2B06A

Crystal structure of the mutt/nudix family protein from streptococcus pneumoniae
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
155
structure length
150
Chain Sequence
MSRSQLTILTNICLIEDLETQRVVMQYRAWSGYAFPGGHVENDEAFAESVIREIYEETGLTIQNPQLVGIKNWPLDTGGRYIVICYKATEFSGTLQSSEEGEVSWVQKDQIPNLNLAYDMLPLMEMMEAPDKSEFFYPRRTEDDWEKKIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics/unknown function
molecule keywords MutT/nudix family protein
publication title The 1.4 A crystal structure of the MutT/nudix family protein from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
total genus 38
structure length 150
sequence length 155
ec nomenclature
pdb deposition date 2005-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2b06A00
3Q2TA 2QKMB 1NFSA 1X84A 1PUQA 3GWYA 3EEUA 4MPOA 1G0SA 1SJYA 2KDVA 4V14A 4JZUA 5GHOA 3X0NA 1NQZA 1NFZA 1V8YA 2CL3A 1RYAA 3DKUA 4KG3A 1SU2A 2R5WA 5ISYA 3OGAA 4C9XA 2A8QA 3O8SA 5C7TA 1VK6A 3F6AA 4N1UA 4ICKA 4N1TA 3X0IA 2GT2A 2W4EA 3P6YA 3I9XA 3FFUA 2A8PA 3FCMA 3MGMA 1V8RA 3ZR0A 5GHIA 2GT4A 3R03A 4KTBA 3HHJA 1X83A 5C8LA 5IW5A 1JKNA 5CFIA 4ILQA 1MK1A 4DYWA 2B06A 1OW2A 4ZG0A 3X0PA 3Q91A 1MQEA 3X0KA 3SHDA 3A6SA 3I7VA 3KVHA 3U53A 3Q4IA 1XSBA 1V8WA 3GZ8A 3DUPA 2DSCA 3MCFA 1SOIA 4HFQA 3EXQA 3X0RA 4C9WA 2I8TA 2PNYA 3GZ6A 4JZVA 5FSOA 1V8IA 4NFXA 2YVMA 3BM4A 4K6EA 1R67A 2KDWA 2FMLA 1V8TA 1PUSA 3X0MA 1VRLA 5FSLA 3GZ5A 5FSMA 3A6VA 5I8UA 3Q1PA 3ACAA 3GG6A 5ANTA 3FJYA 3X0LA 4YOQA 5IW4A 1V8LA 1XSAA 2XSQA 2I8UA 3SONA 3E57A 3FSPA 3WHWA 1PVFA 2B0VA 1XSCA 2RRKA 2G74A 2FVVA 3MDIA 1I9AA 2YVPA 4S2WA 1V8NA 2DSBA 3ID9A 5HZXA 3BHOA 5BONA 2ICJA 1VCDA 5DEQA 1V8SA 4KG4A 3O6ZA 3RH7A 3O69A 3HYQA 3QSJA 1Q33A 1KHZA 2A8RA 3CNGA 5FSIA 4IJXA 3L85A 2J8QA 4HVYA 1G9QA 1Q54A 2VNQA 1QVJA 2AZWA 2O5WA 4NFWA 5DPKA 3MDGA 1MQWA 1HX3A 1HZTA 3EF5A 5BS6A 1VIQA 1V8VA 2DSDA 2O5FA 3A6UA 3Q93A 5ANSA 2A8TA 3SMDA 1MR2A 2JVBA 3X0SA 2B2KA 1VHGA 2QJOA 1Q27A 2YVOA 1X51A 3G0QA 3N77A 5DDGA 2PQVA 1GA7A 3H95A 4JZTA 3X0QA 1VHZA 3A6TA 