA 4O6FA 4RZ0A 5LSZA 3M54A 2O8JA 4YPUA 4I51A 4H12A 4O30A 4J7FA 1MUFA 2R3AA 3CBOA 5F6KC 5TH7A 3OXGA 1ZKKA 5HQ8A 4IJ8A 3SW9A 3KMJA 3M53A 4YNDA 3EP0A 3OXFA 4J8OA 3SWCA 3RQ4A 5TTFA 3M58A 3OOIA 4NVQA 5HI7A 3VUZA 3F9XA 5JHNA 3S7DA 3KMAA 3M5AA 5CCMA 3DALA 4Z4PA 4J83A 5JIYA 4YNMA 5LSXA 3VV0A 3S8PA 2JV0A 3OS5A 5KJLA 4LDGA 2F69A 4MI0A 4AU7A 3S7BA 3RIBA 4QEPA 5F5EA 1O9SA 2QPWA 5KJKA 3RJWA 2BQZA 5T0KA 3K5KA 2IGQA 3M55A 4IJDA 3KMTA 5KJNA 3S7FA 4QENA 1N6CA 3QWPA 3F9ZA 4FMUA 1N6AA 4MI5A 4JDSA 1MT6A 3M57A 3PDNA 4BUPA 3BO5A 3MO2A 5AYFA 5ARGA 5T5GA 3RU0A 3S7JA 1MVHA 3OXLA 2W5ZA 5KJMA 3HNAA 1MVXA 4NJ5A 5ARFA 5EX3A 3MEKA 4QEOA 1N3JA 4J7IA 3F9WA 3DB5A 5CPRB 5EG2A 1XQHA 3MO0A 2W5YA 3TG5A 3QWVA 4YPAA 4JLGA 5JJ0A 5F6LA 3F9YA 3M56A 4YPEA 3FPDA 4C1QA 3CBMA 5EX0A 4E47A 3M59A 1H3IA 5CCLA 3TG4A 1ML9A 1PEGA 3IHXA 5F59A 2RFIA 5T0MA
chains in the Genus database with same CATH superfamily
4WUYA 3MO5A 2G46A 3CBPA 3OPEA 4YNPA 5TEGA 5JINA 3N71A 3RAYA 3QWWA 4O6FA 4RZ0A 5LSZA 3M54A 2O8JA 4YPUA 4I51A 4H12A 4O30A 4J7FA 1MUFA 2R3AA 3CBOA 5F6KC 5TH7A 3OXGA 1ZKKA 5HQ8A 4IJ8A 3SW9A 3KMJA 3M53A 4YNDA 3EP0A 3OXFA 4J8OA 3SWCA 3RQ4A 5TTFA 3M58A 3OOIA 4NVQA 5HI7A 3VUZA 3F9XA 5JHNA 3S7DA 3KMAA 3M5AA 5CCMA 3DALA 4Z4PA 4J83A 5JIYA 4YNMA 5LSXA 3VV0A 3S8PA 2JV0A 3OS5A 5KJLA 4LDGA 2F69A 4MI0A 4AU7A 3S7BA 3RIBA 4QEPA 5F5EA 1O9SA 2QPWA 5KJKA 3RJWA 2BQZA 5T0KA 3K5KA 2IGQA 3M55A 4IJDA 3KMTA 5KJNA 3S7FA 4QENA 1N6CA 3QWPA 3F9ZA 4FMUA 1N6AA 4MI5A 4JDSA 1MT6A 3M57A 3PDNA 4BUPA 3BO5A 3MO2A 5AYFA 5ARGA 5T5GA 3RU0A 3S7JA 1MVHA 3OXLA 2W5ZA 5KJMA 3HNAA 1MVXA 4NJ5A 5ARFA 5EX3A 3MEKA 4QEOA 1N3JA 4J7IA 3F9WA 3DB5A 5CPRB 5EG2A 1XQHA 3MO0A 2W5YA 3TG5A 3QWVA 4YPAA 4JLGA 5JJ0A 5F6LA 3F9YA 3M56A 4YPEA 3FPDA 4C1QA 3CBMA 5EX0A 4E47A 3M59A 1H3IA 5CCLA 3TG4A 1ML9A 1PEGA 3IHXA 5F59A 2RFIA 5T0MA
chains in the Genus database with same CATH topology
4WUYA 3MO5A 2G46A 3CBPA 3OPEA 4YNPA 5TEGA 5JINA 3N71A 3RAYA 3QWWA 4O6FA 4RZ0A 5LSZA 3M54A 2O8JA 4YPUA 4I51A 4H12A 4O30A 4J7FA 1MUFA 2R3AA 3CBOA 5F6KC 5TH7A 3OXGA 1ZKKA 5HQ8A 4IJ8A 3SW9A 3KMJA 3M53A 4YNDA 3EP0A 3OXFA 4J8OA 3SWCA 3RQ4A 5TTFA 3M58A 3OOIA 4NVQA 5HI7A 3VUZA 3F9XA 5JHNA 3S7DA 3KMAA 3M5AA 5CCMA 3DALA 4Z4PA 4J83A 5JIYA 4YNMA 5LSXA 3VV0A 3S8PA 2JV0A 3OS5A 5KJLA 4LDGA 2F69A 4MI0A 4AU7A 3S7BA 3RIBA 4QEPA 5F5EA 1O9SA 2QPWA 5KJKA 3RJWA 2BQZA 5T0KA 3K5KA 2IGQA 3M55A 4IJDA 