1PUNA

Solution structure of the mutt pyrophosphohydrolase complexed with mg(2+) and 8-oxo-dgmp, a tightly-bound product
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
129
structure length
129
Chain Sequence
MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Mutator mutT protein
publication title Solution structure and NH exchange studies of the MutT pyrophosphohydrolase complexed with Mg(2+) and 8-oxo-dGMP, a tightly bound product.
pubmed doi rcsb
source organism Escherichia coli
total genus 18
structure length 129
sequence length 129
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2003-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1punA00
3P5TA 2G74A 2O5WA 2W4EA 5FSNA 4S2YA 3GZ6A 1VHGA 4S2VA 1SOIA 3COUA 2J8QA 3HHJA 2JVBA 3Q4IA 1VC8A 5C7TA 5FSOA 1HZTA 3HYQA 1MP2A 5FSLA 3KVHA 2GT2A 1V8VA 3GZ5A 3SHDA 3EXQA 1V8LA 4JZSA 1NQZA 5C7QA 2QJOA 1QVJA 1VC9A 2FVVA 3Q91A 1PPXA 3FJYA 4IJXA 5ANSA 1PPWA 3BM4A 2GT4A 3EESA 3Q1PA 5ISYA 1IRYA 3O52A 5FSIA 3X0KA 4YOQA 4JZVA 3X0RA 1RRSA 1V8IA 1V8SA 5IW5A 2G73A 2B06A 1KHZA 3MGMA 3MDGA 3E57A 2DHOA 2ICJA 2YYHA 5GHOA 3EEUA 1VRLA 1XSCA 1NFSA 2A6TA 5IW4A 1RRQA 1R67A 2PQVA 3F13A 3X0QA 3FFUA 3MDIA 3X0PA 3QSJA 5CFIA 5C8LA 5GHMA 1V8YA 2O1CA 2A8RA 2O5FA 3A6VA 5GHQA 5ANTA 2I6KA 3X0LA 1JRKA 3O8SA 4DYWA 1PUNA 5DD4A 4JZUA 2A8TA 4KG4A 1VCDA 1VK6A 1X51A 5DEQA 5FSKA 5GHJA 3SMDA 4N1UA 2XSQA 3X0NA 4YPHA 1NFZA 5DPKA 3CNGA 3Q93A 5ANUA 2R5WA 5FSMA 3FSPA 3A6SA 4KYXA 1VHZA 1KTGA 3RH7A 3J7Ye 3X0OA 2PNYA 4JZTA 3X0SA 2DSBA 2FKBA 1V8NA 1MUTA 2YVMA 3A6UA 5GHNA 3U53A 2I8TA 1JKNA 5CFJA 3G0QA 3R03A 4S2XA 1MK1A 3DUPA 2YVOA 3I7VA 3ZR0A 2DSCA 3FCMA 4HFQA 3N9UA 1V8UA 1V8WA 1XSAA 3AC9A 2YVPA 3F6AA 3I7UA 3O6ZA 3WHWA 1VIUA 3H95A 1RYAA 3L85A 2B2KA 1VIQA 5GHPA 2GB5A 2KDWA 3ZR1A 3P6YA 2DUKA 1PVFA 3BHOA 3X0IA 3GRNA 3MCFA 4N1TA 3X0MA 4YPRA 4KG3A 2A8SA 1K26A 3GG6A 1OW2A 1SZ3A 1GA7A 1SU2A 1X84A 1I9AA 1TUMA 2FMLA 2I8UA 3ACAA 4MPOA 3ID9A 1F3YA 3O69A 1NQYA 1SJYA 4ICKA 1KT9A 3I9XA 2VNQA 1MR2A 