1PUNA

Solution structure of the mutt pyrophosphohydrolase complexed with mg(2+) and 8-oxo-dgmp, a tightly-bound product
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
129
structure length
129
Chain Sequence
MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mutator mutT protein
publication title Solution structure and NH exchange studies of the MutT pyrophosphohydrolase complexed with Mg(2+) and 8-oxo-dGMP, a tightly bound product.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 18
structure length 129
sequence length 129
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2003-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1punA00
3BHOA 4ICKA 3E57A 3P6YA 2JVBA 3O61A 1V8YA 5FSLA 4YOQA 3Q2SA 1I9AA 1NFSA 3FSPA 4KYXA 1V8TA 3X0RA 1VIQA 1V8SA 1KHZA 2RRKA 3I7UA 3EEUA 5FSMA 3X0KA 1MQWA 2G73A 3O52A 5ANUA 1OW2A 2R5WA 3MGMA 3Q4IA 3AC9A 3EESA 2FVVA 3A6VA 5DPKA 3G0QA 3X0JA 3Q1PA 4NFWA 1RRSA 3FK9A 3A6SA 4N1TA 5DDGA 3O8SA 3Q2TA 1JRKA 3BAPA 3X0MA 1K26A 2A6TA 2QJOA 4KG3A 5FSOA 3Q93A 3I9XA 4C9XA 4DYWA 5CFIA 1V8NA 1RYAA 3F6AA 1X51A 1SZ3A 5ANVA 3A6UA 2YVPA 2ICKA 4MPOA 2B2KA 1XSAA 3MDIA 2QKMB 1MK1A 5GHMA 1MUTA 3GWYA 3FCMA 2PQVA 5CFJA 1VC8A 2AZWA 4K6EA 3DUPA 3KVHA 5ANTA 2FKBA 2DHOA 1Q54A 3OGAA 3QSJA 3EF5A 3U53A 3N77A 3F13A 2A8RA 1PPVA 1VHGA 3X0PA 1PPXA 2CL3A 3O6ZA 3HHJA 1MQEA 4JZTA 3SONA 3GZ5A 3ZR0A 1U20A 2DSBA 3A6TA 4N1UA 5C7TA 4YPHA 1VK6A 5GHIA 2B06A 1VC9A 2Q9PA 2W4EA 2A8PA 4KTBA 1GA7A 3CNGA 1PVFA 4ILQA 5ANWA 4HVYA 1XSCA 2VNPA 1V8IA 1V8MA 3I7VA 2I6KA 1X83A 1HZTA 3GRNA 4NFXA 1HX3A 3BM4A 1V8RA 2GT2A 5IW4A 3O69A 1G9QA 3N9UA 5GHOA 1G0SA 3HYQA 4C9WA 2ICJA 3X0SA 4JZVA 3GZ8A 4KG4A 5DD4A 2YVOA 1PUQA 2DUKA 4V14A 3L85A 5GHNA 4S2WA 5GHQA 1XSBA 3EXQA 5C7QA 2A8QA 5FSNA 2O1CA 4JZUA 2XSQA 3P5TA 5BS6A 2A8SA 4ZG0A 1TUMA 1K2EA 1PUSA 1NQYA 1RRQA 1X84A 3X0LA 3MDGA 1V8UA 2VNQA 3MCFA 1PPWA 4IJXA 3WHWA 1V8VA 1VIUA 3GZ6A 5GHJA 1F3YA 2GT4A 5HZXA 3X0QA 3J7Ye 3ZR1A 3ID9A 1NQZA 5BONA 5DEQA 3ACAA 2J8QA 5GHPA 3DKUA 