3A6TA

Crystal structure of mutt-8-oxo-dgmp complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
KLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Mutator mutT protein
publication title Structural and dynamic features of the MutT protein in the recognition of nucleotides with the mutagenic 8-oxoguanine base
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 31
structure length 127
sequence length 127
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2009-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3a6tA00
1PPXA 4ILQA 1V8UA 3GZ8A 3COUA 1V8MA 3SHDA 1V8IA 2DUKA 5FSKA 3O69A 1MK1A 5GHNA 1Q33A 3BAPA 3P5TA 2A8RA 4V14A 1PPVA 3Q1PA 5DEQA 4YPRA 1KT9A 1PUSA 3X0KA 3X0LA 3X0QA 5IW5A 3X0OA 3F6AA 1V8TA 3O6ZA 1MP2A 1F3YA 1KHZA 1NFZA 2FVVA 1SJYA 2CL3A 2O1CA 4N1UA 5HZXA 4S2YA 4HFQA 1JKNA 1K26A 3O8SA 1VK6A 4YPHA 2A8TA 2DSCA 3DKUA 5FSLA 5GHJA 3X0NA 2B2KA 3O61A 3L85A 5ANTA 5FSNA 3X0PA 1X84A 3X0RA 2DSBA 1U20A 5BONA 2PQVA 3FK9A 5DDGA 3EESA 1MR2A 1XSCA 4JZTA 2B06A 5ANWA 2KDVA 2A8SA 3G0QA 2RRKA 4JZUA 1MQWA 4JZSA 3SMDA 3GZ5A 1JRKA 3U53A 4YOQA 3FCMA 2YVOA 1G9QA 2FMLA 1VRLA 1V8VA 2J8QA 2YVNA 1SOIA 3R03A 1R67A 2A8PA 1SU2A 2I6KA 2FKBA 1V8WA 2ICJA 2QJTA 3GWYA 1VHZA 3HYQA 3O52A 3A6SA 1V8LA 2JVBA 1PPWA 3ACAA 4ZG0A 3X0MA 1IRYA 1V8NA 3H95A 1K2EA 2O5FA 3RH7A 3FSPA 3A6VA 5CFIA 1TUMA 1VCDA 5I8UA 5GHOA 2B0VA 4NFWA 2G74A 2QJOA 3GRNA 3Q91A 3N77A 4KTBA 3ZR0A 5FSOA 1SZ3A 2XSQA 2YYHA 4KG3A 2GT4A 2PNYA 3FJYA 3P6YA 5C8LA 3HHJA 1V8RA 1VHGA 5GHQA 2VNPA 5CFJA 3Q4IA 3MGMA 4DYWA 3MDGA 1RYAA 1V8YA 1V8SA 2GB5A 2Q9PA 5FSMA 2G73A 3MCFA 4S2WA 3MDIA 1VC9A 2QKMB 2AZWA 3EEUA 1GA7A 1VC8A 3A6TA 3A6UA 2I8TA 1HX3A 1RRQA 2A6TA 2A8QA 5LPGA 5ANSA 5DPKA 3GG6A 3I7UA 2YVPA 3X0SA 1NFSA 3OGAA 1MUTA 3CNGA 3Q2SA 2O5WA 4NFXA 3EF5A 2ICKA 2DSDA 3BM4A 4C9WA 4S2XA 2DHOA 3BHOA 4MPOA 1PVFA 4N1TA 3X0IA 5ANUA 5GHPA 3Q93A 3I7VA 4K6EA 1XSAA 1X51A 2VNQA 3GZ6A 3I9XA 3AC9A 3E57A 4KYXA 4S2VA 1KTGA 5FSIA 3J7Ye 5IW4A 1VIQA 3F13A 3DUPA 4IJXA 4KG4A 2I8UA 1X83A 1HZTA 3X0JA 3QSJA 1MQEA 2GT2A 1G0SA 5DD4A 1PUQA 5C7QA 3SONA 1RRSA 5BS6A 1QVJA 3EXQA 5ISYA 1PUNA 1VIUA 5C7TA 2KDWA 4JZVA 1I9AA 4ICKA 2R5WA 1NQZA 2YVMA 1Q54A 3N9UA 5GHMA 1Q27A 2W4EA 3FFUA 3ZR1A 4C9XA 1XSBA 3ID9A 5ANVA 3KVHA 3WHWA 4HVYA 1NQYA 1OW2A 5GHIA 3Q2TA