2FKBA 5C7QA 1KTGA 1K26A 3FK9A 1VC9A 4S2VA 2O1CA 1PPXA 3J7Ye 5GHPA 1JRKA 1VC8A 2DHOA 2VNPA 1F3YA 5GHJA 1KT9A 1V8UA 2YYHA 2A8SA 5CFJA 5ANUA 3AC9A 3BAPA 3X0JA 1MP2A 1SZ3A 3COUA 1K2EA 5GHMA 1IRYA 5FSKA 3P5TA 3O61A 2QJTA 3N9UA 5GHNA 1VIUA 4JZSA 4YPRA 4S2XA 3ZR1A 1PPVA 1MUTA 4YPHA 3GRNA 3I7UA 1RRQA 3O52A 2GB5A 4KYXA 5GHQA 3Q2SA 1PPWA 4S2YA 3F13A 5FSNA 1TUMA 1RRSA 5ANVA 2DUKA 5DD4A 1U20A 3X0OA 1PUNA 5LPGA 2Q9PA 2YVNA 5ANWA 3EESA 2G73A 2A6TA 2ICKA 1NQYA 1V8MA 2I6KA
chains in the Genus database with same CATH superfamily
3Q2TA 2QKMB 1NFSA 1X84A 1PUQA 3GWYA 3EEUA 4MPOA 1G0SA 2CZRA 1SJYA 2KDVA 4V14A 4JZUA 5GHOA 3X0NA 1NQZA 1NFZA 1V8YA 2CL3A 1RYAA 3DKUA 4KG3A 1SU2A 2R5WA 5ISYA 3OGAA 4C9XA 2A8QA 3O8SA 5C7TA 1VK6A 3F6AA 4N1UA 4ICKA 4N1TA 3X0IA 2GT2A 2W4EA 3P6YA 3I9XA 3FFUA 2A8PA 3FCMA 3MGMA 1V8RA 3ZR0A 5GHIA 2GT4A 3R03A 4KTBA 3HHJA 1X83A 5C8LA 5IW5A 1JKNA 5CFIA 4ILQA 1MK1A 4DYWA 2B06A 1OW2A 4ZG0A 3X0PA 3Q91A 1MQEA 3X0KA 3SHDA 3A6SA 3I7VA 3KVHA 3U53A 3Q4IA 1XSBA 1V8WA 3GZ8A 3DUPA 2DSCA 3MCFA 1SOIA 4HFQA 3EXQA 3X0RA 4C9WA 2I8TA 2PNYA 4J7GA 3GZ6A 5FSOA 4JZVA 1V8IA 4NFXA 2YVMA 3BM4A 4K6EA 1R67A 2KDWA 2FMLA 1V8TA 1PUSA 3X0MA 1VRLA 5FSLA 3GZ5A 5FSMA 3A6VA 5I8UA 3Q1PA 3ACAA 3GG6A 5ANTA 3FJYA 3X0LA 4YOQA 5IW4A 1V8LA 1XSAA 2XSQA 2I8UA 3SONA 3E57A 3FSPA 3WHWA 1PVFA 2B0VA 1XSCA 2RRKA 2G74A 2FVVA 3MDIA 1I9AA 2YVPA 4S2WA 1V8NA 2DSBA 3ID9A 5HZXA 3BHOA 5BONA 2ICJA 1VCDA 5DEQA 1V8SA 4J7HA 4KG4A 3O6ZA 3RH7A 3O69A 3HYQA 3QSJA 1Q33A 1KHZA 2A8RA 3CNGA 5FSIA 4IJXA 3L85A 2J8QA 4HVYA 1G9QA 1Q54A 2VNQA 1QVJA 2AZWA 2O5WA 4NFWA 5DPKA 3MDGA 1MQWA 1HX3A 1HZTA 3EF5A 5BS6A 1VIQA 1V8VA 2DSDA 2O5FA 3A6UA 3Q93A 5ANSA 2A8TA 3SMDA 1MR2A 2JVBA 3X0SA 2B2KA 1VHGA 2QJOA 1Q27A 2YVOA 1X51A 3G0QA 3N77A 5DDGA 2PQVA 1GA7A 3H95A 4JZTA 3X0QA 1VHZA 3A6TA 2FKBA 5C7QA 1KTGA 1K26A 3FK9A 1VC9A 4S2VA 2O1CA 1PPXA 3J7Ye 5GHPA 1JRKA 1VC8A 2DHOA 2VNPA 1F3YA 5GHJA 1KT9A 1V8UA 2YYHA 2A8SA 5CFJA 5ANUA 3AC9A 3BAPA 3X0JA 1MP2A 1SZ3A 3COUA 1K2EA 5GHMA 1IRYA 5FSKA 3P5TA 3O61A 2QJTA 3N9UA 5GHNA 1VIUA 4JZSA 4YPRA 4S2XA 3ZR1A 1PPVA 1MUTA 4YPHA 3GRNA 3I7UA 1RRQA 3O52A 2GB5A 4KYXA 5GHQA 3Q2SA 1PPWA 4S2YA 3F13A 5FSNA 1TUMA 1RRSA 5ANVA 2DUKA 5DD4A 1U20A 3X0OA 1PUNA 5LPGA 2Q9PA 2YVNA 5ANWA 3EESA 2G73A 2A6TA 2ICKA 1NQYA 1V8MA 2I6KA