2FMLA 1MP2A 2I8UA 2YVMA 1Q33A 5FSIA 4S2YA 3FJYA 1V8LA 1VHZA 1NFZA 2KDVA 5I8UA 5ISYA 2QJTA 3COUA 2YYHA 5FSKA 3X0NA 1MR2A 2O5FA 2B0VA 1V8WA 4JZSA 5LPGA 2I8TA 2PNYA 4S2XA 3RH7A 3X0OA 4YPRA 1SOIA 1QVJA 1VCDA 4HFQA 2G74A 1Q27A 2DSCA 3FFUA 5ANSA 1R67A 5C8LA 3SMDA 5IW5A 1VRLA 1PUNA 1SJYA 1IRYA 2KDWA 2DSDA 3Q91A 3GG6A 2O5WA 3X0IA 1KTGA 3R03A 1JKNA 2YVNA 1SU2A 2GB5A 4S2VA 3H95A 3SHDA 1KT9A 2A8TA
chains in the Genus database with same CATH superfamily
3BHOA 4ICKA 3E57A 4J7GA 3P6YA 2JVBA 3O61A 1V8YA 5FSLA 4YOQA 3Q2SA 1I9AA 1NFSA 3FSPA 4KYXA 1V8TA 3X0RA 1VIQA 1V8SA 1KHZA 2RRKA 3I7UA 3EEUA 5FSMA 3X0KA 1MQWA 2G73A 3O52A 5ANUA 1OW2A 2R5WA 3MGMA 3Q4IA 3AC9A 3EESA 2FVVA 3A6VA 5DPKA 3G0QA 3X0JA 3Q1PA 4NFWA 1RRSA 3FK9A 3A6SA 4N1TA 5DDGA 3O8SA 3Q2TA 1JRKA 3BAPA 3X0MA 1K26A 2A6TA 2QJOA 4KG3A 5FSOA 3Q93A 3I9XA 4C9XA 4DYWA 5CFIA 1V8NA 1RYAA 3F6AA 1X51A 1SZ3A 5ANVA 3A6UA 2YVPA 2ICKA 4MPOA 2B2KA 1XSAA 3MDIA 2QKMB 1MK1A 5GHMA 1MUTA 3GWYA 3FCMA 2PQVA 5CFJA 1VC8A 2AZWA 4K6EA 3DUPA 3KVHA 5ANTA 2FKBA 2DHOA 1Q54A 3OGAA 3QSJA 3EF5A 3U53A 3N77A 3F13A 2A8RA 1PPVA 1VHGA 3X0PA 1PPXA 2CL3A 3O6ZA 3HHJA 1MQEA 4JZTA 3SONA 3GZ5A 3ZR0A 1U20A 2DSBA 3A6TA 4N1UA 5C7TA 4YPHA 1VK6A 5GHIA 2B06A 1VC9A 2Q9PA 2W4EA 2A8PA 4KTBA 1GA7A 3CNGA 1PVFA 4ILQA 5ANWA 4HVYA 1XSCA 2VNPA 1V8IA 1V8MA 3I7VA 2I6KA 1X83A 1HZTA 3GRNA 4NFXA 1HX3A 3BM4A 1V8RA 2GT2A 5IW4A 3O69A 1G9QA 4J7HA 3N9UA 5GHOA 1G0SA 3HYQA 4C9WA 2ICJA 3X0SA 4JZVA 3GZ8A 4KG4A 5DD4A 2YVOA 1PUQA 2DUKA 4V14A 3L85A 5GHNA 4S2WA 5GHQA 1XSBA 3EXQA 5C7QA 2A8QA 5FSNA 2O1CA 4JZUA 2XSQA 3P5TA 5BS6A 2A8SA 4ZG0A 1TUMA 1K2EA 1PUSA 1NQYA 1RRQA 1X84A 3X0LA 3MDGA 1V8UA 2VNQA 3MCFA 1PPWA 4IJXA 3WHWA 1V8VA 1VIUA 3GZ6A 5GHJA 1F3YA 2GT4A 5HZXA 3X0QA 3J7Ye 3ZR1A 3ID9A 1NQZA 5BONA 5DEQA 3ACAA 2J8QA 5GHPA 3DKUA 2FMLA 1MP2A 2I8UA 2YVMA 1Q33A 5FSIA 4S2YA 3FJYA 1V8LA 1VHZA 1NFZA 2KDVA 5I8UA 5ISYA 2QJTA 3COUA 2YYHA 5FSKA 3X0NA 1MR2A 2O5FA 2B0VA 1V8WA 4JZSA 5LPGA 2I8TA 2CZRA 2PNYA 4S2XA 3RH7A 3X0OA 4YPRA 1SOIA 1QVJA 1VCDA 4HFQA 2G74A 1Q27A 2DSCA 3FFUA 5ANSA 1R67A 5C8LA 3SMDA 5IW5A 1VRLA 1PUNA 1SJYA 1IRYA 2KDWA 2DSDA 3Q91A 3GG6A 2O5WA 3X0IA 1KTGA 3R03A 1JKNA 2YVNA 1SU2A 2GB5A 4S2VA 3H95A 3SHDA 1KT9A 2A8TA