3Q2SA 2RRKA 4C9WA 2KDVA 2QJTA 1PUSA 4NFXA 1K2EA 1Q33A 1PPVA 3SONA 3A6TA 5I8UA 5ANWA 1G0SA 1MQEA 2A8PA 3BAPA 4S2WA 2QKMB 5DDGA 2YVNA 2ICKA 3FK9A 2VNPA 3GZ8A 4ILQA 1V8RA 1V8MA 4C9XA 2Q9PA 1HX3A 1V8TA 1Q27A 1PUQA 4V14A 1U20A 2DSDA 5GHIA 4ZG0A 5BONA 4KTBA 3X0JA 1G9QA 3GWYA 1MQWA 4HVYA 3DKUA 5BS6A 1X83A 2B0VA 3O61A 4K6EA 1Q54A 3N77A 3Q2TA 5ANVA 5LPGA 5HZXA 1XSBA 4NFWA 2CL3A 3EF5A 2AZWA 3OGAA 2A8QA
chains in the Genus database with same CATH superfamily
3P5TA 2G74A 2O5WA 2W4EA 5FSNA 4S2YA 3GZ6A 1VHGA 4S2VA 1SOIA 3COUA 2J8QA 3HHJA 2JVBA 3Q4IA 1VC8A 5C7TA 5FSOA 1HZTA 3HYQA 1MP2A 5FSLA 3KVHA 2GT2A 1V8VA 3GZ5A 3SHDA 3EXQA 1V8LA 4JZSA 1NQZA 5C7QA 2QJOA 1QVJA 1VC9A 2FVVA 3Q91A 1PPXA 3FJYA 4IJXA 5ANSA 1PPWA 3BM4A 2GT4A 3EESA 3Q1PA 5ISYA 1IRYA 3O52A 5FSIA 3X0KA 4YOQA 4JZVA 3X0RA 1RRSA 1V8IA 1V8SA 5IW5A 2G73A 2B06A 1KHZA 3MGMA 3MDGA 3E57A 2DHOA 2ICJA 2YYHA 5GHOA 3EEUA 1VRLA 1XSCA 1NFSA 2A6TA 5IW4A 1RRQA 1R67A 2PQVA 3F13A 3X0QA 3FFUA 3MDIA 3X0PA 3QSJA 5CFIA 5C8LA 5GHMA 1V8YA 2O1CA 2A8RA 2O5FA 3A6VA 5GHQA 5ANTA 2I6KA 3X0LA 1JRKA 3O8SA 4DYWA 1PUNA 5DD4A 4JZUA 2A8TA 4KG4A 1VCDA 1VK6A 1X51A 5DEQA 5FSKA 5GHJA 3SMDA 4N1UA 2XSQA 3X0NA 4YPHA 1NFZA 5DPKA 3CNGA 3Q93A 5ANUA 2R5WA 5FSMA 3FSPA 3A6SA 4KYXA 1VHZA 1KTGA 3RH7A 3J7Ye 3X0OA 2PNYA 4JZTA 3X0SA 2DSBA 2FKBA 1V8NA 1MUTA 2YVMA 3A6UA 5GHNA 3U53A 2I8TA 1JKNA 5CFJA 3G0QA 3R03A 4S2XA 1MK1A 3DUPA 2YVOA 3I7VA 3ZR0A 2DSCA 3FCMA 4HFQA 4J7GA 3N9UA 1V8UA 1V8WA 1XSAA 3AC9A 2YVPA 3F6AA 3I7UA 3O6ZA 3WHWA 1VIUA 3H95A 1RYAA 3L85A 2B2KA 1VIQA 5GHPA 2GB5A 2KDWA 3ZR1A 3P6YA 2DUKA 1PVFA 3BHOA 3X0IA 3GRNA 3MCFA 4N1TA 4J7HA 3X0MA 4KG3A 2A8SA 1K26A 3GG6A 1OW2A 1SZ3A 1GA7A 1SU2A 1X84A 1I9AA 1TUMA 2FMLA 2I8UA 3ACAA 4MPOA 3ID9A 1F3YA 3O69A 1NQYA 1SJYA 4ICKA 1KT9A 3I9XA 2VNQA 1MR2A 3Q2SA 2RRKA 4C9WA 2KDVA 2QJTA 1PUSA 4NFXA 1K2EA 1Q33A 1PPVA 2CZRA 3A6TA 3SONA 5I8UA 5ANWA 1G0SA 1MQEA 2A8PA 3BAPA 4S2WA 2QKMB 5DDGA 2YVNA 4YPRA 2ICKA 3FK9A 2VNPA 3GZ8A 4ILQA 1V8RA 1V8MA 4C9XA 2Q9PA 1HX3A 1V8TA 1Q27A 1PUQA 4V14A 1U20A 2DSDA 5GHIA 4ZG0A 5BONA 4KTBA 3X0JA 1G9QA 3GWYA 1MQWA 4HVYA 3DKUA 5BS6A 1X83A 2B0VA 3O61A 4K6EA 1Q54A 3N77A 3Q2TA 5ANVA 5LPGA 5HZXA 1XSBA 4NFWA 2CL3A 3EF5A 2AZWA 3OGAA 2A8QA