chains in the Genus database with same CATH topology
3Q2TA 2QKMB 1NFSA 1X84A 1PUQA 3GWYA 3EEUA 4MPOA 1G0SA 2CZRA 1SJYA 2KDVA 4V14A 4JZUA 5GHOA 3X0NA 1NQZA 1NFZA 1V8YA 2CL3A 1RYAA 3DKUA 4KG3A 1SU2A 2R5WA 5ISYA 3OGAA 4C9XA 2A8QA 3O8SA 5C7TA 1VK6A 3F6AA 4N1UA 4ICKA 4N1TA 3X0IA 2GT2A 2W4EA 3P6YA 3I9XA 3FFUA 2A8PA 3FCMA 3MGMA 1V8RA 3ZR0A 5GHIA 2GT4A 3R03A 4KTBA 3HHJA 1X83A 5C8LA 5IW5A 1JKNA 5CFIA 4ILQA 1MK1A 4DYWA 2B06A 1OW2A 4ZG0A 3X0PA 3Q91A 1MQEA 3X0KA 3SHDA 3A6SA 3I7VA 3KVHA 3U53A 3Q4IA 1XSBA 1V8WA 3GZ8A 3DUPA 2DSCA 3MCFA 1SOIA 4HFQA 3EXQA 3X0RA 4C9WA 2I8TA 2PNYA 4J7GA 3GZ6A 5FSOA 4JZVA 1V8IA 4NFXA 2YVMA 3BM4A 4K6EA 1R67A 2KDWA 2FMLA 1V8TA 1PUSA 3X0MA 1VRLA 5FSLA 3GZ5A 5FSMA 3A6VA 5I8UA 3Q1PA 3ACAA 3GG6A 5ANTA 3FJYA 3X0LA 4YOQA 5IW4A 1V8LA 1XSAA 2XSQA 2I8UA 3SONA 3E57A 3FSPA 3WHWA 1PVFA 2B0VA 1XSCA 2RRKA 2G74A 2FVVA 3MDIA 1I9AA 2YVPA 4S2WA 1V8NA 2DSBA 3ID9A 5HZXA 3BHOA 5BONA 2ICJA 1VCDA 5DEQA 1V8SA 4J7HA 4KG4A 3O6ZA 3RH7A 3O69A 3HYQA 3QSJA 1Q33A 1KHZA 2A8RA 3CNGA 5FSIA 4IJXA 3L85A 2J8QA 4HVYA 1G9QA 1Q54A 2VNQA 1QVJA 2AZWA 2O5WA 4NFWA 5DPKA 3MDGA 1MQWA 1HX3A 1HZTA 3EF5A 5BS6A 1VIQA 1V8VA 2DSDA 2O5FA 3A6UA 3Q93A 5ANSA 2A8TA 3SMDA 1MR2A 2JVBA 3X0SA 2B2KA 1VHGA 2QJOA 1Q27A 2YVOA 1X51A 3G0QA 3N77A 5DDGA 2PQVA 1GA7A 3H95A 4JZTA 3X0QA 1VHZA 3A6TA 2FKBA 5C7QA 1KTGA 1K26A 3FK9A 1VC9A 4S2VA 2O1CA 1PPXA 3J7Ye 5GHPA 1JRKA 1VC8A 2DHOA 2VNPA 1F3YA 5GHJA 1KT9A 1V8UA 2YYHA 2A8SA 5CFJA 5ANUA 3AC9A 3BAPA 3X0JA 1MP2A 1SZ3A 3COUA 1K2EA 5GHMA 1IRYA 5FSKA 3P5TA 3O61A 2QJTA 3N9UA 5GHNA 1VIUA 4JZSA 4YPRA 4S2XA 3ZR1A 1PPVA 1MUTA 4YPHA 3GRNA 3I7UA 1RRQA 3O52A 2GB5A 4KYXA 5GHQA 3Q2SA 1PPWA 4S2YA 3F13A 5FSNA 1TUMA 1RRSA 5ANVA 2DUKA 5DD4A 1U20A 3X0OA 1PUNA 5LPGA 2Q9PA 2YVNA 5ANWA 