3KMTA 5KJNA 3S7FA 4QENA 1N6CA 3QWPA 3F9ZA 4FMUA 1N6AA 4MI5A 4JDSA 1MT6A 3M57A 3PDNA 4BUPA 3BO5A 3MO2A 5AYFA 5ARGA 5T5GA 3RU0A 3S7JA 1MVHA 3OXLA 2W5ZA 5KJMA 3HNAA 1MVXA 4NJ5A 5ARFA 5EX3A 3MEKA 4QEOA 1N3JA 4J7IA 3F9WA 3DB5A 5CPRB 5EG2A 1XQHA 3MO0A 2W5YA 3TG5A 3QWVA 4YPAA 4JLGA 5JJ0A 5F6LA 3F9YA 3M56A 4YPEA 3FPDA 4C1QA 3CBMA 5EX0A 4E47A 3M59A 1H3IA 5CCLA 3TG4A 1ML9A 1PEGA 3IHXA 5F59A 2RFIA 5T0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WUY A;  3MO5 A;  2G46 A;  3CBP A;  3OPE A;  4YNP A;  5TEG A;  5JIN A;  3N71 A;  3RAY A;  3QWW A;  4O6F A;  4RZ0 A;  5LSZ A;  3M54 A;  2O8J A;  4YPU A;  4I51 A;  4H12 A;  4O30 A;  4J7F A;  1MUF A;  2R3A A;  3CBO A;  5F6K C;  5TH7 A;  3OXG A;  1ZKK A;  5HQ8 A;  4IJ8 A;  3SW9 A;  3KMJ A;  3M53 A;  4YND A;  3EP0 A;  3OXF A;  4J8O A;  3SWC A;  3RQ4 A;  5TTF A;  3M58 A;  3OOI A;  4NVQ A;  5HI7 A;  3VUZ A;  3F9X A;  5JHN A;  3S7D A;  3KMA A;  3M5A A;  5CCM A;  3DAL A;  4Z4P A;  4J83 A;  5JIY A;  4YNM A;  5LSX A;  3VV0 A;  3S8P A;  2JV0 A;  3OS5 A;  5KJL A;  4LDG A;  2F69 A;  4MI0 A;  4AU7 A;  3S7B A;  3RIB A;  4QEP A;  5F5E A;  1O9S A;  2QPW A;  5KJK A;  3RJW A;  2BQZ A;  5T0K A;  3K5K A;  2IGQ A;  3M55 A;  4IJD A;  3KMT A;  5KJN A;  3S7F A;  4QEN A;  1N6C A;  3QWP A;  3F9Z A;  4FMU A;  1N6A A;  4MI5 A;  4JDS A;  1MT6 A;  3M57 A;  3PDN A;  4BUP A;  3BO5 A;  3MO2 A;  5AYF A;  5ARG A;  5T5G A;  3RU0 A;  3S7J A;  1MVH A;  3OXL A;  2W5Z A;  5KJM A;  3HNA A;  1MVX A;  4NJ5 A;  5ARF A;  5EX3 A;  3MEK A;  4QEO A;  1N3J A;  4J7I A;  3F9W A;  3DB5 A;  5CPR B;  5EG2 A;  1XQH A;  3MO0 A;  2W5Y A;  3TG5 A;  3QWV A;  4YPA A;  4JLG A;  5JJ0 A;  5F6L A;  3F9Y A;  3M56 A;  4YPE A;  3FPD A;  4C1Q A;  3CBM A;  5EX0 A;  4E47 A;  3M59 A;  1H3I A;  5CCL A;  3TG4 A;  1ML9 A;  1PEG A;  3IHX A;  5F59 A;  2RFI A;  5T0M A; 
#chains in the Genus database with same CATH topology
 4WUY A;  3MO5 A;  2G46 A;  3CBP A;  3OPE A;  4YNP A;  5TEG A;  5JIN A;  3N71 A;  3RAY A;  3QWW A;  4O6F A;  4RZ0 A;  5LSZ A;  3M54 A;  2O8J A;  4YPU A;  4I51 A;  4H12 A;  4O30 A;  4J7F A;  1MUF A;  2R3A A;  3CBO A;  5F6K C;  5TH7 A;  3OXG A;  1ZKK A;  5HQ8 A;  4IJ8 A;  3SW9 A;  3KMJ A;  3M53 A;  4YND A;  3EP0 A;  3OXF A;  4J8O A;  3SWC A;  3RQ4 A;  5TTF A;  3M58 A;  3OOI A;  4NVQ A;  5HI7 A;  3VUZ A;  3F9X A;  5JHN A;  3S7D A;  3KMA A;  3M5A A;  5CCM A;  