chains in the Genus database with same CATH topology
3BHOA 4ICKA 3E57A 4J7GA 3P6YA 2JVBA 3O61A 1V8YA 5FSLA 4YOQA 3Q2SA 1I9AA 1NFSA 3FSPA 4KYXA 1V8TA 3X0RA 1VIQA 1V8SA 1KHZA 2RRKA 3I7UA 3EEUA 5FSMA 3X0KA 1MQWA 2G73A 3O52A 5ANUA 1OW2A 2R5WA 3MGMA 3Q4IA 3AC9A 3EESA 2FVVA 3A6VA 5DPKA 3G0QA 3X0JA 3Q1PA 4NFWA 1RRSA 3FK9A 3A6SA 4N1TA 5DDGA 3O8SA 3Q2TA 1JRKA 3BAPA 3X0MA 1K26A 2A6TA 2QJOA 4KG3A 5FSOA 3Q93A 3I9XA 4C9XA 4DYWA 5CFIA 1V8NA 1RYAA 3F6AA 1X51A 1SZ3A 5ANVA 3A6UA 2YVPA 2ICKA 4MPOA 2B2KA 1XSAA 3MDIA 2QKMB 1MK1A 5GHMA 1MUTA 3GWYA 3FCMA 2PQVA 5CFJA 1VC8A 2AZWA 4K6EA 3DUPA 3KVHA 5ANTA 2FKBA 2DHOA 1Q54A 3OGAA 3QSJA 3EF5A 3U53A 3N77A 3F13A 2A8RA 1PPVA 1VHGA 3X0PA 1PPXA 2CL3A 3O6ZA 3HHJA 1MQEA 4JZTA 3SONA 3GZ5A 3ZR0A 1U20A 2DSBA 3A6TA 4N1UA 5C7TA 4YPHA 1VK6A 5GHIA 2B06A 1VC9A 2Q9PA 2W4EA 2A8PA 4KTBA 1GA7A 3CNGA 1PVFA 4ILQA 5ANWA 4HVYA 1XSCA 2VNPA 1V8IA 1V8MA 3I7VA 2I6KA 1X83A 1HZTA 3GRNA 4NFXA 1HX3A 3BM4A 1V8RA 2GT2A 5IW4A 3O69A 1G9QA 4J7HA 3N9UA 5GHOA 1G0SA 3HYQA 4C9WA 2ICJA 3X0SA 4JZVA 3GZ8A 4KG4A 5DD4A 2YVOA 1PUQA 2DUKA 4V14A 3L85A 5GHNA 4S2WA 5GHQA 1XSBA 3EXQA 5C7QA 2A8QA 5FSNA 2O1CA 4JZUA 2XSQA 3P5TA 5BS6A 2A8SA 4ZG0A 1TUMA 1K2EA 1PUSA 1NQYA 1RRQA 1X84A 3X0LA 3MDGA 1V8UA 2VNQA 3MCFA 1PPWA 4IJXA 3WHWA 1V8VA 1VIUA 3GZ6A 5GHJA 1F3YA 2GT4A 5HZXA 3X0QA 3J7Ye 3ZR1A 3ID9A 1NQZA 5BONA 5DEQA 3ACAA 2J8QA 5GHPA 3DKUA 2FMLA 1MP2A 2I8UA 2YVMA 1Q33A 5FSIA 4S2YA 3FJYA 1V8LA 1VHZA 1NFZA 2KDVA 5I8UA 5ISYA 2QJTA 3COUA 2YYHA 5FSKA 3X0NA 1MR2A 2O5FA 2B0VA 1V8WA 4JZSA 5LPGA 2I8TA 2CZRA 2PNYA 4S2XA 3RH7A 3X0OA 4YPRA 1SOIA 1QVJA 1VCDA 4HFQA 2G74A 1Q27A 2DSCA 3FFUA 5ANSA 1R67A 5C8LA 3SMDA 5IW5A 1VRLA 1PUNA 1SJYA 1IRYA 2KDWA 2DSDA 3Q91A 3GG6A 2O5WA 3X0IA 1KTGA 3R03A 1JKNA 2YVNA 1SU2A 2GB5A 4S2VA 3H95A 3SHDA 1KT9A 