3EESA 2G73A 2A6TA 2ICKA 1NQYA 1V8MA 2I6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q2T A;  2QKM B;  1NFS A;  1X84 A;  1PUQ A;  3GWY A;  3EEU A;  4MPO A;  1G0S A;  1SJY A;  2KDV A;  4V14 A;  4JZU A;  5GHO A;  3X0N A;  1NQZ A;  1NFZ A;  1V8Y A;  2CL3 A;  1RYA A;  3DKU A;  4KG3 A;  1SU2 A;  2R5W A;  5ISY A;  3OGA A;  4C9X A;  2A8Q A;  3O8S A;  5C7T A;  1VK6 A;  3F6A A;  4N1U A;  4ICK A;  4N1T A;  3X0I A;  2GT2 A;  2W4E A;  3P6Y A;  3I9X A;  3FFU A;  2A8P A;  3FCM A;  3MGM A;  1V8R A;  3ZR0 A;  5GHI A;  2GT4 A;  3R03 A;  4KTB A;  3HHJ A;  1X83 A;  5C8L A;  5IW5 A;  1JKN A;  5CFI A;  4ILQ A;  1MK1 A;  4DYW A;  2B06 A;  1OW2 A;  4ZG0 A;  3X0P A;  3Q91 A;  1MQE A;  3X0K A;  3SHD A;  3A6S A;  3I7V A;  3KVH A;  3U53 A;  3Q4I A;  1XSB A;  1V8W A;  3GZ8 A;  3DUP A;  2DSC A;  3MCF A;  1SOI A;  4HFQ A;  3EXQ A;  3X0R A;  4C9W A;  2I8T A;  2PNY A;  3GZ6 A;  4JZV A;  5FSO A;  1V8I A;  4NFX A;  2YVM A;  3BM4 A;  4K6E A;  1R67 A;  2KDW A;  2FML A;  1V8T A;  1PUS A;  3X0M A;  1VRL A;  5FSL A;  3GZ5 A;  5FSM A;  3A6V A;  5I8U A;  3Q1P A;  3ACA A;  3GG6 A;  5ANT A;  3FJY A;  3X0L A;  4YOQ A;  5IW4 A;  1V8L A;  1XSA A;  2XSQ A;  2I8U A;  3SON A;  3E57 A;  3FSP A;  3WHW A;  1PVF A;  2B0V A;  1XSC A;  2RRK A;  2G74 A;  2FVV A;  3MDI A;  1I9A A;  2YVP A;  4S2W A;  1V8N A;  2DSB A;  3ID9 A;  5HZX A;  3BHO A;  5BON A;  2ICJ A;  1VCD A;  5DEQ A;  1V8S A;  4KG4 A;  3O6Z A;  3RH7 A;  3O69 A;  3HYQ A;  3QSJ A;  1Q33 A;  1KHZ A;  2A8R A;  3CNG A;  5FSI A;  4IJX A;  3L85 A;  2J8Q A;  4HVY A;  1G9Q A;  1Q54 A;  2VNQ A;  1QVJ A;  2AZW A;  2O5W A;  4NFW A;  5DPK A;  3MDG A;  1MQW A;  1HX3 A;  1HZT A;  3EF5 A;  5BS6 A;  1VIQ A;  1V8V A;  2DSD A;  2O5F A;  3A6U A;  3Q93 A;  5ANS A;  2A8T A;  3SMD A;  1MR2 A;  2JVB A;  3X0S A;  2B2K A;  1VHG A;  2QJO A;  1Q27 A;  2YVO A;  1X51 A;  3G0Q A;  3N77 A;  5DDG A;  2PQV A;  1GA7 A;  3H95 A;  4JZT A;  3X0Q A;  1VHZ A;  3A6T A;  2FKB A;  5C7Q A;  1KTG A;  1K26 A;  3FK9 A;  1VC9 A;  4S2V