4QENA

Crystal structure of kryptonite in complex with mchh dna and sah
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
526
structure length
472
Chain Sequence
LEPHLKVTKCLRLFNKQYLLCVQAKLSRPDLKGVTEMIKAKAILYPRKIIGDLPGIDVGHRFFSRAEMCAVGFHNHWLNGIDYMSMEYEKEYSNYKLPLAVSIVMSGQYEDDLDNADTVTYTGQGGHNLTGNKRQIKDQLLERGNLALKHCCEYNVPVRVTRGHNCKSSYTKRVYTYDGLYKVEKFWAQKGVSGFTVYKYRLKRLEGQPELTTDIEGLVCEDISGGLEFKGIPATNRVDDSPVSPTSGFTYIKSLIIEPNVIIPKSSTGCNCRGSCTDSKKCACAKLNGGNFPYVDLNDGRLIESRDVVFECGPHCGCGPKCVNRTSQKRLRFNLEVFRSAKKGWAVRSWEYIPAGSPVCEYIGVVRRTADVNEYIFEIDCPEFCIDAGSTGNFARFINHSCEPNLFVQCVLSSHQDIRLARVVLFAADNISPMQELTYDYGYALDSVHGPDGKVKQLACYCGALNCRKRLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of DNA Methylation-Directed Histone Methylation by KRYPTONITE.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription/dna
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific SUV
total genus 135
structure length 472
sequence length 526
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2014-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF02182 SAD_SRA SAD/SRA domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4qenA03
3FPDA 3M53A 3RJWA 3OS5A 3RU0A 3S7DA 3CBPA 4NVQA 3M58A 2F69A 3OXGA 4QENA 1H3IA 3QWVA 2RFIA 2BQZA 4Z4PA 1O9SA 4YNDA 3TG4A 3M54A 4MI0A 3QWWA 3MEKA 3F9XA 1MVXA 5TEGA 3CBOA 3OPEA 4BUPA 5T0KA 1N6AA 5F6KC 5JINA 3M57A 3VV0A 4YNPA 5ARGA 2W5ZA 1MVHA 5EX0A 4YPAA 3TG5A 4YPEA 3KMJA 5F59A 3RAYA 2JV0A 1XQHA 3M55A 4WUYA 3OOIA 3F9WA 2W5YA 1PEGA 3QWPA 4J8OA 4YPUA 4MI5A 4QEPA 5CCMA 3HNAA 5AYFA 5TH7A 5CCLA 1ZKKA 3K5KA 5T0MA 5EG2A 5ARFA 5LSZA 3OXFA 4C1QA 2IGQA 3RIBA 3F9ZA 5JJ0A 2R3AA 5HI7A 5HQ8A 1MUFA 5KJNA 5CPRB 3RQ4A 3N71A 4LDGA 3OXLA 4I51A 5T5GA 5TTFA 4O6FA 5KJKA 3BO5A 3SW9A 5JHNA 4IJ8A 4H12A 5LSXA 3M59A 3VUZA 3KMTA 3PDNA 4J83A 4J7FA 4E47A 3SWCA 5JIYA 3S7FA 4NJ5A 1ML9A 5F5EA 3MO2A 4AU7A 3MO5A 4RZ0A 5KJMA 5EX3A 3EP0A 4QEOA 4JLGA 4O30A 3F9YA 3DB5A 3DALA 2G46A 3S7JA 4JDSA 1MT6A 3KMAA 3M56A 3MO0A 4IJDA 3IHXA 3CBMA 4YNMA 1N6CA 2O8JA 5F6LA 1N3JA 4FMUA 4J7IA 3S7BA 5KJLA 3M5AA 3S8PA 2QPWA