2A8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BHO A;  4ICK A;  3E57 A;  3P6Y A;  2JVB A;  3O61 A;  1V8Y A;  5FSL A;  4YOQ A;  3Q2S A;  1I9A A;  1NFS A;  3FSP A;  4KYX A;  1V8T A;  3X0R A;  1VIQ A;  1V8S A;  1KHZ A;  2RRK A;  3I7U A;  3EEU A;  5FSM A;  3X0K A;  1MQW A;  2G73 A;  3O52 A;  5ANU A;  1OW2 A;  2R5W A;  3MGM A;  3Q4I A;  3AC9 A;  3EES A;  2FVV A;  3A6V A;  5DPK A;  3G0Q A;  3X0J A;  3Q1P A;  4NFW A;  1RRS A;  3FK9 A;  3A6S A;  4N1T A;  5DDG A;  3O8S A;  3Q2T A;  1JRK A;  3BAP A;  3X0M A;  1K26 A;  2A6T A;  2QJO A;  4KG3 A;  5FSO A;  3Q93 A;  3I9X A;  4C9X A;  4DYW A;  5CFI A;  1V8N A;  1RYA A;  3F6A A;  1X51 A;  1SZ3 A;  5ANV A;  3A6U A;  2YVP A;  2ICK A;  4MPO A;  2B2K A;  1XSA A;  3MDI A;  2QKM B;  1MK1 A;  5GHM A;  1MUT A;  3GWY A;  3FCM A;  2PQV A;  5CFJ A;  1VC8 A;  2AZW A;  4K6E A;  3DUP A;  3KVH A;  5ANT A;  2FKB A;  2DHO A;  1Q54 A;  3OGA A;  3QSJ A;  3EF5 A;  3U53 A;  3N77 A;  3F13 A;  2A8R A;  1PPV A;  1VHG A;  3X0P A;  1PPX A;  2CL3 A;  3O6Z A;  3HHJ A;  1MQE A;  4JZT A;  3SON A;  3GZ5 A;  3ZR0 A;  1U20 A;  2DSB A;  3A6T A;  4N1U A;  5C7T A;  4YPH A;  1VK6 A;  5GHI A;  2B06 A;  1VC9 A;  2Q9P A;  2W4E A;  2A8P A;  4KTB A;  1GA7 A;  3CNG A;  1PVF A;  4ILQ A;  5ANW A;  4HVY A;  1XSC A;  2VNP A;  1V8I A;  1V8M A;  3I7V A;  2I6K A;  1X83 A;  1HZT A;  3GRN A;  4NFX A;  1HX3 A;  3BM4 A;  1V8R A;  2GT2 A;  5IW4 A;  3O69 A;  1G9Q A;  3N9U A;  5GHO A;  1G0S A;  3HYQ A;  4C9W A;  2ICJ A;  3X0S A;  4JZV A;  3GZ8 A;  4KG4 A;  5DD4 A;  2YVO A;  1PUQ A;  2DUK A;  4V14 A;  3L85 A;  5GHN A;  4S2W A;  5GHQ A;  1XSB A;  3EXQ A;  5C7Q A;  2A8Q A;  5FSN A;  2O1C A;  4JZU A;  2XSQ A;  3P5T A;  5BS6 A;  2A8S A;  4ZG0 A;  1TUM A;  1K2E A;  1PUS A;  1NQY A;  1RRQ A;  1X84 A;  3X0L A;  3MDG A;  1V8U A;  2VNQ A;  3MCF A;  1PPW A;  4IJX A;  3WHW A;  1V8V A;  1VIU A;  3GZ6 A;  5GHJ A;  1F3Y A;  2GT4 A;  5HZX A;  3X0Q A;  3J7Y e;  3ZR1 A;  3ID9 A;  1NQZ A;  5BON A;  5DEQ A;  3ACA A;  2J8Q A;  5GHP