1F3YA

Solution structure of the nudix enzyme diadenosine tetraphosphate hydrolase from lupinus angustifolius l.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
165
structure length
165
Chain Sequence
b'GPLGSMDSPPEGYRRNVGICLMNNDKKIFAASRLDIPDAWQMPQGGIDEGEDPRNAAIRELREETGVTSAEVIAEVPYWLTYDFPPKVREKLNIQWGSDWKGQAQKWFLFKFTGQDQEINLLGDGSEKPEFGEWSWVTPEQLIDLTVEFKKPVYKEVLSVFAPHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIADENOSINE 5',5'''-P1,P4-TETRAPHOSPHATE HYDROLASE
publication title The three-dimensional structure of the Nudix enzyme diadenosine tetraphosphate hydrolase from Lupinus angustifolius L.
pubmed doi rcsb
source organism Lupinus angustifolius
molecule tags Hydrolase
total genus 30
structure length 165
sequence length 165
ec nomenclature ec 3.6.1.17: Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical).
pdb deposition date 2000-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1f3yA00
1PUNA 3BAPA 2A8TA 1V8TA 5GHPA 4KG4A 3J7Ye 3P6YA 3MCFA 3KVHA 2YVMA 1MK1A 1V8LA 1VC9A 4NFXA 1X83A 3EF5A 2AZWA 3CNGA 3EXQA 5DEQA 3ACAA 3O61A 5ISYA 3P5TA 3RH7A 4HVYA 2ICJA 5C7QA 1X51A 3GZ8A 3Q4IA 1V8IA 2DSDA 1Q27A 2YVOA 1IRYA 3X0KA 4S2WA 1KT9A 3FSPA 1SOIA 2J8QA 1MR2A 4MPOA 3QSJA 1I9AA 5FSOA 2KDWA 2YVNA 3U53A 4DYWA 2W4EA 3GRNA 4JZTA 4ZG0A 2YVPA 2CL3A 2Q9PA 1V8SA 2A8RA 4N1TA 3X0LA 1VK6A 3COUA 5ANWA 1PUQA 2FMLA 3A6UA 5IW5A 5LPGA 1V8WA 4S2XA 1PVFA 2QKMB 3DUPA 3HYQA 4JZVA 1RRQA 1XSAA 4JZSA 2DSCA 2A8QA 3AC9A 5GHIA 2DSBA 1Q54A 2JVBA 1Q33A 3L85A 1OW2A 4KG3A 5FSMA 2B0VA 3O52A 1X84A 2GT4A 5GHQA 5BONA 4S2VA 2GB5A 3BM4A 3H95A 3GWYA 5GHJA 3X0MA 3X0JA 4HFQA 3EEUA 2ICKA 2A8SA 1HX3A 1VHZA 2PQVA 1G9QA 4ICKA 2I8UA 3EESA 5GHOA 3FK9A 1V8YA 1V8RA 1V8UA 3F13A 5FSNA 3FCMA 1VHGA 5GHMA 3ZR1A 1F3YA 2YYHA 5FSIA 2DUKA 3A6SA 2QJOA 3X0NA 3GZ6A 3O69A 3X0SA 5BS6A 3G0QA 4IJXA 2O5WA 1MP2A 1MUTA 4JZUA 5ANTA 3ZR0A 5DDGA 3MDIA 4C9XA 3N9UA 4N1UA 5C8LA 3FFUA 3X0RA 3WHWA 1G0SA 2R5WA 2G74A 1KHZA 2B2KA 2I8TA 3A6VA 2DHOA 1NFZA 4KTBA 5ANUA 3X0IA 1V8MA 1VIQA 2GT2A 2A6TA 