chains in the Genus database with same CATH topology
3P5TA 2G74A 2O5WA 2W4EA 5FSNA 4S2YA 3GZ6A 1VHGA 4S2VA 1SOIA 3COUA 2J8QA 3HHJA 2JVBA 3Q4IA 1VC8A 5C7TA 5FSOA 1HZTA 3HYQA 1MP2A 5FSLA 3KVHA 2GT2A 1V8VA 3GZ5A 3SHDA 3EXQA 1V8LA 4JZSA 1NQZA 5C7QA 2QJOA 1QVJA 1VC9A 2FVVA 3Q91A 1PPXA 3FJYA 4IJXA 5ANSA 1PPWA 3BM4A 2GT4A 3EESA 3Q1PA 5ISYA 1IRYA 3O52A 5FSIA 3X0KA 4YOQA 4JZVA 3X0RA 1RRSA 1V8IA 1V8SA 5IW5A 2G73A 2B06A 1KHZA 3MGMA 3MDGA 3E57A 2DHOA 2ICJA 2YYHA 5GHOA 3EEUA 1VRLA 1XSCA 1NFSA 2A6TA 5IW4A 1RRQA 1R67A 2PQVA 3F13A 3X0QA 3FFUA 3MDIA 3X0PA 3QSJA 5CFIA 5C8LA 5GHMA 1V8YA 2O1CA 2A8RA 2O5FA 3A6VA 5GHQA 5ANTA 2I6KA 3X0LA 1JRKA 3O8SA 4DYWA 1PUNA 5DD4A 4JZUA 2A8TA 4KG4A 1VCDA 1VK6A 1X51A 5DEQA 5FSKA 5GHJA 3SMDA 4N1UA 2XSQA 3X0NA 4YPHA 1NFZA 5DPKA 3CNGA 3Q93A 5ANUA 2R5WA 5FSMA 3FSPA 3A6SA 4KYXA 1VHZA 1KTGA 3RH7A 3J7Ye 3X0OA 2PNYA 4JZTA 3X0SA 2DSBA 2FKBA 1V8NA 1MUTA 2YVMA 3A6UA 5GHNA 3U53A 2I8TA 1JKNA 5CFJA 3G0QA 3R03A 4S2XA 1MK1A 3DUPA 2YVOA 3I7VA 3ZR0A 2DSCA 3FCMA 4HFQA 4J7GA 3N9UA 1V8UA 1V8WA 1XSAA 3AC9A 2YVPA 3F6AA 3I7UA 3O6ZA 3WHWA 1VIUA 3H95A 1RYAA 3L85A 2B2KA 1VIQA 5GHPA 2GB5A 2KDWA 3ZR1A 3P6YA 2DUKA 1PVFA 3BHOA 3X0IA 3GRNA 3MCFA 4N1TA 4J7HA 3X0MA 4KG3A 2A8SA 1K26A 3GG6A 1OW2A 1SZ3A 1GA7A 1SU2A 1X84A 1I9AA 1TUMA 2FMLA 2I8UA 3ACAA 4MPOA 3ID9A 1F3YA 3O69A 1NQYA 1SJYA 4ICKA 1KT9A 3I9XA 2VNQA 1MR2A 3Q2SA 2RRKA 4C9WA 2KDVA 2QJTA 1PUSA 4NFXA 1K2EA 1Q33A 1PPVA 2CZRA 3A6TA 3SONA 5I8UA 5ANWA 1G0SA 1MQEA 2A8PA 3BAPA 4S2WA 2QKMB 5DDGA 2YVNA 4YPRA 2ICKA 3FK9A 2VNPA 3GZ8A 4ILQA 1V8RA 1V8MA 4C9XA 2Q9PA 1HX3A 1V8TA 1Q27A 1PUQA 4V14A 1U20A 2DSDA 5GHIA 4ZG0A 5BONA 4KTBA 3X0JA 1G9QA 3GWYA 1MQWA 4HVYA 3DKUA 5BS6A 1X83A 2B0VA 3O61A 4K6EA 1Q54A 3N77A 3Q2TA 5ANVA 5LPGA 5HZXA 1XSBA 4NFWA 2CL3A 3EF5A 2AZWA 3OGAA 