3DAL A;  4Z4P A;  4J83 A;  5JIY A;  4YNM A;  5LSX A;  3VV0 A;  3S8P A;  2JV0 A;  3OS5 A;  5KJL A;  4LDG A;  2F69 A;  4MI0 A;  4AU7 A;  3S7B A;  3RIB A;  4QEP A;  5F5E A;  1O9S A;  2QPW A;  5KJK A;  3RJW A;  2BQZ A;  5T0K A;  3K5K A;  2IGQ A;  3M55 A;  4IJD A;  3KMT A;  5KJN A;  3S7F A;  4QEN A;  1N6C A;  3QWP A;  3F9Z A;  4FMU A;  1N6A A;  4MI5 A;  4JDS A;  1MT6 A;  3M57 A;  3PDN A;  4BUP A;  3BO5 A;  3MO2 A;  5AYF A;  5ARG A;  5T5G A;  3RU0 A;  3S7J A;  1MVH A;  3OXL A;  2W5Z A;  5KJM A;  3HNA A;  1MVX A;  4NJ5 A;  5ARF A;  5EX3 A;  3MEK A;  4QEO A;  1N3J A;  4J7I A;  3F9W A;  3DB5 A;  5CPR B;  5EG2 A;  1XQH A;  3MO0 A;  2W5Y A;  3TG5 A;  3QWV A;  4YPA A;  4JLG A;  5JJ0 A;  5F6L A;  3F9Y A;  3M56 A;  4YPE A;  3FPD A;  4C1Q A;  3CBM A;  5EX0 A;  4E47 A;  3M59 A;  1H3I A;  5CCL A;  3TG4 A;  1ML9 A;  1PEG A;  3IHX A;  5F59 A;  2RFI A;  5T0M A; 
#chains in the Genus database with same CATH homology
 4WUY A;  3MO5 A;  2G46 A;  3CBP A;  3OPE A;  4YNP A;  5TEG A;  5JIN A;  3N71 A;  3RAY A;  3QWW A;  4O6F A;  4RZ0 A;  5LSZ A;  3M54 A;  2O8J A;  4YPU A;  4I51 A;  4H12 A;  4O30 A;  4J7F A;  1MUF A;  2R3A A;  3CBO A;  5F6K C;  5TH7 A;  3OXG A;  1ZKK A;  5HQ8 A;  4IJ8 A;  3SW9 A;  3KMJ A;  3M53 A;  4YND A;  3EP0 A;  3OXF A;  4J8O A;  3SWC A;  3RQ4 A;  5TTF A;  3M58 A;  3OOI A;  4NVQ A;  5HI7 A;  3VUZ A;  3F9X A;  5JHN A;  3S7D A;  3KMA A;  3M5A A;  5CCM A;  3DAL A;  4Z4P A;  4J83 A;  5JIY A;  4YNM A;  5LSX A;  3VV0 A;  3S8P A;  2JV0 A;  3OS5 A;  5KJL A;  4LDG A;  2F69 A;  4MI0 A;  4AU7 A;  3S7B A;  3RIB A;  4QEP A;  5F5E A;  1O9S A;  2QPW A;  5KJK A;  3RJW A;  2BQZ A;  5T0K A;  3K5K A;  2IGQ A;  3M55 A;  4IJD A;  3KMT A;  5KJN A;  3S7F A;  4QEN A;  1N6C A;  3QWP A;  3F9Z A;  4FMU A;  1N6A A;  4MI5 A;  4JDS A;  1MT6 A;  3M57 A;  3PDN A;  4BUP A;  3BO5 A;  3MO2 A;  5AYF A;  5ARG A;  5T5G A;  3RU0 A;  3S7J A;  1MVH A;  3OXL A;  2W5Z A;  5KJM A;  3HNA A;  1MVX A;  4NJ5 A;  5ARF A;  5EX3 A;  3MEK A;  4QEO A;  1N3J A;  4J7I A;  3F9W A;  3DB5 A;  5CPR B;  5EG2 A;  1XQH A;  3MO0 A;  2W5Y A;  3TG5 A;  3QWV A;  4YPA A;  4JLG A;  5JJ0 A;  5F6L A;  3F9Y A;  3M56 A;  4YPE A;  3FPD A;  4C1Q A;  3CBM A;  5EX0 A;  4E47 A;  3M59 A;  1H3I A;  5CCL A;  3TG4 A;  1ML9 A;  1PEG A;  3IHX A;  5F59 A;  2RFI A;  5T0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...