chains in the Genus database with same CATH superfamily
1PPXA 4ILQA 4J7GA 1V8UA 3GZ8A 3COUA 1V8MA 3SHDA 1V8IA 2DUKA 5FSKA 3O69A 1MK1A 5GHNA 1Q33A 3BAPA 3P5TA 2A8RA 4V14A 1PPVA 3Q1PA 5DEQA 4YPRA 1KT9A 1PUSA 3X0KA 3X0LA 3X0QA 5IW5A 3X0OA 3F6AA 1V8TA 3O6ZA 1MP2A 1F3YA 1KHZA 1NFZA 2FVVA 1SJYA 2CL3A 2O1CA 4N1UA 5HZXA 4S2YA 4HFQA 1JKNA 1K26A 3O8SA 1VK6A 4YPHA 2A8TA 2DSCA 3DKUA 5FSLA 5GHJA 3X0NA 2B2KA 3O61A 3L85A 5ANTA 5FSNA 3X0PA 1X84A 3X0RA 2DSBA 1U20A 5BONA 2PQVA 3FK9A 5DDGA 3EESA 1MR2A 1XSCA 4JZTA 2B06A 5ANWA 2KDVA 2A8SA 3G0QA 2RRKA 4JZUA 1MQWA 4JZSA 3SMDA 3GZ5A 1JRKA 3U53A 4YOQA 3FCMA 2YVOA 1G9QA 2FMLA 1VRLA 1V8VA 2J8QA 2YVNA 1SOIA 3R03A 1R67A 2A8PA 1SU2A 2I6KA 2FKBA 1V8WA 2ICJA 2QJTA 3GWYA 1VHZA 3HYQA 3O52A 3A6SA 1V8LA 2JVBA 1PPWA 3ACAA 4ZG0A 3X0MA 1IRYA 1V8NA 3H95A 1K2EA 2O5FA 3RH7A 3FSPA 3A6VA 5CFIA 1TUMA 1VCDA 5I8UA 5GHOA 2B0VA 4NFWA 2G74A 2QJOA 3GRNA 3Q91A 3N77A 4KTBA 3ZR0A 5FSOA 1SZ3A 2XSQA 2YYHA 4KG3A 2GT4A 2PNYA 3FJYA 3P6YA 2CZRA 5C8LA 3HHJA 1V8RA 1VHGA 5GHQA 2VNPA 5CFJA 3Q4IA 3MGMA 4DYWA 3MDGA 1RYAA 1V8YA 1V8SA 2GB5A 2Q9PA 5FSMA 2G73A 3MCFA 4S2WA 3MDIA 1VC9A 2QKMB 2AZWA 3EEUA 1GA7A 1VC8A 3A6TA 3A6UA 2I8TA 1HX3A 1RRQA 2A6TA 2A8QA 5LPGA 5ANSA 5DPKA 3GG6A 3I7UA 2YVPA 3X0SA 1NFSA 3OGAA 1MUTA 3CNGA 3Q2SA 2O5WA 4NFXA 3EF5A 2ICKA 2DSDA 3BM4A 4C9WA 4S2XA 2DHOA 3BHOA 4MPOA 1PVFA 4N1TA 3X0IA 5ANUA 5GHPA 3Q93A 3I7VA 4J7HA 1XSAA 1X51A 2VNQA 4K6EA 3GZ6A 3I9XA 3AC9A 3E57A 4KYXA 4S2VA 1KTGA 5FSIA 3J7Ye 5IW4A 1VIQA 3F13A 3DUPA 4IJXA 4KG4A 2I8UA 1X83A 1HZTA 3X0JA 3QSJA 1MQEA 2GT2A 1G0SA 5DD4A 1PUQA 5C7QA 3SONA 1RRSA 5BS6A 1QVJA 3EXQA 5ISYA 1PUNA 1VIUA 5C7TA 2KDWA 4JZVA 1I9AA 4ICKA 2R5WA 1NQZA 2YVMA 1Q54A 3N9UA 5GHMA 1Q27A 2W4EA 3FFUA 3ZR1A 4C9XA 1XSBA 3ID9A 5ANVA 3KVHA 3WHWA 4HVYA 1NQYA 1OW2A 5GHIA 3Q2TA