A;  2O1C A;  1PPX A;  3J7Y e;  5GHP A;  1JRK A;  1VC8 A;  2DHO A;  2VNP A;  1F3Y A;  5GHJ A;  1KT9 A;  1V8U A;  2YYH A;  2A8S A;  5CFJ A;  5ANU A;  3AC9 A;  3BAP A;  3X0J A;  1MP2 A;  1SZ3 A;  3COU A;  1K2E A;  5GHM A;  1IRY A;  5FSK A;  3P5T A;  3O61 A;  2QJT A;  3N9U A;  5GHN A;  1VIU A;  4JZS A;  4YPR A;  4S2X A;  3ZR1 A;  1PPV A;  1MUT A;  4YPH A;  3GRN A;  3I7U A;  1RRQ A;  3O52 A;  2GB5 A;  4KYX A;  5GHQ A;  3Q2S A;  1PPW A;  4S2Y A;  3F13 A;  5FSN A;  1TUM A;  1RRS A;  5ANV A;  2DUK A;  5DD4 A;  1U20 A;  3X0O A;  1PUN A;  5LPG A;  2Q9P A;  2YVN A;  5ANW A;  3EES A;  2G73 A;  2A6T A;  2ICK A;  1NQY A;  1V8M A;  2I6K A; 
#chains in the Genus database with same CATH topology
 3Q2T A;  2QKM B;  1NFS A;  1X84 A;  1PUQ A;  3GWY A;  3EEU A;  4MPO A;  1G0S A;  2CZR A;  1SJY A;  2KDV A;  4V14 A;  4JZU A;  5GHO A;  3X0N A;  1NQZ A;  1NFZ A;  1V8Y A;  2CL3 A;  1RYA A;  3DKU A;  4KG3 A;  1SU2 A;  2R5W A;  5ISY A;  3OGA A;  4C9X A;  2A8Q A;  3O8S A;  5C7T A;  1VK6 A;  3F6A A;  4N1U A;  4ICK A;  4N1T A;  3X0I A;  2GT2 A;  2W4E A;  3P6Y A;  3I9X A;  3FFU A;  2A8P A;  3FCM A;  3MGM A;  1V8R A;  3ZR0 A;  5GHI A;  2GT4 A;  3R03 A;  4KTB A;  3HHJ A;  1X83 A;  5C8L A;  5IW5 A;  1JKN A;  5CFI A;  4ILQ A;  1MK1 A;  4DYW A;  2B06 A;  1OW2 A;  4ZG0 A;  3X0P A;  3Q91 A;  1MQE A;  3X0K A;  3SHD A;  3A6S A;  3I7V A;  3KVH A;  3U53 A;  3Q4I A;  1XSB A;  1V8W A;  3GZ8 A;  3DUP A;  2DSC A;  3MCF A;  1SOI A;  4HFQ A;  3EXQ A;  3X0R A;  4C9W A;  2I8T A;  2PNY A;  4J7G A;  3GZ6 A;  5FSO A;  4JZV A;  1V8I A;  4NFX A;  2YVM A;  3BM4 A;  4K6E A;  1R67 A;  2KDW A;  2FML A;  1V8T A;  1PUS A;  3X0M A;  1VRL A;  5FSL A;  3GZ5 A;  5FSM A;  3A6V A;  5I8U A;  3Q1P A;  3ACA A;  3GG6 A;  5ANT A;  3FJY A;  3X0L A;  4YOQ A;  5IW4 A;  1V8L A;  1XSA A;  2XSQ A;  2I8U A;  3SON A;  3E57 A;  3FSP A;  3WHW A;  1PVF A;  2B0V A;  1XSC A;  2RRK A;  2G74 A;  2FVV A;  3MDI A;  1I9A A;  2YVP A;  4S2W A;  1V8N A;  2DSB A;  3ID9 A;  5HZX A;  3BHO A;  