2A8QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P5T A;  2G74 A;  2O5W A;  2W4E A;  5FSN A;  4S2Y A;  3GZ6 A;  1VHG A;  4S2V A;  1SOI A;  3COU A;  2J8Q A;  3HHJ A;  2JVB A;  3Q4I A;  1VC8 A;  5C7T A;  5FSO A;  1HZT A;  3HYQ A;  1MP2 A;  5FSL A;  3KVH A;  2GT2 A;  1V8V A;  3GZ5 A;  3SHD A;  3EXQ A;  1V8L A;  4JZS A;  1NQZ A;  5C7Q A;  2QJO A;  1QVJ A;  1VC9 A;  2FVV A;  3Q91 A;  1PPX A;  3FJY A;  4IJX A;  5ANS A;  1PPW A;  3BM4 A;  2GT4 A;  3EES A;  3Q1P A;  5ISY A;  1IRY A;  3O52 A;  5FSI A;  3X0K A;  4YOQ A;  4JZV A;  3X0R A;  1RRS A;  1V8I A;  1V8S A;  5IW5 A;  2G73 A;  2B06 A;  1KHZ A;  3MGM A;  3MDG A;  3E57 A;  2DHO A;  2ICJ A;  2YYH A;  5GHO A;  3EEU A;  1VRL A;  1XSC A;  1NFS A;  2A6T A;  5IW4 A;  1RRQ A;  1R67 A;  2PQV A;  3F13 A;  3X0Q A;  3FFU A;  3MDI A;  3X0P A;  3QSJ A;  5CFI A;  5C8L A;  5GHM A;  1V8Y A;  2O1C A;  2A8R A;  2O5F A;  3A6V A;  5GHQ A;  5ANT A;  2I6K A;  3X0L A;  1JRK A;  3O8S A;  4DYW A;  1PUN A;  5DD4 A;  4JZU A;  2A8T A;  4KG4 A;  1VCD A;  1VK6 A;  1X51 A;  5DEQ A;  5FSK A;  5GHJ A;  3SMD A;  4N1U A;  2XSQ A;  3X0N A;  4YPH A;  1NFZ A;  5DPK A;  3CNG A;  3Q93 A;  5ANU A;  2R5W A;  5FSM A;  3FSP A;  3A6S A;  4KYX A;  1VHZ A;  1KTG A;  3RH7 A;  3J7Y e;  3X0O A;  2PNY A;  4JZT A;  3X0S A;  2DSB A;  2FKB A;  1V8N A;  1MUT A;  2YVM A;  3A6U A;  5GHN A;  3U53 A;  2I8T A;  1JKN A;  5CFJ A;  3G0Q A;  3R03 A;  4S2X A;  1MK1 A;  3DUP A;  2YVO A;  3I7V A;  3ZR0 A;  2DSC A;  3FCM A;  4HFQ A;  3N9U A;  1V8U A;  1V8W A;  1XSA A;  3AC9 A;  2YVP A;  3F6A A;  3I7U A;  3O6Z A;  3WHW A;  1VIU A;  3H95 A;  1RYA A;  3L85 A;  2B2K A;  1VIQ A;  5GHP A;  2GB5 A;  2KDW A;  3ZR1 A;  3P6Y A;  2DUK A;  1PVF A;  3BHO A;  3X0I A;  3GRN A;  3MCF A;  4N1T A;  3X0M A;  4YPR A;  4KG3 A;  2A8S A;  1K26 A;  3GG6 A;  1OW2 A;  1SZ3 A;  1GA7 A;  1SU2 A;  1X84 A;  1I9A A;  1TUM A;  2FML A;  2I8U A;  3ACA A;  4MPO A;  3ID9 A;  1F3Y A;  3O69 A;  1NQY A;  1SJY A;  4ICK A;  1KT9 A;  3I9X A;  2VNQ A;  