chains in the Genus database with same CATH topology
1PPXA 4ILQA 4J7GA 1V8UA 3GZ8A 3COUA 1V8MA 3SHDA 1V8IA 2DUKA 5FSKA 3O69A 1MK1A 5GHNA 1Q33A 3BAPA 3P5TA 2A8RA 4V14A 1PPVA 3Q1PA 5DEQA 4YPRA 1KT9A 1PUSA 3X0KA 3X0LA 3X0QA 5IW5A 3X0OA 3F6AA 1V8TA 3O6ZA 1MP2A 1F3YA 1KHZA 1NFZA 2FVVA 1SJYA 2CL3A 2O1CA 4N1UA 5HZXA 4S2YA 4HFQA 1JKNA 1K26A 3O8SA 1VK6A 4YPHA 2A8TA 2DSCA 3DKUA 5FSLA 5GHJA 3X0NA 2B2KA 3O61A 3L85A 5ANTA 5FSNA 3X0PA 1X84A 3X0RA 2DSBA 1U20A 5BONA 2PQVA 3FK9A 5DDGA 3EESA 1MR2A 1XSCA 4JZTA 2B06A 5ANWA 2KDVA 2A8SA 3G0QA 2RRKA 4JZUA 1MQWA 4JZSA 3SMDA 3GZ5A 1JRKA 3U53A 4YOQA 3FCMA 2YVOA 1G9QA 2FMLA 1VRLA 1V8VA 2J8QA 2YVNA 1SOIA 3R03A 1R67A 2A8PA 1SU2A 2I6KA 2FKBA 1V8WA 2ICJA 2QJTA 3GWYA 1VHZA 3HYQA 3O52A 3A6SA 1V8LA 2JVBA 1PPWA 3ACAA 4ZG0A 3X0MA 1IRYA 1V8NA 3H95A 1K2EA 2O5FA 3RH7A 3FSPA 3A6VA 5CFIA 1TUMA 1VCDA 5I8UA 5GHOA 2B0VA 4NFWA 2G74A 2QJOA 3GRNA 3Q91A 3N77A 4KTBA 3ZR0A 5FSOA 1SZ3A 2XSQA 2YYHA 4KG3A 2GT4A 2PNYA 3FJYA 3P6YA 2CZRA 5C8LA 3HHJA 1V8RA 1VHGA 5GHQA 2VNPA 5CFJA 3Q4IA 3MGMA 4DYWA 3MDGA 1RYAA 1V8YA 1V8SA 2GB5A 2Q9PA 5FSMA 2G73A 3MCFA 4S2WA 3MDIA 1VC9A 2QKMB 2AZWA 3EEUA 1GA7A 1VC8A 3A6TA 3A6UA 2I8TA 1HX3A 1RRQA 2A6TA 2A8QA 5LPGA 5ANSA 5DPKA 3GG6A 3I7UA 2YVPA 3X0SA 1NFSA 3OGAA 1MUTA 3CNGA 3Q2SA 2O5WA 4NFXA 3EF5A 2ICKA 2DSDA 3BM4A 4C9WA 4S2XA 2DHOA 3BHOA 4MPOA 1PVFA 4N1TA 3X0IA 5ANUA 5GHPA 3Q93A 3I7VA 4J7HA 1XSAA 1X51A 2VNQA 4K6EA 3GZ6A 3I9XA 3AC9A 3E57A 4KYXA 4S2VA 1KTGA 5FSIA 3J7Ye 5IW4A 1VIQA 3F13A 3DUPA 4IJXA 4KG4A 2I8UA 1X83A 1HZTA 3X0JA 3QSJA 1MQEA 2GT2A 1G0SA 5DD4A 1PUQA 5C7QA 3SONA 1RRSA 5BS6A 1QVJA 3EXQA 5ISYA 1PUNA 1VIUA 5C7TA 2KDWA 4JZVA 1I9AA 4ICKA 2R5WA 1NQZA 2YVMA 1Q54A 3N9UA 5GHMA 1Q27A 2W4EA 3FFUA 3ZR1A 4C9XA 1XSBA 3ID9A 5ANVA 3KVHA 3WHWA 4HVYA 1NQYA 1OW2A 5GHIA 3Q2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PPX A;  4ILQ A;  1V8U A;  