2PNYA 3Q2SA 5FSLA 3MDGA 5ANSA 3SHDA 3X0OA 1VIUA 5ANVA 5IW4A 3GZ5A 2B06A 1QVJA 3ID9A 2O5FA 1NFSA 3O8SA 3BHOA 2XSQA 1PPWA 3FJYA 1SJYA 1U20A 3HHJA 3I7UA 4C9WA 2RRKA 3E57A 2I6KA 2QJTA 3I9XA 3O6ZA 1NQYA 3OGAA 3Q2TA 1K26A 1SU2A 2VNQA 5HZXA 1PPXA 1JRKA 3X0QA 1KTGA 1RRSA 5CFJA 1GA7A 1HZTA 3A6TA 3DKUA 1PUSA 2FVVA 3GG6A 4KYXA 5GHNA 3Q91A 4YPHA 4K6EA 4ILQA 1PPVA 2KDVA 4YOQA 1K2EA 3SONA 5C7TA 1RYAA 4YPRA 1VRLA 2G73A 2FKBA 5CFIA 1MQEA 1NQZA 1MQWA 3MGMA 3F6AA 2A8PA 3R03A 2O1CA 3N77A 1R67A 1XSCA 3I7VA 3Q1PA 5FSKA 3X0PA 4V14A 5I8UA 1JKNA 3SMDA 2VNPA 4S2YA 5DPKA 1VC8A 4NFWA 1V8NA 1XSBA 5DD4A 3Q93A 1VCDA 1SZ3A 1TUMA 1V8VA
chains in the Genus database with same CATH superfamily
1PUNA 3BAPA 2A8TA 1V8TA 5GHPA 4KG4A 3J7Ye 3P6YA 3MCFA 3KVHA 2YVMA 1MK1A 1V8LA 1VC9A 4NFXA 1X83A 3EF5A 2AZWA 3CNGA 3EXQA 5DEQA 3ACAA 3O61A 5ISYA 3P5TA 3RH7A 4HVYA 2ICJA 5C7QA 1X51A 3GZ8A 3Q4IA 1V8IA 2DSDA 1Q27A 2YVOA 1IRYA 3X0KA 4S2WA 1KT9A 3FSPA 1SOIA 2J8QA 1MR2A 4MPOA 3QSJA 1I9AA 5FSOA 2KDWA 2YVNA 3U53A 4DYWA 2W4EA 3GRNA 4JZTA 4ZG0A 2YVPA 2CL3A 2Q9PA 1V8SA 2A8RA 2CZRA 4N1TA 1VK6A 3COUA 5ANWA 1PUQA 3X0LA 2FMLA 3A6UA 5IW5A 5LPGA 1V8WA 4S2XA 1PVFA 2QKMB 3DUPA 3HYQA 4JZVA 1RRQA 1XSAA 4JZSA 2DSCA 2A8QA 3AC9A 5GHIA 2DSBA 1Q54A 2JVBA 1Q33A 3L85A 1OW2A 4KG3A 5FSMA 2B0VA 3O52A 1X84A 2GT4A 5GHQA 5BONA 4S2VA 2GB5A 3BM4A 3H95A 3GWYA 5GHJA 3X0MA 3X0JA 4HFQA 3EEUA 2ICKA 2A8SA 1HX3A 1VHZA 2PQVA 1G9QA 4ICKA 2I8UA 3EESA 5GHOA 3FK9A 1V8YA 1V8RA 1V8UA 3F13A 5FSNA 3FCMA 1VHGA 5GHMA 3ZR1A 1F3YA 2YYHA 5FSIA 2DUKA 3A6SA 2QJOA 3X0NA 3GZ6A 3O69A 3X0SA 5BS6A 3G0QA 4IJXA 2O5WA 1MP2A 1MUTA 4JZUA 5ANTA 3ZR0A 5DDGA 3MDIA 4C9XA 3N9UA 4N1UA 5C8LA 3FFUA 3X0RA 3WHWA 1G0SA 2R5WA 2G74A 1KHZA 2B2KA 2I8TA 3A6VA 2DHOA 1NFZA 4KTBA 5ANUA 3X0IA 1V8MA 1VIQA 2GT2A 2A6TA 2PNYA 3Q2SA 5FSLA 3MDGA 5ANSA 4J7GA 3SHDA 3X0OA 1VIUA 5ANVA 5IW4A 3GZ5A 2B06A 1QVJA 3ID9A 2O5FA 1NFSA 3O8SA 3BHOA 2XSQA 1PPWA 3FJYA 1SJYA 1U20A 3HHJA 3I7UA 4C9WA 2RRKA 3E57A 2I6KA 2QJTA 3I9XA 3O6ZA 1NQYA 3OGAA 3Q2TA 1K26A 1SU2A 2VNQA 5HZXA 1PPXA 