5BON A;  2ICJ A;  1VCD A;  5DEQ A;  1V8S A;  4J7H A;  4KG4 A;  3O6Z A;  3RH7 A;  3O69 A;  3HYQ A;  3QSJ A;  1Q33 A;  1KHZ A;  2A8R A;  3CNG A;  5FSI A;  4IJX A;  3L85 A;  2J8Q A;  4HVY A;  1G9Q A;  1Q54 A;  2VNQ A;  1QVJ A;  2AZW A;  2O5W A;  4NFW A;  5DPK A;  3MDG A;  1MQW A;  1HX3 A;  1HZT A;  3EF5 A;  5BS6 A;  1VIQ A;  1V8V A;  2DSD A;  2O5F A;  3A6U A;  3Q93 A;  5ANS A;  2A8T A;  3SMD A;  1MR2 A;  2JVB A;  3X0S A;  2B2K A;  1VHG A;  2QJO A;  1Q27 A;  2YVO A;  1X51 A;  3G0Q A;  3N77 A;  5DDG A;  2PQV A;  1GA7 A;  3H95 A;  4JZT A;  3X0Q A;  1VHZ A;  3A6T A;  2FKB A;  5C7Q A;  1KTG A;  1K26 A;  3FK9 A;  1VC9 A;  4S2V A;  2O1C A;  1PPX A;  3J7Y e;  5GHP A;  1JRK A;  1VC8 A;  2DHO A;  2VNP A;  1F3Y A;  5GHJ A;  1KT9 A;  1V8U A;  2YYH A;  2A8S A;  5CFJ A;  5ANU A;  3AC9 A;  3BAP A;  3X0J A;  1MP2 A;  1SZ3 A;  3COU A;  1K2E A;  5GHM A;  1IRY A;  5FSK A;  3P5T A;  3O61 A;  2QJT A;  3N9U A;  5GHN A;  1VIU A;  4JZS A;  4YPR A;  4S2X A;  3ZR1 A;  1PPV A;  1MUT A;  4YPH A;  3GRN A;  3I7U A;  1RRQ A;  3O52 A;  2GB5 A;  4KYX A;  5GHQ A;  3Q2S A;  1PPW A;  4S2Y A;  3F13 A;  5FSN A;  1TUM A;  1RRS A;  5ANV A;  2DUK A;  5DD4 A;  1U20 A;  3X0O A;  1PUN A;  5LPG A;  2Q9P A;  2YVN A;  5ANW A;  3EES A;  2G73 A;  2A6T A;  2ICK A;  1NQY A;  1V8M A;  2I6K A; 
#chains in the Genus database with same CATH homology
 3Q2T A;  2QKM B;  1NFS A;  1X84 A;  1PUQ A;  3GWY A;  3EEU A;  4MPO A;  1G0S A;  2CZR A;  1SJY A;  2KDV A;  4V14 A;  4JZU A;  5GHO A;  3X0N A;  1NQZ A;  1NFZ A;  1V8Y A;  2CL3 A;  1RYA A;  3DKU A;  4KG3 A;  1SU2 A;  2R5W A;  5ISY A;  3OGA A;  4C9X A;  2A8Q A;  3O8S A;  5C7T A;  1VK6 A;  3F6A A;  4N1U A;  4ICK A;  4N1T A;  3X0I A;  2GT2 A;  2W4E A;  3P6Y A;  3I9X A;  3FFU A;  2A8P A;  3FCM A;  3MGM A;  1V8R A;  3ZR0 A;  5GHI A;  2GT4 A;  3R03 A;  4KTB A;  3HHJ A;  1X83 A;  5C8L A;  5IW5 A;  1JKN A;  5CFI A;  4ILQ A;  1MK1 A;  4DYW A;  2B06 A;  1OW2 A;  4ZG0 A;  3X0P A;  3Q91 A;  1MQE A;  3X0K A;  3SHD A;  3A6S A;  