3GZ8 A;  3COU A;  1V8M A;  3SHD A;  1V8I A;  2DUK A;  5FSK A;  3O69 A;  1MK1 A;  5GHN A;  1Q33 A;  3BAP A;  3P5T A;  2A8R A;  4V14 A;  1PPV A;  3Q1P A;  5DEQ A;  4YPR A;  1KT9 A;  1PUS A;  3X0K A;  3X0L A;  3X0Q A;  5IW5 A;  3X0O A;  3F6A A;  1V8T A;  3O6Z A;  1MP2 A;  1F3Y A;  1KHZ A;  1NFZ A;  2FVV A;  1SJY A;  2CL3 A;  2O1C A;  4N1U A;  5HZX A;  4S2Y A;  4HFQ A;  1JKN A;  1K26 A;  3O8S A;  1VK6 A;  4YPH A;  2A8T A;  2DSC A;  3DKU A;  5FSL A;  5GHJ A;  3X0N A;  2B2K A;  3O61 A;  3L85 A;  5ANT A;  5FSN A;  3X0P A;  1X84 A;  3X0R A;  2DSB A;  1U20 A;  5BON A;  2PQV A;  3FK9 A;  5DDG A;  3EES A;  1MR2 A;  1XSC A;  4JZT A;  2B06 A;  5ANW A;  2KDV A;  2A8S A;  3G0Q A;  2RRK A;  4JZU A;  1MQW A;  4JZS A;  3SMD A;  3GZ5 A;  1JRK A;  3U53 A;  4YOQ A;  3FCM A;  2YVO A;  1G9Q A;  2FML A;  1VRL A;  1V8V A;  2J8Q A;  2YVN A;  1SOI A;  3R03 A;  1R67 A;  2A8P A;  1SU2 A;  2I6K A;  2FKB A;  1V8W A;  2ICJ A;  2QJT A;  3GWY A;  1VHZ A;  3HYQ A;  3O52 A;  3A6S A;  1V8L A;  2JVB A;  1PPW A;  3ACA A;  4ZG0 A;  3X0M A;  1IRY A;  1V8N A;  3H95 A;  1K2E A;  2O5F A;  3RH7 A;  3FSP A;  3A6V A;  5CFI A;  1TUM A;  1VCD A;  5I8U A;  5GHO A;  2B0V A;  4NFW A;  2G74 A;  2QJO A;  3GRN A;  3Q91 A;  3N77 A;  4KTB A;  3ZR0 A;  5FSO A;  1SZ3 A;  2XSQ A;  2YYH A;  4KG3 A;  2GT4 A;  2PNY A;  3FJY A;  3P6Y A;  5C8L A;  3HHJ A;  1V8R A;  1VHG A;  5GHQ A;  2VNP A;  5CFJ A;  3Q4I A;  3MGM A;  4DYW A;  3MDG A;  1RYA A;  1V8Y A;  1V8S A;  2GB5 A;  2Q9P A;  5FSM A;  2G73 A;  3MCF A;  4S2W A;  3MDI A;  1VC9 A;  2QKM B;  2AZW A;  3EEU A;  1GA7 A;  1VC8 A;  3A6T A;  3A6U A;  2I8T A;  1HX3 A;  1RRQ A;  2A6T A;  2A8Q A;  5LPG A;  5ANS A;  5DPK A;  3GG6 A;  3I7U A;  2YVP A;  3X0S A;  1NFS A;  3OGA A;  1MUT A;  3CNG A;  3Q2S A;  2O5W A;  4NFX A;  3EF5 A;  2ICK A;  2DSD A;  3BM4 A;  4C9W A;  4S2X A;  2DHO A;  3BHO A;  4MPO A;  1PVF A;  4N1T A;  3X0I A;  5ANU A;  5GHP A;  3Q93 A;  3I7V A;  4K6E A;  1XSA A;  1X51 A;  2VNQ A;  3GZ6 A;  3I9X A;  3AC9 A;  3E57 A;  4KYX A;  4S2V A;  1KTG A;  5FSI A;  3J7Y e;  5IW4 A;  1VIQ A;  3F13 A;  3DUP A;  4IJX A;  4KG4 A;  2I8U A;  1X83 A;  1HZT A;  3X0J A;  3QSJ A;  1MQE A;  2GT2 A;  1G0S A;  5DD4 A;  1PUQ A;  5C7Q A;  3SON A;  1RRS A;  5BS6 A;  1QVJ A;  3EXQ A;  5ISY A;  1PUN A;  1VIU A;  5C7T A;  2KDW A;  4JZV A;  1I9A A;  4ICK A;  2R5W A;  1NQZ A;  2YVM A;  1Q54 A;  3N9U A;  5GHM A;  1Q27 A;  2W4E A;  3FFU A;  3ZR1 A;  4C9X A;  1XSB A;  3ID9 A;  5ANV A;  3KVH A;  3WHW A;  4HVY A;  1NQY A;  1OW2 A;  5GHI A;  3Q2T A; 
#chains in the Genus database with same CATH topology
 1PPX A;  4ILQ A;  4J7G A;  1V8U A;  3GZ8 A;  3COU A;  1V8M A;  3SHD A;  1V8I A;  2DUK A;  5FSK A;  3O69 A;  1MK1 A;  5GHN A;  1Q33 A;  3BAP A;  3P5T A;  2A8R A;  4V14 A;  1PPV A;  3Q1P A;  5DEQ A;  4YPR A;  1KT9 A;  1PUS A;  3X0K A;  3X0L A;  3X0Q A;  5IW5 A;  3X0O A;  3F6A A;  1V8T A;  3O6Z A;  1MP2 A;  1F3Y A;  1KHZ A;  1NFZ A;  2FVV A;  1SJY A;  2CL3 A;  2O1C A;  4N1U A;  5HZX A;  4S2Y A;  4HFQ A;  1JKN A;  1K26 A;  3O8S A;  1VK6 A;  4YPH A;  2A8T A;  2DSC A;  3DKU A;  5FSL A;  5GHJ A;  3X0N A;  2B2K A;  3O61 A;  3L85 A;  5ANT A;  5FSN A;  3X0P A;  1X84 A;  3X0R A;  2DSB A;  1U20 A;  5BON A;  2PQV A;  3FK9 A;  5DDG A;  3EES A;  1MR2 A;  1XSC A;  4JZT A;  2B06 A;  5ANW A;  2KDV A;  2A8S A;  3G0Q A;  2RRK A;  4JZU A;  1MQW A;  4JZS A;  3SMD A;  3GZ5 A;  1JRK A;  3U53 A;  4YOQ A;  3FCM A;  2YVO A;  1G9Q A;  2FML A;  1VRL A;  1V8V A;  2J8Q A;  2YVN A;  1SOI A;  3R03 A;  1R67 A;  2A8P A;  1SU2 A;  2I6K A;  2FKB A;  1V8W A;  2ICJ A;  2QJT A;  3GWY A;  1VHZ A;  3HYQ A;  3O52 A;  3A6S A;  1V8L A;  2JVB A;  1PPW A;  3ACA A;  4ZG0 A;  3X0M A;  1IRY A;  1V8N A;  3H95 A;  1K2E A;  2O5F A;  3RH7 A;  3FSP A;  3A6V A;  5CFI A;  1TUM A;  1VCD A;  5I8U A;  5GHO A;  2B0V A;  4NFW A;  2G74 A;  2QJO A;  3GRN A;  3Q91 A;  3N77 A;  4KTB A;  3ZR0 A;  5FSO A;  1SZ3 A;  2XSQ A;  2YYH A;  4KG3 A;  2GT4 A;  2PNY A;  3FJY A;  3P6Y A;  2CZR A;  5C8L A;  3HHJ A;  1V8R A;  1VHG A;  5GHQ A;  2VNP A;  5CFJ A;  3Q4I A;  3MGM A;  4DYW A;  3MDG A;  1RYA A;  1V8Y A;  1V8S A;  2GB5 A;  2Q9P A;  5FSM A;  2G73 A;  3MCF A;  4S2W A;  3MDI A;  1VC9 A;  2QKM B;  2AZW A;  3EEU A;  1GA7 A;  1VC8 A;  3A6T A;  3A6U A;  2I8T A;  1HX3 A;  1RRQ A;  2A6T A;  2A8Q A;  5LPG A;  5ANS A;  5DPK A;  3GG6 A;  3I7U A;  2YVP A;  3X0S A;  1NFS A;  3OGA A;  1MUT A;  3CNG A;  3Q2S A;  2O5W A;  4NFX A;  3EF5 A;  2ICK A;  2DSD A;  3BM4 A;  4C9W A;  4S2X A;  2DHO A;  3BHO A;  4MPO A;  1PVF A;  4N1T A;  3X0I A;  5ANU A;  5GHP A;  3Q93 A;  3I7V A;  4J7H A;  1XSA A;  1X51 A;  2VNQ A;  4K6E A;  3GZ6 A;  3I9X A;  3AC9 A;  3E57 A;  4KYX A;  4S2V A;  1KTG A;  5FSI A;  3J7Y e;  5IW4 A;  1VIQ A;  3F13 A;  3DUP A;  4IJX A;  4KG4 A;  2I8U A;  1X83 A;  1HZT A;  3X0J A;  3QSJ A;  1MQE A;  2GT2 A;  1G0S A;  5DD4 A;  1PUQ A;  5C7Q A;  3SON A;  1RRS A;  5BS6 A;  1QVJ A;  3EXQ A;  5ISY A;  1PUN A;  1VIU A;  5C7T A;  2KDW A;  4JZV A;  1I9A A;  4ICK A;  2R5W A;  1NQZ A;  2YVM A;  1Q54 A;  3N9U A;  5GHM A;  1Q27 A;  2W4E A;  3FFU A;  3ZR1 A;  4C9X A;  1XSB A;  3ID9 A;  5ANV A;  3KVH A;  3WHW A;  4HVY A;  1NQY A;  1OW2 A;  5GHI A;  3Q2T A; 
#chains in the Genus database with same CATH homology
 1PPX A;  4ILQ A;  4J7G A;  1V8U A;  3GZ8 A;  3COU A;  1V8M A;  3SHD A;  1V8I A;  2DUK A;  5FSK A;  3O69 A;  1MK1 A;  5GHN A;  1Q33 A;  3BAP A;  3P5T A;  2A8R A;  4V14 A;  1PPV A;  3Q1P A;  5DEQ A;  4YPR A;  1KT9 A;  1PUS A;  3X0K A;  3X0L A;  3X0Q A;  5IW5 A;  3X0O A;  3F6A A;  1V8T A;  3O6Z A;  1MP2 A;  1F3Y A;  1KHZ A;  1NFZ A;  2FVV A;  1SJY A;  2CL3 A;  2O1C A;  4N1U A;  5HZX A;  4S2Y A;  4HFQ A;  1JKN A;  1K26 A;  3O8S A;  1VK6 A;  4YPH A;  2A8T A;  2DSC A;  3DKU A;  5FSL A;  5GHJ A;  3X0N A;  2B2K A;  3O61 A;  3L85 A;  5ANT A;  5FSN A;  3X0P A;  1X84 A;  3X0R A;  2DSB A;  1U20 A;  5BON A;  2PQV A;  3FK9 A;  5DDG A;  3EES A;  1MR2 A;  