1JRKA 3X0QA 1KTGA 1RRSA 5CFJA 1GA7A 1HZTA 3A6TA 3DKUA 1PUSA 2FVVA 3GG6A 4J7HA 4KYXA 3Q91A 5GHNA 4K6EA 4ILQA 4YPHA 1PPVA 2KDVA 4YOQA 1K2EA 3SONA 5C7TA 1RYAA 4YPRA 1VRLA 2G73A 2FKBA 5CFIA 1MQEA 1NQZA 1MQWA 3MGMA 3F6AA 2A8PA 3R03A 2O1CA 3N77A 1R67A 1XSCA 3I7VA 3Q1PA 5FSKA 3X0PA 4V14A 5I8UA 1JKNA 3SMDA 2VNPA 4S2YA 5DPKA 1VC8A 4NFWA 1V8NA 1XSBA 5DD4A 3Q93A 1VCDA 1SZ3A 1TUMA 1V8VA
chains in the Genus database with same CATH topology
1PUNA 3BAPA 2A8TA 1V8TA 5GHPA 4KG4A 3J7Ye 3P6YA 3MCFA 3KVHA 2YVMA 1MK1A 1V8LA 1VC9A 4NFXA 1X83A 3EF5A 2AZWA 3CNGA 3EXQA 5DEQA 3ACAA 3O61A 5ISYA 3P5TA 3RH7A 4HVYA 2ICJA 5C7QA 1X51A 3GZ8A 3Q4IA 1V8IA 2DSDA 1Q27A 2YVOA 1IRYA 3X0KA 4S2WA 1KT9A 3FSPA 1SOIA 2J8QA 1MR2A 4MPOA 3QSJA 1I9AA 5FSOA 2KDWA 2YVNA 3U53A 4DYWA 2W4EA 3GRNA 4JZTA 4ZG0A 2YVPA 2CL3A 2Q9PA 1V8SA 2A8RA 2CZRA 4N1TA 1VK6A 3COUA 5ANWA 1PUQA 3X0LA 2FMLA 3A6UA 5IW5A 5LPGA 1V8WA 4S2XA 1PVFA 2QKMB 3DUPA 3HYQA 4JZVA 1RRQA 1XSAA 4JZSA 2DSCA 2A8QA 3AC9A 5GHIA 2DSBA 1Q54A 2JVBA 1Q33A 3L85A 1OW2A 4KG3A 5FSMA 2B0VA 3O52A 1X84A 2GT4A 5GHQA 5BONA 4S2VA 2GB5A 3BM4A 3H95A 3GWYA 5GHJA 3X0MA 3X0JA 4HFQA 3EEUA 2ICKA 2A8SA 1HX3A 1VHZA 2PQVA 1G9QA 4ICKA 2I8UA 3EESA 5GHOA 3FK9A 1V8YA 1V8RA 1V8UA 3F13A 5FSNA 3FCMA 1VHGA 5GHMA 3ZR1A 1F3YA 2YYHA 5FSIA 2DUKA 3A6SA 2QJOA 3X0NA 3GZ6A 3O69A 3X0SA 5BS6A 3G0QA 4IJXA 2O5WA 1MP2A 1MUTA 4JZUA 5ANTA 3ZR0A 5DDGA 3MDIA 4C9XA 3N9UA 4N1UA 5C8LA 3FFUA 3X0RA 3WHWA 1G0SA 2R5WA 2G74A 1KHZA 2B2KA 2I8TA 3A6VA 2DHOA 1NFZA 4KTBA 5ANUA 3X0IA 1V8MA 1VIQA 2GT2A 2A6TA 2PNYA 3Q2SA 5FSLA 3MDGA 5ANSA 4J7GA 3SHDA 3X0OA 1VIUA 5ANVA 5IW4A 3GZ5A 2B06A 1QVJA 3ID9A 2O5FA 1NFSA 3O8SA 3BHOA 2XSQA 1PPWA 3FJYA 1SJYA 1U20A 3HHJA 3I7UA 4C9WA 2RRKA 3E57A 2I6KA 2QJTA 3I9XA 3O6ZA 1NQYA 3OGAA 3Q2TA 1K26A 1SU2A 2VNQA 5HZXA 1PPXA 1JRKA 3X0QA 1KTGA 1RRSA 5CFJA 1GA7A 1HZTA 3A6TA 3DKUA 1PUSA 2FVVA 3GG6A 4J7HA 4KYXA 3Q91A 5GHNA 4K6EA 4ILQA 4YPHA 1PPVA 2KDVA 4YOQA 1K2EA 3SONA 5C7TA 1RYAA 4YPRA 1VRLA 2G73A 2FKBA 5CFIA 1MQEA 1NQZA 1MQWA 3MGMA 3F6AA 2A8PA 3R03A 2O1CA 3N77A 1R67A 1XSCA 3I7VA 3Q1PA 5FSKA 3X0PA 4V14A 5I8UA 1JKNA 3SMDA 2VNPA 4S2YA 5DPKA 1VC8A 4NFWA 1V8NA 1XSBA 5DD4A 3Q93A 1VCDA 1SZ3A 1TUMA 1V8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PUN A;  3BAP A;  2A8T A;  1V8T A;  5GHP A;  4KG4 A;  3J7Y e;  3P6Y A;  3MCF A;  3KVH A;  2YVM A;  1MK1 A;  1V8L A;  1VC9 A;  4NFX A;  1X83 A;  3EF5 A;  2AZW A;  3CNG A;  3EXQ A;  5DEQ A;  3ACA A;  3O61 A;  5ISY A;  3P5T A;  3RH7 A;  4HVY A;  2ICJ A;  5C7Q A;  1X51 A;  3GZ8 A;  3Q4I A;  1V8I A;  2DSD A;  1Q27 A;  2YVO A;  1IRY A;  3X0K A;  4S2W A;  1KT9 A;  3FSP A;  1SOI A;  2J8Q A;  1MR2 A;  4MPO A;  3QSJ A;  1I9A A;  5FSO A;  2KDW A;  2YVN A;  3U53 A;  4DYW A;  2W4E A;  3GRN A;  4JZT A;  4ZG0 A;  2YVP A;  2CL3 A;  2Q9P A;  1V8S A;  2A8R A;  4N1T A;  3X0L A;  1VK6 A;  3COU A;  5ANW A;  1PUQ A;  2FML A;  3A6U A;  5IW5 A;  5LPG A;  1V8W A;  4S2X A;  1PVF A;  2QKM B;  3DUP A;  3HYQ A;  4JZV A;  1RRQ A;  1XSA A;  4JZS A;  2DSC A;  2A8Q A;  3AC9 A;  5GHI A;  2DSB A;  1Q54 A;  2JVB A;  1Q33 A;  3L85 A;  1OW2 A;  4KG3 A;  5FSM A;  2B0V A;  3O52 A;  1X84 A;  2GT4 A;  5GHQ A;  5BON A;  4S2V A;  2GB5 A;  3BM4 A;  3H95 A;  3GWY A;  5GHJ A;  3X0M A;  3X0J A;  4HFQ A;  3EEU A;  2ICK A;  2A8S A;  1HX3 A;  1VHZ A;  2PQV A;  1G9Q A;  4ICK A;  2I8U A;  3EES A;  5GHO A;  3FK9 A;  1V8Y A;  1V8R A;  1V8U A;  3F13 A;  5FSN A;  3FCM A;  1VHG A;  5GHM A;  3ZR1 A;  1F3Y A;  2YYH A;  5FSI A;  2DUK A;  3A6S A;  2QJO A;  3X0N A;  3GZ6 A;  3O69 A;  3X0S A;  5BS6 A;  3G0Q A;  4IJX A;  2O5W A;  1MP2 A;  1MUT A;  4JZU A;  5ANT A;  3ZR0 A;  5DDG A;  3MDI A;  4C9X A;  3N9U A;  4N1U A;  5C8L A;  3FFU A;  3X0R A;  3WHW A;  1G0S A;  2R5W A;  2G74 A;  1KHZ A;  2B2K A;  2I8T A;  3A6V A;  2DHO A;  1NFZ A;  4KTB A;  5ANU A;  3X0I A;  1V8M A;  1VIQ A;  2GT2 A;  2A6T A;  2PNY A;  3Q2S A;  5FSL A;  3MDG A;  5ANS A;  3SHD A;  3X0O A;  1VIU A;  5ANV A;  5IW4 A;  3GZ5 A;  2B06 A;  1QVJ A;  3ID9 A;  2O5F A;  1NFS A;  3O8S A;  3BHO A;  2XSQ A;  1PPW A;  3FJY A;  1SJY A;  1U20 A;  