4QENA

Crystal structure of kryptonite in complex with mchh dna and sah
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
526
structure length
472
Chain Sequence
LEPHLKVTKCLRLFNKQYLLCVQAKLSRPDLKGVTEMIKAKAILYPRKIIGDLPGIDVGHRFFSRAEMCAVGFHNHWLNGIDYMSMEYEKEYSNYKLPLAVSIVMSGQYEDDLDNADTVTYTGQGGHNLTGNKRQIKDQLLERGNLALKHCCEYNVPVRVTRGHNCKSSYTKRVYTYDGLYKVEKFWAQKGVSGFTVYKYRLKRLEGQPELTTDIEGLVCEDISGGLEFKGIPATNRVDDSPVSPTSGFTYIKSLIIEPNVIIPKSSTGCNCRGSCTDSKKCACAKLNGGNFPYVDLNDGRLIESRDVVFECGPHCGCGPKCVNRTSQKRLRFNLEVFRSAKKGWAVRSWEYIPAGSPVCEYIGVVRRTADVNEYIFEIDCPEFCIDAGSTGNFARFINHSCEPNLFVQCVLSSHQDIRLARVVLFAADNISPMQELTYDYGYALDSVHGPDGKVKQLACYCGALNCRKRLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific SUV
publication title Mechanism of DNA Methylation-Directed Histone Methylation by KRYPTONITE.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription/dna
total genus 135
structure length 472
sequence length 526
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2014-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF02182 SAD_SRA SAD/SRA domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4qenA03
4QENA 4IJ8A 3EP0A 3S7FA 3TG4A 3RIBA 3RAYA 5JIYA 1O9SA 3MO5A 4I51A 3KMAA 1XQHA 3F9XA 2IGQA 3VV0A 1MVXA 3M54A 4YPAA 3K5KA 4O30A 5AYFA 3M5AA 4JDSA 3RQ4A 3S7BA 4YNDA 4AU7A 3S7JA 4BUPA 4J8OA 5EG2A 5EX3A 5ARFA 3OXFA 3CBMA 4Z4PA 1MT6A 5T0MA 3RU0A 3S7DA 3F9WA 3M55A 5KJLA 3OXLA 1H3IA 3KMJA 2O8JA 4YNMA 4YPEA 1MVHA 3MEKA 3M59A 5TEGA 3OOIA 5TH7A 4E47A 5CPRB 3FPDA 3OXGA 4FMUA 2W5YA 5F6LA 3QWPA 3QWWA 3M57A 5JHNA 5JINA 5ARGA 3M56A 3CBOA 3RJWA 5EX0A 1ML9A 4NVQA 2F69A 2JV0A 3IHXA 3CBPA 4RZ0A 5T5GA 2BQZA 4IJDA 5LSZA 3MO0A 5CCLA 3TG5A 3F9YA 5TTFA 4WUYA 4MI5A 3DALA 3OS5A 4J83A 4YNPA 3M58A 3QWVA 3SW9A 5T0KA 3S8PA 5F5EA 4QEOA 3KMTA 3M53A 4JLGA 1ZKKA 5KJMA 3MO2A 5CCMA 3SWCA 3DB5A 3PDNA 4J7FA 4H12A 4LDGA 3VUZA 5KJKA 4MI0A 5HI7A 3OPEA 4NJ5A 1N6AA 5KJNA 2RFIA 4YPUA 4C1QA 4QEPA 4J7IA 5LSXA 2W5ZA 3BO5A 2G46A 1MUFA 3HNAA 4O6FA 5F59A 5HQ8A 1N6CA 1PEGA 3N71A 1N3JA 2QPWA 2R3AA 5F6KC 5JJ0A 3F9ZA