chains in the Genus database with same CATH superfamily
3FPDA 3M53A 3RJWA 3OS5A 3RU0A 3S7DA 3CBPA 4NVQA 3M58A 2F69A 3OXGA 4QENA 1H3IA 3QWVA 2RFIA 2BQZA 4Z4PA 1O9SA 4YNDA 3TG4A 3M54A 4MI0A 3QWWA 3MEKA 3F9XA 1MVXA 5TEGA 3CBOA 3OPEA 4BUPA 5T0KA 1N6AA 5F6KC 5JINA 3M57A 3VV0A 4YNPA 5ARGA 2W5ZA 1MVHA 5EX0A 4YPAA 3TG5A 4YPEA 3KMJA 5F59A 3RAYA 2JV0A 1XQHA 3M55A 4WUYA 3OOIA 3F9WA 2W5YA 1PEGA 3QWPA 4J8OA 4YPUA 4MI5A 4QEPA 5CCMA 3HNAA 5AYFA 5TH7A 5CCLA 1ZKKA 3K5KA 5T0MA 5EG2A 5ARFA 5LSZA 3OXFA 4C1QA 2IGQA 3RIBA 3F9ZA 5JJ0A 2R3AA 5HI7A 5HQ8A 1MUFA 5KJNA 5CPRB 3RQ4A 3N71A 4LDGA 3OXLA 4I51A 5T5GA 5TTFA 4O6FA 5KJKA 3BO5A 3SW9A 5JHNA 4IJ8A 4H12A 5LSXA 3M59A 3VUZA 3KMTA 3PDNA 4J83A 4J7FA 4E47A 3SWCA 5JIYA 3S7FA 4NJ5A 1ML9A 5F5EA 3MO2A 4AU7A 3MO5A 4RZ0A 5KJMA 5EX3A 3EP0A 4QEOA 4JLGA 4O30A 3F9YA 3DB5A 3DALA 2G46A 3S7JA 4JDSA 1MT6A 3KMAA 3M56A 3MO0A 4IJDA 3IHXA 3CBMA 4YNMA 1N6CA 2O8JA 5F6LA 1N3JA 4FMUA 4J7IA 3S7BA 5KJLA 3M5AA 3S8PA 2QPWA
chains in the Genus database with same CATH topology
3FPDA 3M53A 3RJWA 3OS5A 3RU0A 3S7DA 3CBPA 4NVQA 3M58A 2F69A 3OXGA 4QENA 1H3IA 3QWVA 2RFIA 2BQZA 4Z4PA 1O9SA 4YNDA 3TG4A 3M54A 4MI0A 3QWWA 3MEKA 3F9XA 1MVXA 5TEGA 3CBOA 3OPEA 4BUPA 5T0KA 1N6AA 5F6KC 5JINA 3M57A 3VV0A 4YNPA 5ARGA 2W5ZA 1MVHA 5EX0A 4YPAA 3TG5A 4YPEA 3KMJA 5F59A 3RAYA 2JV0A 1XQHA 3M55A 4WUYA 3OOIA 3F9WA 2W5YA 1PEGA 3QWPA 4J8OA 4YPUA 4MI5A 4QEPA 5CCMA 3HNAA 5AYFA 5TH7A 5CCLA 1ZKKA 3K5KA 5T0MA 5EG2A 5ARFA 5LSZA 3OXFA 4C1QA 2IGQA 3RIBA 3F9ZA 5JJ0A 2R3AA 5HI7A 5HQ8A 1MUFA 5KJNA 5CPRB 3RQ4A 3N71A 4LDGA 3OXLA 4I51A 5T5GA 5TTFA 4O6FA 5KJKA 3BO5A 3SW9A 5JHNA 4IJ8A 4H12A 5LSXA 3M59A 3VUZA 3KMTA 3PDNA 4J83A 4J7FA 4E47A 3SWCA 5JIYA 3S7FA 4NJ5A 1ML9A 5F5EA 3MO2A 4AU7A 3MO5A 4RZ0A 5KJMA 5EX3A 3EP0A 4QEOA 4JLGA 4O30A 3F9YA 3DB5A 3DALA 2G46A 3S7JA 4JDSA 1MT6A 3KMAA 3M56A 3MO0A 4IJDA 3IHXA 3CBMA 4YNMA 1N6CA 2O8JA 5F6LA 1N3JA 4FMUA 4J7IA 3S7BA 5KJLA 3M5AA 3S8PA 2QPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FPD A;  3M53 A;  3RJW A;  3OS5 A;  3RU0 A;  3S7D A;  3CBP A;  4NVQ A;  3M58 A;  2F69 A;  