3HHJ A;  3I7U A;  4C9W A;  2RRK A;  3E57 A;  2I6K A;  2QJT A;  3I9X A;  3O6Z A;  1NQY A;  3OGA A;  3Q2T A;  1K26 A;  1SU2 A;  2VNQ A;  5HZX A;  1PPX A;  1JRK A;  3X0Q A;  1KTG A;  1RRS A;  5CFJ A;  1GA7 A;  1HZT A;  3A6T A;  3DKU A;  1PUS A;  2FVV A;  3GG6 A;  4KYX A;  5GHN A;  3Q91 A;  4YPH A;  4K6E A;  4ILQ A;  1PPV A;  2KDV A;  4YOQ A;  1K2E A;  3SON A;  5C7T A;  1RYA A;  4YPR A;  1VRL A;  2G73 A;  2FKB A;  5CFI A;  1MQE A;  1NQZ A;  1MQW A;  3MGM A;  3F6A A;  2A8P A;  3R03 A;  2O1C A;  3N77 A;  1R67 A;  1XSC A;  3I7V A;  3Q1P A;  5FSK A;  3X0P A;  4V14 A;  5I8U A;  1JKN A;  3SMD A;  2VNP A;  4S2Y A;  5DPK A;  1VC8 A;  4NFW A;  1V8N A;  1XSB A;  5DD4 A;  3Q93 A;  1VCD A;  1SZ3 A;  1TUM A;  1V8V A; 
#chains in the Genus database with same CATH topology
 1PUN A;  3BAP A;  2A8T A;  1V8T A;  5GHP A;  4KG4 A;  3J7Y e;  3P6Y A;  3MCF A;  3KVH A;  2YVM A;  1MK1 A;  1V8L A;  1VC9 A;  4NFX A;  1X83 A;  3EF5 A;  2AZW A;  3CNG A;  3EXQ A;  5DEQ A;  3ACA A;  3O61 A;  5ISY A;  3P5T A;  3RH7 A;  4HVY A;  2ICJ A;  5C7Q A;  1X51 A;  3GZ8 A;  3Q4I A;  1V8I A;  2DSD A;  1Q27 A;  2YVO A;  1IRY A;  3X0K A;  4S2W A;  1KT9 A;  3FSP A;  1SOI A;  2J8Q A;  1MR2 A;  4MPO A;  3QSJ A;  1I9A A;  5FSO A;  2KDW A;  2YVN A;  3U53 A;  4DYW A;  2W4E A;  3GRN A;  4JZT A;  4ZG0 A;  2YVP A;  2CL3 A;  2Q9P A;  1V8S A;  2A8R A;  2CZR A;  4N1T A;  1VK6 A;  3COU A;  5ANW A;  1PUQ A;  3X0L A;  2FML A;  3A6U A;  5IW5 A;  5LPG A;  1V8W A;  4S2X A;  1PVF A;  2QKM B;  3DUP A;  3HYQ A;  4JZV A;  1RRQ A;  1XSA A;  4JZS A;  2DSC A;  2A8Q A;  3AC9 A;  5GHI A;  2DSB A;  1Q54 A;  2JVB A;  1Q33 A;  3L85 A;  1OW2 A;  4KG3 A;  5FSM A;  2B0V A;  3O52 A;  1X84 A;  2GT4 A;  5GHQ A;  5BON A;  4S2V A;  2GB5 A;  3BM4 A;  3H95 A;  3GWY A;  5GHJ A;  3X0M A;  3X0J A;  4HFQ A;  3EEU A;  2ICK A;  2A8S A;  1HX3 A;  1VHZ A;  2PQV A;  1G9Q A;  4ICK A;  2I8U A;  3EES A;  5GHO A;  3FK9 A;  1V8Y A;  1V8R A;  1V8U A;  3F13 A;  5FSN A;  3FCM A;  1VHG A;  5GHM A;  3ZR1 A;  1F3Y A;  2YYH A;  5FSI