chains in the Genus database with same CATH superfamily
4QENA 4IJ8A 3EP0A 3S7FA 3TG4A 3RIBA 3RAYA 5JIYA 1O9SA 3MO5A 4I51A 3KMAA 1XQHA 3F9XA 2IGQA 3VV0A 1MVXA 3M54A 4YPAA 3K5KA 4O30A 5AYFA 3M5AA 4JDSA 3RQ4A 3S7BA 4YNDA 4AU7A 3S7JA 4BUPA 4J8OA 5EG2A 5EX3A 5ARFA 3OXFA 3CBMA 4Z4PA 1MT6A 5T0MA 3RU0A 3S7DA 3F9WA 3M55A 5KJLA 3OXLA 1H3IA 3KMJA 2O8JA 4YNMA 4YPEA 1MVHA 3MEKA 3M59A 5TEGA 3OOIA 5TH7A 4E47A 5CPRB 3FPDA 3OXGA 4FMUA 2W5YA 5F6LA 3QWPA 3QWWA 3M57A 5JHNA 5JINA 5ARGA 3M56A 3CBOA 3RJWA 5EX0A 1ML9A 4NVQA 2F69A 2JV0A 3IHXA 3CBPA 4RZ0A 5T5GA 2BQZA 4IJDA 5LSZA 3MO0A 5CCLA 3TG5A 3F9YA 5TTFA 4WUYA 4MI5A 3DALA 3OS5A 4J83A 4YNPA 3M58A 3QWVA 3SW9A 5T0KA 3S8PA 5F5EA 4QEOA 3KMTA 3M53A 4JLGA 1ZKKA 5KJMA 3MO2A 5CCMA 3SWCA 3DB5A 3PDNA 4J7FA 4H12A 4LDGA 3VUZA 5KJKA 4MI0A 5HI7A 3OPEA 4NJ5A 1N6AA 5KJNA 2RFIA 4YPUA 4C1QA 4QEPA 4J7IA 5LSXA 2W5ZA 3BO5A 2G46A 1MUFA 3HNAA 4O6FA 5F59A 5HQ8A 1N6CA 1PEGA 3N71A 1N3JA 2QPWA 2R3AA 5F6KC 5JJ0A 3F9ZA
chains in the Genus database with same CATH topology
4QENA 4IJ8A 3EP0A 3S7FA 3TG4A 3RIBA 3RAYA 5JIYA 1O9SA 3MO5A 4I51A 3KMAA 1XQHA 3F9XA 2IGQA 3VV0A 1MVXA 3M54A 4YPAA 3K5KA 4O30A 5AYFA 3M5AA 4JDSA 3RQ4A 3S7BA 4YNDA 4AU7A 3S7JA 4BUPA 4J8OA 5EG2A 5EX3A 5ARFA 3OXFA 3CBMA 4Z4PA 1MT6A 5T0MA 3RU0A 3S7DA 3F9WA 3M55A 5KJLA 3OXLA 1H3IA 3KMJA 2O8JA 4YNMA 4YPEA 1MVHA 3MEKA 3M59A 5TEGA 3OOIA 5TH7A 4E47A 5CPRB 3FPDA 3OXGA 4FMUA 2W5YA 5F6LA 3QWPA 3QWWA 3M57A 5JHNA 5JINA 5ARGA 3M56A 3CBOA 3RJWA 5EX0A 1ML9A 4NVQA 2F69A 2JV0A 3IHXA 3CBPA 4RZ0A 5T5GA 2BQZA 4IJDA 5LSZA 3MO0A 5CCLA 3TG5A 3F9YA 5TTFA 4WUYA 4MI5A 3DALA 3OS5A 4J83A 4YNPA 3M58A 3QWVA 3SW9A 5T0KA 3S8PA 5F5EA 4QEOA 3KMTA 3M53A 4JLGA 1ZKKA 5KJMA 3MO2A 5CCMA 3SWCA 3DB5A 3PDNA 4J7FA 4H12A 4LDGA 3VUZA 5KJKA 4MI0A 5HI7A 3OPEA 4NJ5A 1N6AA 5KJNA 2RFIA 4YPUA 4C1QA 4QEPA 4J7IA 5LSXA 2W5ZA 3BO5A 2G46A 1MUFA 3HNAA 4O6FA 5F59A 5HQ8A 1N6CA 1PEGA 3N71A 1N3JA 2QPWA 2R3AA 5F6KC 5JJ0A 3F9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QEN A;  4IJ8 A;  3EP0 A;  3S7F A;  3TG4 A;  3RIB A;  3RAY A;  5JIY A;  1O9S A;  3MO5 A;  4I51 A;  3KMA