3OXG A;  4QEN A;  1H3I A;  3QWV A;  2RFI A;  2BQZ A;  4Z4P A;  1O9S A;  4YND A;  3TG4 A;  3M54 A;  4MI0 A;  3QWW A;  3MEK A;  3F9X A;  1MVX A;  5TEG A;  3CBO A;  3OPE A;  4BUP A;  5T0K A;  1N6A A;  5F6K C;  5JIN A;  3M57 A;  3VV0 A;  4YNP A;  5ARG A;  2W5Z A;  1MVH A;  5EX0 A;  4YPA A;  3TG5 A;  4YPE A;  3KMJ A;  5F59 A;  3RAY A;  2JV0 A;  1XQH A;  3M55 A;  4WUY A;  3OOI A;  3F9W A;  2W5Y A;  1PEG A;  3QWP A;  4J8O A;  4YPU A;  4MI5 A;  4QEP A;  5CCM A;  3HNA A;  5AYF A;  5TH7 A;  5CCL A;  1ZKK A;  3K5K A;  5T0M A;  5EG2 A;  5ARF A;  5LSZ A;  3OXF A;  4C1Q A;  2IGQ A;  3RIB A;  3F9Z A;  5JJ0 A;  2R3A A;  5HI7 A;  5HQ8 A;  1MUF A;  5KJN A;  5CPR B;  3RQ4 A;  3N71 A;  4LDG A;  3OXL A;  4I51 A;  5T5G A;  5TTF A;  4O6F A;  5KJK A;  3BO5 A;  3SW9 A;  5JHN A;  4IJ8 A;  4H12 A;  5LSX A;  3M59 A;  3VUZ A;  3KMT A;  3PDN A;  4J83 A;  4J7F A;  4E47 A;  3SWC A;  5JIY A;  3S7F A;  4NJ5 A;  1ML9 A;  5F5E A;  3MO2 A;  4AU7 A;  3MO5 A;  4RZ0 A;  5KJM A;  5EX3 A;  3EP0 A;  4QEO A;  4JLG A;  4O30 A;  3F9Y A;  3DB5 A;  3DAL A;  2G46 A;  3S7J A;  4JDS A;  1MT6 A;  3KMA A;  3M56 A;  3MO0 A;  4IJD A;  3IHX A;  3CBM A;  4YNM A;  1N6C A;  2O8J A;  5F6L A;  1N3J A;  4FMU A;  4J7I A;  3S7B A;  5KJL A;  3M5A A;  3S8P A;  2QPW A; 
#chains in the Genus database with same CATH topology
 3FPD A;  3M53 A;  3RJW A;  3OS5 A;  3RU0 A;  3S7D A;  3CBP A;  4NVQ A;  3M58 A;  2F69 A;  3OXG A;  4QEN A;  1H3I A;  3QWV A;  2RFI A;  2BQZ A;  4Z4P A;  1O9S A;  4YND A;  3TG4 A;  3M54 A;  4MI0 A;  3QWW A;  3MEK A;  3F9X A;  1MVX A;  5TEG A;  3CBO A;  3OPE A;  4BUP A;  5T0K A;  1N6A A;  5F6K C;  5JIN A;  3M57 A;  3VV0 A;  4YNP A;  5ARG A;  2W5Z A;  1MVH A;  5EX0 A;  4YPA A;  3TG5 A;  4YPE A;  3KMJ A;  5F59 A;  3RAY A;  2JV0 A;  1XQH A;  3M55 A;  4WUY A;  3OOI A;  3F9W A;  2W5Y A;  1PEG A;  3QWP A;  4J8O A;  4YPU A;  4MI5 A;  4QEP A;  5CCM A;  3HNA A;  5AYF A;  5TH7 A;  5CCL A;  1ZKK A;  3K5K A;  5T0M A;  5EG2 A;  5ARF A;  5LSZ A;  3OXF A;  4C1Q A;  2IGQ A;  3RIB A;  3F9Z A;  5JJ0 A;  2R3A A;  5HI7 A;  5HQ8 A;  1MUF A;  