A;  2DUK A;  3A6S A;  2QJO A;  3X0N A;  3GZ6 A;  3O69 A;  3X0S A;  5BS6 A;  3G0Q A;  4IJX A;  2O5W A;  1MP2 A;  1MUT A;  4JZU A;  5ANT A;  3ZR0 A;  5DDG A;  3MDI A;  4C9X A;  3N9U A;  4N1U A;  5C8L A;  3FFU A;  3X0R A;  3WHW A;  1G0S A;  2R5W A;  2G74 A;  1KHZ A;  2B2K A;  2I8T A;  3A6V A;  2DHO A;  1NFZ A;  4KTB A;  5ANU A;  3X0I A;  1V8M A;  1VIQ A;  2GT2 A;  2A6T A;  2PNY A;  3Q2S A;  5FSL A;  3MDG A;  5ANS A;  4J7G A;  3SHD A;  3X0O A;  1VIU A;  5ANV A;  5IW4 A;  3GZ5 A;  2B06 A;  1QVJ A;  3ID9 A;  2O5F A;  1NFS A;  3O8S A;  3BHO A;  2XSQ A;  1PPW A;  3FJY A;  1SJY A;  1U20 A;  3HHJ A;  3I7U A;  4C9W A;  2RRK A;  3E57 A;  2I6K A;  2QJT A;  3I9X A;  3O6Z A;  1NQY A;  3OGA A;  3Q2T A;  1K26 A;  1SU2 A;  2VNQ A;  5HZX A;  1PPX A;  1JRK A;  3X0Q A;  1KTG A;  1RRS A;  5CFJ A;  1GA7 A;  1HZT A;  3A6T A;  3DKU A;  1PUS A;  2FVV A;  3GG6 A;  4J7H A;  4KYX A;  3Q91 A;  5GHN A;  4K6E A;  4ILQ A;  4YPH A;  1PPV A;  2KDV A;  4YOQ A;  1K2E A;  3SON A;  5C7T A;  1RYA A;  4YPR A;  1VRL A;  2G73 A;  2FKB A;  5CFI A;  1MQE A;  1NQZ A;  1MQW A;  3MGM A;  3F6A A;  2A8P A;  3R03 A;  2O1C A;  3N77 A;  1R67 A;  1XSC A;  3I7V A;  3Q1P A;  5FSK A;  3X0P A;  4V14 A;  5I8U A;  1JKN A;  3SMD A;  2VNP A;  4S2Y A;  5DPK A;  1VC8 A;  4NFW A;  1V8N A;  1XSB A;  5DD4 A;  3Q93 A;  1VCD A;  1SZ3 A;  1TUM A;  1V8V A; 
#chains in the Genus database with same CATH homology
 1PUN A;  3BAP A;  2A8T A;  1V8T A;  5GHP A;  4KG4 A;  3J7Y e;  3P6Y A;  3MCF A;  3KVH A;  2YVM A;  1MK1 A;  1V8L A;  1VC9 A;  4NFX A;  1X83 A;  3EF5 A;  2AZW A;  3CNG A;  3EXQ A;  5DEQ A;  3ACA A;  3O61 A;  5ISY A;  3P5T A;  3RH7 A;  4HVY A;  2ICJ A;  5C7Q A;  1X51 A;  3GZ8 A;  3Q4I A;  1V8I A;  2DSD A;  1Q27 A;  2YVO A;  1IRY A;  3X0K A;  4S2W A;  1KT9 A;  3FSP A;  1SOI A;  2J8Q A;  1MR2 A;  4MPO A;  3QSJ A;  1I9A A;  5FSO A;  2KDW A;  2YVN A;  3U53 A;  4DYW A;  2W4E A;  3GRN A;  4JZT A;  4ZG0 A;  2YVP A;  2CL3 A;  2Q9P A;  1V8S A;  2A8R A;  2CZR A;  4N1T A;  1VK6 A;  3COU A;  5ANW A;  