3I7V A;  3KVH A;  3U53 A;  3Q4I A;  1XSB A;  1V8W A;  3GZ8 A;  3DUP A;  2DSC A;  3MCF A;  1SOI A;  4HFQ A;  3EXQ A;  3X0R A;  4C9W A;  2I8T A;  2PNY A;  4J7G A;  3GZ6 A;  5FSO A;  4JZV A;  1V8I A;  4NFX A;  2YVM A;  3BM4 A;  4K6E A;  1R67 A;  2KDW A;  2FML A;  1V8T A;  1PUS A;  3X0M A;  1VRL A;  5FSL A;  3GZ5 A;  5FSM A;  3A6V A;  5I8U A;  3Q1P A;  3ACA A;  3GG6 A;  5ANT A;  3FJY A;  3X0L A;  4YOQ A;  5IW4 A;  1V8L A;  1XSA A;  2XSQ A;  2I8U A;  3SON A;  3E57 A;  3FSP A;  3WHW A;  1PVF A;  2B0V A;  1XSC A;  2RRK A;  2G74 A;  2FVV A;  3MDI A;  1I9A A;  2YVP A;  4S2W A;  1V8N A;  2DSB A;  3ID9 A;  5HZX A;  3BHO A;  5BON A;  2ICJ A;  1VCD A;  5DEQ A;  1V8S A;  4J7H A;  4KG4 A;  3O6Z A;  3RH7 A;  3O69 A;  3HYQ A;  3QSJ A;  1Q33 A;  1KHZ A;  2A8R A;  3CNG A;  5FSI A;  4IJX A;  3L85 A;  2J8Q A;  4HVY A;  1G9Q A;  1Q54 A;  2VNQ A;  1QVJ A;  2AZW A;  2O5W A;  4NFW A;  5DPK A;  3MDG A;  1MQW A;  1HX3 A;  1HZT A;  3EF5 A;  5BS6 A;  1VIQ A;  1V8V A;  2DSD A;  2O5F A;  3A6U A;  3Q93 A;  5ANS A;  2A8T A;  3SMD A;  1MR2 A;  2JVB A;  3X0S A;  2B2K A;  1VHG A;  2QJO A;  1Q27 A;  2YVO A;  1X51 A;  3G0Q A;  3N77 A;  5DDG A;  2PQV A;  1GA7 A;  3H95 A;  4JZT A;  3X0Q A;  1VHZ A;  3A6T A;  2FKB A;  5C7Q A;  1KTG A;  1K26 A;  3FK9 A;  1VC9 A;  4S2V A;  2O1C A;  1PPX A;  3J7Y e;  5GHP A;  1JRK A;  1VC8 A;  2DHO A;  2VNP A;  1F3Y A;  5GHJ A;  1KT9 A;  1V8U A;  2YYH A;  2A8S A;  5CFJ A;  5ANU A;  3AC9 A;  3BAP A;  3X0J A;  1MP2 A;  1SZ3 A;  3COU A;  1K2E A;  5GHM A;  1IRY A;  5FSK A;  3P5T A;  3O61 A;  2QJT A;  3N9U A;  5GHN A;  1VIU A;  4JZS A;  4YPR A;  4S2X A;  3ZR1 A;  1PPV A;  1MUT A;  4YPH A;  3GRN A;  3I7U A;  1RRQ A;  3O52 A;  2GB5 A;  4KYX A;  5GHQ A;  3Q2S A;  1PPW A;  4S2Y A;  3F13 A;  5FSN A;  1TUM A;  1RRS A;  5ANV A;  2DUK A;  5DD4 A;  1U20 A;  3X0O A;  1PUN A;  5LPG A;  2Q9P A;  2YVN A;  5ANW A;  3EES A;  2G73 A;  2A6T A;  2ICK A;  1NQY A;  1V8M A;  2I6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...