1MR2 A;  3Q2S A;  2RRK A;  4C9W A;  2KDV A;  2QJT A;  1PUS A;  4NFX A;  1K2E A;  1Q33 A;  1PPV A;  3SON A;  3A6T A;  5I8U A;  5ANW A;  1G0S A;  1MQE A;  2A8P A;  3BAP A;  4S2W A;  2QKM B;  5DDG A;  2YVN A;  2ICK A;  3FK9 A;  2VNP A;  3GZ8 A;  4ILQ A;  1V8R A;  1V8M A;  4C9X A;  2Q9P A;  1HX3 A;  1V8T A;  1Q27 A;  1PUQ A;  4V14 A;  1U20 A;  2DSD A;  5GHI A;  4ZG0 A;  5BON A;  4KTB A;  3X0J A;  1G9Q A;  3GWY A;  1MQW A;  4HVY A;  3DKU A;  5BS6 A;  1X83 A;  2B0V A;  3O61 A;  4K6E A;  1Q54 A;  3N77 A;  3Q2T A;  5ANV A;  5LPG A;  5HZX A;  1XSB A;  4NFW A;  2CL3 A;  3EF5 A;  2AZW A;  3OGA A;  2A8Q A; 
#chains in the Genus database with same CATH topology
 3P5T A;  2G74 A;  2O5W A;  2W4E A;  5FSN A;  4S2Y A;  3GZ6 A;  1VHG A;  4S2V A;  1SOI A;  3COU A;  2J8Q A;  3HHJ A;  2JVB A;  3Q4I A;  1VC8 A;  5C7T A;  5FSO A;  1HZT A;  3HYQ A;  1MP2 A;  5FSL A;  3KVH A;  2GT2 A;  1V8V A;  3GZ5 A;  3SHD A;  3EXQ A;  1V8L A;  4JZS A;  1NQZ A;  5C7Q A;  2QJO A;  1QVJ A;  1VC9 A;  2FVV A;  3Q91 A;  1PPX A;  3FJY A;  4IJX A;  5ANS A;  1PPW A;  3BM4 A;  2GT4 A;  3EES A;  3Q1P A;  5ISY A;  1IRY A;  3O52 A;  5FSI A;  3X0K A;  4YOQ A;  4JZV A;  3X0R A;  1RRS A;  1V8I A;  1V8S A;  5IW5 A;  2G73 A;  2B06 A;  1KHZ A;  3MGM A;  3MDG A;  3E57 A;  2DHO A;  2ICJ A;  2YYH A;  5GHO A;  3EEU A;  1VRL A;  1XSC A;  1NFS A;  2A6T A;  5IW4 A;  1RRQ A;  1R67 A;  2PQV A;  3F13 A;  3X0Q A;  3FFU A;  3MDI A;  3X0P A;  3QSJ A;  5CFI A;  5C8L A;  5GHM A;  1V8Y A;  2O1C A;  2A8R A;  2O5F A;  3A6V A;  5GHQ A;  5ANT A;  2I6K A;  3X0L A;  1JRK A;  3O8S A;  4DYW A;  1PUN A;  5DD4 A;  4JZU A;  2A8T A;  4KG4 A;  1VCD A;  1VK6 A;  1X51 A;  5DEQ A;  5FSK A;  5GHJ A;  3SMD A;  4N1U A;  2XSQ A;  3X0N A;  4YPH A;  1NFZ A;  5DPK A;  3CNG A;  3Q93 A;  5ANU A;  2R5W A;  5FSM A;  3FSP A;  3A6S A;  4KYX A;  1VHZ A;  1KTG A;  3RH7 A;  3J7Y e;  3X0O A;  2PNY A;  4JZT A;  3X0S A;  2DSB A;  2FKB A;  1V8N A;  1MUT A;  2YVM A;  3A6U A;  5GHN A;  3U53 A;  2I8T