A;  1XQH A;  3F9X A;  2IGQ A;  3VV0 A;  1MVX A;  3M54 A;  4YPA A;  3K5K A;  4O30 A;  5AYF A;  3M5A A;  4JDS A;  3RQ4 A;  3S7B A;  4YND A;  4AU7 A;  3S7J A;  4BUP A;  4J8O A;  5EG2 A;  5EX3 A;  5ARF A;  3OXF A;  3CBM A;  4Z4P A;  1MT6 A;  5T0M A;  3RU0 A;  3S7D A;  3F9W A;  3M55 A;  5KJL A;  3OXL A;  1H3I A;  3KMJ A;  2O8J A;  4YNM A;  4YPE A;  1MVH A;  3MEK A;  3M59 A;  5TEG A;  3OOI A;  5TH7 A;  4E47 A;  5CPR B;  3FPD A;  3OXG A;  4FMU A;  2W5Y A;  5F6L A;  3QWP A;  3QWW A;  3M57 A;  5JHN A;  5JIN A;  5ARG A;  3M56 A;  3CBO A;  3RJW A;  5EX0 A;  1ML9 A;  4NVQ A;  2F69 A;  2JV0 A;  3IHX A;  3CBP A;  4RZ0 A;  5T5G A;  2BQZ A;  4IJD A;  5LSZ A;  3MO0 A;  5CCL A;  3TG5 A;  3F9Y A;  5TTF A;  4WUY A;  4MI5 A;  3DAL A;  3OS5 A;  4J83 A;  4YNP A;  3M58 A;  3QWV A;  3SW9 A;  5T0K A;  3S8P A;  5F5E A;  4QEO A;  3KMT A;  3M53 A;  4JLG A;  1ZKK A;  5KJM A;  3MO2 A;  5CCM A;  3SWC A;  3DB5 A;  3PDN A;  4J7F A;  4H12 A;  4LDG A;  3VUZ A;  5KJK A;  4MI0 A;  5HI7 A;  3OPE A;  4NJ5 A;  1N6A A;  5KJN A;  2RFI A;  4YPU A;  4C1Q A;  4QEP A;  4J7I A;  5LSX A;  2W5Z A;  3BO5 A;  2G46 A;  1MUF A;  3HNA A;  4O6F A;  5F59 A;  5HQ8 A;  1N6C A;  1PEG A;  3N71 A;  1N3J A;  2QPW A;  2R3A A;  5F6K C;  5JJ0 A;  3F9Z A; 
#chains in the Genus database with same CATH topology
 4QEN A;  4IJ8 A;  3EP0 A;  3S7F A;  3TG4 A;  3RIB A;  3RAY A;  5JIY A;  1O9S A;  3MO5 A;  4I51 A;  3KMA A;  1XQH A;  3F9X A;  2IGQ A;  3VV0 A;  1MVX A;  3M54 A;  4YPA A;  3K5K A;  4O30 A;  5AYF A;  3M5A A;  4JDS A;  3RQ4 A;  3S7B A;  4YND A;  4AU7 A;  3S7J A;  4BUP A;  4J8O A;  5EG2 A;  5EX3 A;  5ARF A;  3OXF A;  3CBM A;  4Z4P A;  1MT6 A;  5T0M A;  3RU0 A;  3S7D A;  3F9W A;  3M55 A;  5KJL A;  3OXL A;  1H3I A;  3KMJ A;  2O8J A;  4YNM A;  4YPE A;  1MVH A;  3MEK A;  3M59 A;  5TEG A;  3OOI A;  5TH7 A;  4E47 A;  5CPR B;  3FPD A;  3OXG A;  4FMU A;  2W5Y A;  5F6L A;  3QWP A;  3QWW A;  3M57 A;  5JHN A;  5JIN A;  5ARG A;  3M56 A;  3CBO A;  3RJW A;  5EX0 A;  1ML9 A;  4NVQ A;  2F69 A;  2JV0 A;  3IHX A;  3CBP A;  4RZ0 A;  5T5G A;  2BQZ A;  4IJD A;  5LSZ A;  3MO0 A;  5CCL A;  3TG5 A;  3F9Y A;  5TTF A;  4WUY A;  4MI5 A;  3DAL A;  3OS5 A;  4J83 A;  4YNP A;  3M58 A;  3QWV A;  3SW9 A;  5T0K A;  3S8P A;  5F5E A;  4QEO A;  3KMT A;  3M53 A;  4JLG A;  1ZKK A;  5KJM A;  3MO2 A;  5CCM A;  3SWC A;  3DB5 A;  3PDN A;  4J7F A;  4H12 A;  4LDG A;  3VUZ A;  5KJK A;  4MI0 A;  5HI7 A;  3OPE A;  4NJ5 A;  1N6A A;  5KJN A;  2RFI A;  4YPU A;  4C1Q A;  4QEP A;  4J7I A;  5LSX A;  2W5Z A;  3BO5 A;  2G46 A;  1MUF A;  3HNA A;  4O6F A;  5F59 A;  5HQ8 A;  1N6C A;  1PEG A;  3N71 A;  1N3J A;  2QPW A;  2R3A A;  5F6K C;  5JJ0 A;  3F9Z A; 
#chains in the Genus database with same CATH homology
 4QEN A;  4IJ8 A;  3EP0 A;  3S7F A;  3TG4 A;  3RIB A;  3RAY A;  5JIY A;  1O9S A;  3MO5 A;  4I51 A;  3KMA A;  1XQH A;  3F9X A;  2IGQ A;  3VV0 A;  1MVX A;  3M54 A;  4YPA A;  3K5K A;  4O30 A;  5AYF A;  3M5A A;  4JDS A;  3RQ4 A;  3S7B A;  4YND A;  4AU7 A;  3S7J A;  4BUP A;  4J8O A;  5EG2 A;  5EX3 A;  5ARF A;  3OXF A;  3CBM A;  4Z4P A;  1MT6 A;  5T0M A;  3RU0 A;  3S7D A;  3F9W A;  3M55 A;  5KJL A;  3OXL A;  1H3I A;  3KMJ A;  2O8J A;  4YNM A;  4YPE A;  1MVH A;  3MEK A;  3M59 A;  5TEG A;  3OOI A;  5TH7 A;  4E47 A;  5CPR B;  3FPD A;  3OXG A;  4FMU A;  2W5Y A;  5F6L A;  3QWP A;  3QWW A;  3M57 A;  5JHN A;  5JIN A;  5ARG A;  3M56 A;  3CBO A;  3RJW A;  5EX0 A;  1ML9 A;  4NVQ A;  2F69 A;  2JV0 A;  3IHX A;  3CBP A;  4RZ0 A;  5T5G A;  2BQZ A;  4IJD A;  5LSZ A;  3MO0 A;  5CCL A;  3TG5 A;  3F9Y A;  5TTF A;  4WUY A;  4MI5 A;  3DAL A;  3OS5 A;  4J83 A;  4YNP A;  3M58 A;  3QWV A;  3SW9 A;  5T0K A;  3S8P A;  5F5E A;  4QEO A;  3KMT A;  3M53 A;  4JLG A;  1ZKK A;  5KJM A;  3MO2 A;  5CCM A;  3SWC A;  3DB5 A;  3PDN A;  4J7F A;  4H12 A;  4LDG A;  3VUZ A;  5KJK A;  4MI0 A;  5HI7 A;  3OPE A;  4NJ5 A;  1N6A A;  5KJN A;  2RFI A;  4YPU A;  4C1Q A;  4QEP A;  4J7I A;  5LSX A;  2W5Z A;  3BO5 A;  2G46 A;  1MUF A;  3HNA A;  4O6F A;  5F59 A;  5HQ8 A;  1N6C A;  1PEG A;  3N71 A;  1N3J A;  2QPW A;  2R3A A;  5F6K C;  5JJ0 A;  3F9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...