A;  3DKU A;  2FML A;  1MP2 A;  2I8U A;  2YVM A;  1Q33 A;  5FSI A;  4S2Y A;  3FJY A;  1V8L A;  1VHZ A;  1NFZ A;  2KDV A;  5I8U A;  5ISY A;  2QJT A;  3COU A;  2YYH A;  5FSK A;  3X0N A;  1MR2 A;  2O5F A;  2B0V A;  1V8W A;  4JZS A;  5LPG A;  2I8T A;  2PNY A;  4S2X A;  3RH7 A;  3X0O A;  4YPR A;  1SOI A;  1QVJ A;  1VCD A;  4HFQ A;  2G74 A;  1Q27 A;  2DSC A;  3FFU A;  5ANS A;  1R67 A;  5C8L A;  3SMD A;  5IW5 A;  1VRL A;  1PUN A;  1SJY A;  1IRY A;  2KDW A;  2DSD A;  3Q91 A;  3GG6 A;  2O5W A;  3X0I A;  1KTG A;  3R03 A;  1JKN A;  2YVN A;  1SU2 A;  2GB5 A;  4S2V A;  3H95 A;  3SHD A;  1KT9 A;  2A8T A; 
#chains in the Genus database with same CATH topology
 3BHO A;  4ICK A;  3E57 A;  4J7G A;  3P6Y A;  2JVB A;  3O61 A;  1V8Y A;  5FSL A;  4YOQ A;  3Q2S A;  1I9A A;  1NFS A;  3FSP A;  4KYX A;  1V8T A;  3X0R A;  1VIQ A;  1V8S A;  1KHZ A;  2RRK A;  3I7U A;  3EEU A;  5FSM A;  3X0K A;  1MQW A;  2G73 A;  3O52 A;  5ANU A;  1OW2 A;  2R5W A;  3MGM A;  3Q4I A;  3AC9 A;  3EES A;  2FVV A;  3A6V A;  5DPK A;  3G0Q A;  3X0J A;  3Q1P A;  4NFW A;  1RRS A;  3FK9 A;  3A6S A;  4N1T A;  5DDG A;  3O8S A;  3Q2T A;  1JRK A;  3BAP A;  3X0M A;  1K26 A;  2A6T A;  2QJO A;  4KG3 A;  5FSO A;  3Q93 A;  3I9X A;  4C9X A;  4DYW A;  5CFI A;  1V8N A;  1RYA A;  3F6A A;  1X51 A;  1SZ3 A;  5ANV A;  3A6U A;  2YVP A;  2ICK A;  4MPO A;  2B2K A;  1XSA A;  3MDI A;  2QKM B;  1MK1 A;  5GHM A;  1MUT A;  3GWY A;  3FCM A;  2PQV A;  5CFJ A;  1VC8 A;  2AZW A;  4K6E A;  3DUP A;  3KVH A;  5ANT A;  2FKB A;  2DHO A;  1Q54 A;  3OGA A;  3QSJ A;  3EF5 A;  3U53 A;  3N77 A;  3F13 A;  2A8R A;  1PPV A;  1VHG A;  3X0P A;  1PPX A;  2CL3 A;  3O6Z A;  3HHJ A;  1MQE A;  4JZT A;  3SON A;  3GZ5 A;  3ZR0 A;  1U20 A;  2DSB A;  3A6T A;  4N1U A;  5C7T A;  4YPH A;  1VK6 A;  5GHI A;  2B06 A;  1VC9 A;  2Q9P A;  2W4E A;  2A8P A;  4KTB A;  1GA7 A;  3CNG A;  1PVF A;  4ILQ A;  5ANW A;  4HVY A;  1XSC A;  2VNP A;  1V8I A;  1V8M A;  3I7V A;  2I6K A;  1X83 A;  1HZT A;  3GRN A;  4NFX A;  