A;  1JKN A;  5CFJ A;  3G0Q A;  3R03 A;  4S2X A;  1MK1 A;  3DUP A;  2YVO A;  3I7V A;  3ZR0 A;  2DSC A;  3FCM A;  4HFQ A;  4J7G A;  3N9U A;  1V8U A;  1V8W A;  1XSA A;  3AC9 A;  2YVP A;  3F6A A;  3I7U A;  3O6Z A;  3WHW A;  1VIU A;  3H95 A;  1RYA A;  3L85 A;  2B2K A;  1VIQ A;  5GHP A;  2GB5 A;  2KDW A;  3ZR1 A;  3P6Y A;  2DUK A;  1PVF A;  3BHO A;  3X0I A;  3GRN A;  3MCF A;  4N1T A;  4J7H A;  3X0M A;  4KG3 A;  2A8S A;  1K26 A;  3GG6 A;  1OW2 A;  1SZ3 A;  1GA7 A;  1SU2 A;  1X84 A;  1I9A A;  1TUM A;  2FML A;  2I8U A;  3ACA A;  4MPO A;  3ID9 A;  1F3Y A;  3O69 A;  1NQY A;  1SJY A;  4ICK A;  1KT9 A;  3I9X A;  2VNQ A;  1MR2 A;  3Q2S A;  2RRK A;  4C9W A;  2KDV A;  2QJT A;  1PUS A;  4NFX A;  1K2E A;  1Q33 A;  1PPV A;  2CZR A;  3A6T A;  3SON A;  5I8U A;  5ANW A;  1G0S A;  1MQE A;  2A8P A;  3BAP A;  4S2W A;  2QKM B;  5DDG A;  2YVN A;  4YPR A;  2ICK A;  3FK9 A;  2VNP A;  3GZ8 A;  4ILQ A;  1V8R A;  1V8M A;  4C9X A;  2Q9P A;  1HX3 A;  1V8T A;  1Q27 A;  1PUQ A;  4V14 A;  1U20 A;  2DSD A;  5GHI A;  4ZG0 A;  5BON A;  4KTB A;  3X0J A;  1G9Q A;  3GWY A;  1MQW A;  4HVY A;  3DKU A;  5BS6 A;  1X83 A;  2B0V A;  3O61 A;  4K6E A;  1Q54 A;  3N77 A;  3Q2T A;  5ANV A;  5LPG A;  5HZX A;  1XSB A;  4NFW A;  2CL3 A;  3EF5 A;  2AZW A;  3OGA A;  2A8Q A; 
#chains in the Genus database with same CATH homology
 3P5T A;  2G74 A;  2O5W A;  2W4E A;  5FSN A;  4S2Y A;  3GZ6 A;  1VHG A;  4S2V A;  1SOI A;  3COU A;  2J8Q A;  3HHJ A;  2JVB A;  3Q4I A;  1VC8 A;  5C7T A;  5FSO A;  1HZT A;  3HYQ A;  1MP2 A;  5FSL A;  3KVH A;  2GT2 A;  1V8V A;  3GZ5 A;  3SHD A;  3EXQ A;  1V8L A;  4JZS A;  1NQZ A;  5C7Q A;  2QJO A;  1QVJ A;  1VC9 A;  2FVV A;  3Q91 A;  1PPX A;  3FJY A;  4IJX A;  5ANS A;  1PPW A;  3BM4 A;  2GT4 A;  3EES A;  3Q1P A;  5ISY A;  1IRY A;  3O52 A;  5FSI A;  3X0K A;  4YOQ A;  4JZV A;  3X0R A;  1RRS A;  1V8I A;  1V8S A;  5IW5 A;  2G73 A;  2B06 A;  1KHZ A;  3MGM A;  3MDG A;  3E57 A;  2DHO A;  2ICJ A;  2YYH A;  5GHO A;  3EEU A;  1VRL A;  