1PUQ A;  3X0L A;  2FML A;  3A6U A;  5IW5 A;  5LPG A;  1V8W A;  4S2X A;  1PVF A;  2QKM B;  3DUP A;  3HYQ A;  4JZV A;  1RRQ A;  1XSA A;  4JZS A;  2DSC A;  2A8Q A;  3AC9 A;  5GHI A;  2DSB A;  1Q54 A;  2JVB A;  1Q33 A;  3L85 A;  1OW2 A;  4KG3 A;  5FSM A;  2B0V A;  3O52 A;  1X84 A;  2GT4 A;  5GHQ A;  5BON A;  4S2V A;  2GB5 A;  3BM4 A;  3H95 A;  3GWY A;  5GHJ A;  3X0M A;  3X0J A;  4HFQ A;  3EEU A;  2ICK A;  2A8S A;  1HX3 A;  1VHZ A;  2PQV A;  1G9Q A;  4ICK A;  2I8U A;  3EES A;  5GHO A;  3FK9 A;  1V8Y A;  1V8R A;  1V8U A;  3F13 A;  5FSN A;  3FCM A;  1VHG A;  5GHM A;  3ZR1 A;  1F3Y A;  2YYH A;  5FSI A;  2DUK A;  3A6S A;  2QJO A;  3X0N A;  3GZ6 A;  3O69 A;  3X0S A;  5BS6 A;  3G0Q A;  4IJX A;  2O5W A;  1MP2 A;  1MUT A;  4JZU A;  5ANT A;  3ZR0 A;  5DDG A;  3MDI A;  4C9X A;  3N9U A;  4N1U A;  5C8L A;  3FFU A;  3X0R A;  3WHW A;  1G0S A;  2R5W A;  2G74 A;  1KHZ A;  2B2K A;  2I8T A;  3A6V A;  2DHO A;  1NFZ A;  4KTB A;  5ANU A;  3X0I A;  1V8M A;  1VIQ A;  2GT2 A;  2A6T A;  2PNY A;  3Q2S A;  5FSL A;  3MDG A;  5ANS A;  4J7G A;  3SHD A;  3X0O A;  1VIU A;  5ANV A;  5IW4 A;  3GZ5 A;  2B06 A;  1QVJ A;  3ID9 A;  2O5F A;  1NFS A;  3O8S A;  3BHO A;  2XSQ A;  1PPW A;  3FJY A;  1SJY A;  1U20 A;  3HHJ A;  3I7U A;  4C9W A;  2RRK A;  3E57 A;  2I6K A;  2QJT A;  3I9X A;  3O6Z A;  1NQY A;  3OGA A;  3Q2T A;  1K26 A;  1SU2 A;  2VNQ A;  5HZX A;  1PPX A;  1JRK A;  3X0Q A;  1KTG A;  1RRS A;  5CFJ A;  1GA7 A;  1HZT A;  3A6T A;  3DKU A;  1PUS A;  2FVV A;  3GG6 A;  4J7H A;  4KYX A;  3Q91 A;  5GHN A;  4K6E A;  4ILQ A;  4YPH A;  1PPV A;  2KDV A;  4YOQ A;  1K2E A;  3SON A;  5C7T A;  1RYA A;  4YPR A;  1VRL A;  2G73 A;  2FKB A;  5CFI A;  1MQE A;  1NQZ A;  1MQW A;  3MGM A;  3F6A A;  2A8P A;  3R03 A;  2O1C A;  3N77 A;  1R67 A;  1XSC A;  3I7V A;  3Q1P A;  5FSK A;  3X0P A;  4V14 A;  5I8U A;  1JKN A;  3SMD A;  2VNP A;  4S2Y A;  5DPK A;  1VC8 A;  4NFW A;  1V8N A;  1XSB A;  5DD4 A;  3Q93 A;  1VCD A;  1SZ3 A;  1TUM A;  1V8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...