1HX3 A;  3BM4 A;  1V8R A;  2GT2 A;  5IW4 A;  3O69 A;  1G9Q A;  4J7H A;  3N9U A;  5GHO A;  1G0S A;  3HYQ A;  4C9W A;  2ICJ A;  3X0S A;  4JZV A;  3GZ8 A;  4KG4 A;  5DD4 A;  2YVO A;  1PUQ A;  2DUK A;  4V14 A;  3L85 A;  5GHN A;  4S2W A;  5GHQ A;  1XSB A;  3EXQ A;  5C7Q A;  2A8Q A;  5FSN A;  2O1C A;  4JZU A;  2XSQ A;  3P5T A;  5BS6 A;  2A8S A;  4ZG0 A;  1TUM A;  1K2E A;  1PUS A;  1NQY A;  1RRQ A;  1X84 A;  3X0L A;  3MDG A;  1V8U A;  2VNQ A;  3MCF A;  1PPW A;  4IJX A;  3WHW A;  1V8V A;  1VIU A;  3GZ6 A;  5GHJ A;  1F3Y A;  2GT4 A;  5HZX A;  3X0Q A;  3J7Y e;  3ZR1 A;  3ID9 A;  1NQZ A;  5BON A;  5DEQ A;  3ACA A;  2J8Q A;  5GHP A;  3DKU A;  2FML A;  1MP2 A;  2I8U A;  2YVM A;  1Q33 A;  5FSI A;  4S2Y A;  3FJY A;  1V8L A;  1VHZ A;  1NFZ A;  2KDV A;  5I8U A;  5ISY A;  2QJT A;  3COU A;  2YYH A;  5FSK A;  3X0N A;  1MR2 A;  2O5F A;  2B0V A;  1V8W A;  4JZS A;  5LPG A;  2I8T A;  2CZR A;  2PNY A;  4S2X A;  3RH7 A;  3X0O A;  4YPR A;  1SOI A;  1QVJ A;  1VCD A;  4HFQ A;  2G74 A;  1Q27 A;  2DSC A;  3FFU A;  5ANS A;  1R67 A;  5C8L A;  3SMD A;  5IW5 A;  1VRL A;  1PUN A;  1SJY A;  1IRY A;  2KDW A;  2DSD A;  3Q91 A;  3GG6 A;  2O5W A;  3X0I A;  1KTG A;  3R03 A;  1JKN A;  2YVN A;  1SU2 A;  2GB5 A;  4S2V A;  3H95 A;  3SHD A;  1KT9 A;  2A8T A; 
#chains in the Genus database with same CATH homology
 3BHO A;  4ICK A;  3E57 A;  4J7G A;  3P6Y A;  2JVB A;  3O61 A;  1V8Y A;  5FSL A;  4YOQ A;  3Q2S A;  1I9A A;  1NFS A;  3FSP A;  4KYX A;  1V8T A;  3X0R A;  1VIQ A;  1V8S A;  1KHZ A;  2RRK A;  3I7U A;  3EEU A;  5FSM A;  3X0K A;  1MQW A;  2G73 A;  3O52 A;  5ANU A;  1OW2 A;  2R5W A;  3MGM A;  3Q4I A;  3AC9 A;  3EES A;  2FVV A;  3A6V A;  5DPK A;  3G0Q A;  3X0J A;  3Q1P A;  4NFW A;  1RRS A;  3FK9 A;  3A6S A;  4N1T A;  5DDG A;  3O8S A;  3Q2T A;  1JRK A;  3BAP A;  3X0M A;  1K26 A;  2A6T A;  2QJO A;  4KG3 A;  5FSO A;  3Q93 A;  3I9X A;  4C9X A;  4DYW A;  5CFI A;  1V8N A;  1RYA A;  3F6A A;  1X51 A;  1SZ3 A;  5ANV A;  3A6U A;  2YVP A;  