1XSC A;  1NFS A;  2A6T A;  5IW4 A;  1RRQ A;  1R67 A;  2PQV A;  3F13 A;  3X0Q A;  3FFU A;  3MDI A;  3X0P A;  3QSJ A;  5CFI A;  5C8L A;  5GHM A;  1V8Y A;  2O1C A;  2A8R A;  2O5F A;  3A6V A;  5GHQ A;  5ANT A;  2I6K A;  3X0L A;  1JRK A;  3O8S A;  4DYW A;  1PUN A;  5DD4 A;  4JZU A;  2A8T A;  4KG4 A;  1VCD A;  1VK6 A;  1X51 A;  5DEQ A;  5FSK A;  5GHJ A;  3SMD A;  4N1U A;  2XSQ A;  3X0N A;  4YPH A;  1NFZ A;  5DPK A;  3CNG A;  3Q93 A;  5ANU A;  2R5W A;  5FSM A;  3FSP A;  3A6S A;  4KYX A;  1VHZ A;  1KTG A;  3RH7 A;  3J7Y e;  3X0O A;  2PNY A;  4JZT A;  3X0S A;  2DSB A;  2FKB A;  1V8N A;  1MUT A;  2YVM A;  3A6U A;  5GHN A;  3U53 A;  2I8T A;  1JKN A;  5CFJ A;  3G0Q A;  3R03 A;  4S2X A;  1MK1 A;  3DUP A;  2YVO A;  3I7V A;  3ZR0 A;  2DSC A;  3FCM A;  4HFQ A;  4J7G A;  3N9U A;  1V8U A;  1V8W A;  1XSA A;  3AC9 A;  2YVP A;  3F6A A;  3I7U A;  3O6Z A;  3WHW A;  1VIU A;  3H95 A;  1RYA A;  3L85 A;  2B2K A;  1VIQ A;  5GHP A;  2GB5 A;  2KDW A;  3ZR1 A;  3P6Y A;  2DUK A;  1PVF A;  3BHO A;  3X0I A;  3GRN A;  3MCF A;  4N1T A;  4J7H A;  3X0M A;  4KG3 A;  2A8S A;  1K26 A;  3GG6 A;  1OW2 A;  1SZ3 A;  1GA7 A;  1SU2 A;  1X84 A;  1I9A A;  1TUM A;  2FML A;  2I8U A;  3ACA A;  4MPO A;  3ID9 A;  1F3Y A;  3O69 A;  1NQY A;  1SJY A;  4ICK A;  1KT9 A;  3I9X A;  2VNQ A;  1MR2 A;  3Q2S A;  2RRK A;  4C9W A;  2KDV A;  2QJT A;  1PUS A;  4NFX A;  1K2E A;  1Q33 A;  1PPV A;  2CZR A;  3A6T A;  3SON A;  5I8U A;  5ANW A;  1G0S A;  1MQE A;  2A8P A;  3BAP A;  4S2W A;  2QKM B;  5DDG A;  2YVN A;  4YPR A;  2ICK A;  3FK9 A;  2VNP A;  3GZ8 A;  4ILQ A;  1V8R A;  1V8M A;  4C9X A;  2Q9P A;  1HX3 A;  1V8T A;  1Q27 A;  1PUQ A;  4V14 A;  1U20 A;  2DSD A;  5GHI A;  4ZG0 A;  5BON A;  4KTB A;  3X0J A;  1G9Q A;  3GWY A;  1MQW A;  4HVY A;  3DKU A;  5BS6 A;  1X83 A;  2B0V A;  3O61 A;  4K6E A;  1Q54 A;  3N77 A;  3Q2T A;  5ANV A;  5LPG A;  5HZX A;  1XSB A;  4NFW A;  2CL3 A;  3EF5 A;  2AZW A;  3OGA A;  2A8Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...