5KJN A;  5CPR B;  3RQ4 A;  3N71 A;  4LDG A;  3OXL A;  4I51 A;  5T5G A;  5TTF A;  4O6F A;  5KJK A;  3BO5 A;  3SW9 A;  5JHN A;  4IJ8 A;  4H12 A;  5LSX A;  3M59 A;  3VUZ A;  3KMT A;  3PDN A;  4J83 A;  4J7F A;  4E47 A;  3SWC A;  5JIY A;  3S7F A;  4NJ5 A;  1ML9 A;  5F5E A;  3MO2 A;  4AU7 A;  3MO5 A;  4RZ0 A;  5KJM A;  5EX3 A;  3EP0 A;  4QEO A;  4JLG A;  4O30 A;  3F9Y A;  3DB5 A;  3DAL A;  2G46 A;  3S7J A;  4JDS A;  1MT6 A;  3KMA A;  3M56 A;  3MO0 A;  4IJD A;  3IHX A;  3CBM A;  4YNM A;  1N6C A;  2O8J A;  5F6L A;  1N3J A;  4FMU A;  4J7I A;  3S7B A;  5KJL A;  3M5A A;  3S8P A;  2QPW A; 
#chains in the Genus database with same CATH homology
 3FPD A;  3M53 A;  3RJW A;  3OS5 A;  3RU0 A;  3S7D A;  3CBP A;  4NVQ A;  3M58 A;  2F69 A;  3OXG A;  4QEN A;  1H3I A;  3QWV A;  2RFI A;  2BQZ A;  4Z4P A;  1O9S A;  4YND A;  3TG4 A;  3M54 A;  4MI0 A;  3QWW A;  3MEK A;  3F9X A;  1MVX A;  5TEG A;  3CBO A;  3OPE A;  4BUP A;  5T0K A;  1N6A A;  5F6K C;  5JIN A;  3M57 A;  3VV0 A;  4YNP A;  5ARG A;  2W5Z A;  1MVH A;  5EX0 A;  4YPA A;  3TG5 A;  4YPE A;  3KMJ A;  5F59 A;  3RAY A;  2JV0 A;  1XQH A;  3M55 A;  4WUY A;  3OOI A;  3F9W A;  2W5Y A;  1PEG A;  3QWP A;  4J8O A;  4YPU A;  4MI5 A;  4QEP A;  5CCM A;  3HNA A;  5AYF A;  5TH7 A;  5CCL A;  1ZKK A;  3K5K A;  5T0M A;  5EG2 A;  5ARF A;  5LSZ A;  3OXF A;  4C1Q A;  2IGQ A;  3RIB A;  3F9Z A;  5JJ0 A;  2R3A A;  5HI7 A;  5HQ8 A;  1MUF A;  5KJN A;  5CPR B;  3RQ4 A;  3N71 A;  4LDG A;  3OXL A;  4I51 A;  5T5G A;  5TTF A;  4O6F A;  5KJK A;  3BO5 A;  3SW9 A;  5JHN A;  4IJ8 A;  4H12 A;  5LSX A;  3M59 A;  3VUZ A;  3KMT A;  3PDN A;  4J83 A;  4J7F A;  4E47 A;  3SWC A;  5JIY A;  3S7F A;  4NJ5 A;  1ML9 A;  5F5E A;  3MO2 A;  4AU7 A;  3MO5 A;  4RZ0 A;  5KJM A;  5EX3 A;  3EP0 A;  4QEO A;  4JLG A;  4O30 A;  3F9Y A;  3DB5 A;  3DAL A;  2G46 A;  3S7J A;  4JDS A;  1MT6 A;  3KMA A;  3M56 A;  3MO0 A;  4IJD A;  3IHX A;  3CBM A;  4YNM A;  1N6C A;  2O8J A;  5F6L A;  1N3J A;  4FMU A;  4J7I A;  3S7B A;  5KJL A;  3M5A A;  3S8P A;  2QPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...