2ICK A;  4MPO A;  2B2K A;  1XSA A;  3MDI A;  2QKM B;  1MK1 A;  5GHM A;  1MUT A;  3GWY A;  3FCM A;  2PQV A;  5CFJ A;  1VC8 A;  2AZW A;  4K6E A;  3DUP A;  3KVH A;  5ANT A;  2FKB A;  2DHO A;  1Q54 A;  3OGA A;  3QSJ A;  3EF5 A;  3U53 A;  3N77 A;  3F13 A;  2A8R A;  1PPV A;  1VHG A;  3X0P A;  1PPX A;  2CL3 A;  3O6Z A;  3HHJ A;  1MQE A;  4JZT A;  3SON A;  3GZ5 A;  3ZR0 A;  1U20 A;  2DSB A;  3A6T A;  4N1U A;  5C7T A;  4YPH A;  1VK6 A;  5GHI A;  2B06 A;  1VC9 A;  2Q9P A;  2W4E A;  2A8P A;  4KTB A;  1GA7 A;  3CNG A;  1PVF A;  4ILQ A;  5ANW A;  4HVY A;  1XSC A;  2VNP A;  1V8I A;  1V8M A;  3I7V A;  2I6K A;  1X83 A;  1HZT A;  3GRN A;  4NFX A;  1HX3 A;  3BM4 A;  1V8R A;  2GT2 A;  5IW4 A;  3O69 A;  1G9Q A;  4J7H A;  3N9U A;  5GHO A;  1G0S A;  3HYQ A;  4C9W A;  2ICJ A;  3X0S A;  4JZV A;  3GZ8 A;  4KG4 A;  5DD4 A;  2YVO A;  1PUQ A;  2DUK A;  4V14 A;  3L85 A;  5GHN A;  4S2W A;  5GHQ A;  1XSB A;  3EXQ A;  5C7Q A;  2A8Q A;  5FSN A;  2O1C A;  4JZU A;  2XSQ A;  3P5T A;  5BS6 A;  2A8S A;  4ZG0 A;  1TUM A;  1K2E A;  1PUS A;  1NQY A;  1RRQ A;  1X84 A;  3X0L A;  3MDG A;  1V8U A;  2VNQ A;  3MCF A;  1PPW A;  4IJX A;  3WHW A;  1V8V A;  1VIU A;  3GZ6 A;  5GHJ A;  1F3Y A;  2GT4 A;  5HZX A;  3X0Q A;  3J7Y e;  3ZR1 A;  3ID9 A;  1NQZ A;  5BON A;  5DEQ A;  3ACA A;  2J8Q A;  5GHP A;  3DKU A;  2FML A;  1MP2 A;  2I8U A;  2YVM A;  1Q33 A;  5FSI A;  4S2Y A;  3FJY A;  1V8L A;  1VHZ A;  1NFZ A;  2KDV A;  5I8U A;  5ISY A;  2QJT A;  3COU A;  2YYH A;  5FSK A;  3X0N A;  1MR2 A;  2O5F A;  2B0V A;  1V8W A;  4JZS A;  5LPG A;  2I8T A;  2CZR A;  2PNY A;  4S2X A;  3RH7 A;  3X0O A;  4YPR A;  1SOI A;  1QVJ A;  1VCD A;  4HFQ A;  2G74 A;  1Q27 A;  2DSC A;  3FFU A;  5ANS A;  1R67 A;  5C8L A;  3SMD A;  5IW5 A;  1VRL A;  1PUN A;  1SJY A;  1IRY A;  2KDW A;  2DSD A;  3Q91 A;  3GG6 A;  2O5W A;  3X0I A;  1KTG A;  3R03 A;  1JKN A;  2YVN A;  1SU2 A;  2GB5 A;  4S2V A;  3H95 A;  3SHD A;  1KT9 A;  2A8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...