1XSC A;  4JZT A;  2B06 A;  5ANW A;  2KDV A;  2A8S A;  3G0Q A;  2RRK A;  4JZU A;  1MQW A;  4JZS A;  3SMD A;  3GZ5 A;  1JRK A;  3U53 A;  4YOQ A;  3FCM A;  2YVO A;  1G9Q A;  2FML A;  1VRL A;  1V8V A;  2J8Q A;  2YVN A;  1SOI A;  3R03 A;  1R67 A;  2A8P A;  1SU2 A;  2I6K A;  2FKB A;  1V8W A;  2ICJ A;  2QJT A;  3GWY A;  1VHZ A;  3HYQ A;  3O52 A;  3A6S A;  1V8L A;  2JVB A;  1PPW A;  3ACA A;  4ZG0 A;  3X0M A;  1IRY A;  1V8N A;  3H95 A;  1K2E A;  2O5F A;  3RH7 A;  3FSP A;  3A6V A;  5CFI A;  1TUM A;  1VCD A;  5I8U A;  5GHO A;  2B0V A;  4NFW A;  2G74 A;  2QJO A;  3GRN A;  3Q91 A;  3N77 A;  4KTB A;  3ZR0 A;  5FSO A;  1SZ3 A;  2XSQ A;  2YYH A;  4KG3 A;  2GT4 A;  2PNY A;  3FJY A;  3P6Y A;  2CZR A;  5C8L A;  3HHJ A;  1V8R A;  1VHG A;  5GHQ A;  2VNP A;  5CFJ A;  3Q4I A;  3MGM A;  4DYW A;  3MDG A;  1RYA A;  1V8Y A;  1V8S A;  2GB5 A;  2Q9P A;  5FSM A;  2G73 A;  3MCF A;  4S2W A;  3MDI A;  1VC9 A;  2QKM B;  2AZW A;  3EEU A;  1GA7 A;  1VC8 A;  3A6T A;  3A6U A;  2I8T A;  1HX3 A;  1RRQ A;  2A6T A;  2A8Q A;  5LPG A;  5ANS A;  5DPK A;  3GG6 A;  3I7U A;  2YVP A;  3X0S A;  1NFS A;  3OGA A;  1MUT A;  3CNG A;  3Q2S A;  2O5W A;  4NFX A;  3EF5 A;  2ICK A;  2DSD A;  3BM4 A;  4C9W A;  4S2X A;  2DHO A;  3BHO A;  4MPO A;  1PVF A;  4N1T A;  3X0I A;  5ANU A;  5GHP A;  3Q93 A;  3I7V A;  4J7H A;  1XSA A;  1X51 A;  2VNQ A;  4K6E A;  3GZ6 A;  3I9X A;  3AC9 A;  3E57 A;  4KYX A;  4S2V A;  1KTG A;  5FSI A;  3J7Y e;  5IW4 A;  1VIQ A;  3F13 A;  3DUP A;  4IJX A;  4KG4 A;  2I8U A;  1X83 A;  1HZT A;  3X0J A;  3QSJ A;  1MQE A;  2GT2 A;  1G0S A;  5DD4 A;  1PUQ A;  5C7Q A;  3SON A;  1RRS A;  5BS6 A;  1QVJ A;  3EXQ A;  5ISY A;  1PUN A;  1VIU A;  5C7T A;  2KDW A;  4JZV A;  1I9A A;  4ICK A;  2R5W A;  1NQZ A;  2YVM A;  1Q54 A;  3N9U A;  5GHM A;  1Q27 A;  2W4E A;  3FFU A;  3ZR1 A;  4C9X A;  1XSB A;  3ID9 A;  5ANV A;  3KVH A;  3WHW A;  4HVY A;  1NQY A;  1OW2 A;  5GHI A;  3Q2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...