3A6TA

Crystal structure of mutt-8-oxo-dgmp complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
KLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mutator mutT protein
publication title Structural and dynamic features of the MutT protein in the recognition of nucleotides with the mutagenic 8-oxoguanine base
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Hydrolase
total genus 31
structure length 127
sequence length 127
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2009-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3a6tA00
2YYHA 3Q2TA 1V8YA 3EXQA 3FCMA 4V14A 3X0JA 1G9QA 2PQVA 2YVNA 3O6ZA 5ANWA 1MP2A 5FSIA 4IJXA 5FSMA 2JVBA 3EESA 3GZ5A 2FVVA 2I6KA 3GZ8A 3GWYA 5CFIA 4JZVA 3COUA 5GHMA 5FSLA 1XSCA 1SZ3A 1HX3A 1VC8A 2DSDA 3EF5A 3F6AA 4ZG0A 2PNYA 5DDGA 2O5WA 3G0QA 3GG6A 1VCDA 4YPRA 1NQYA 1PPVA 1V8RA 3Q1PA 5C7QA 4HVYA 1V8SA 5DD4A 3E57A 1F3YA 1X83A 2QJOA 2R5WA 1R67A 4KTBA 3X0MA 5ANVA 4JZTA 1V8UA 4S2YA 2VNPA 1XSBA 1I9AA 3FFUA 1X51A 4ICKA 3MCFA 4N1TA 5DEQA 3J7Ye 3FJYA 3WHWA 1VC9A 2DHOA 3HHJA 1IRYA 3ID9A 3O61A 3P6YA 5ANSA 5GHOA 2GT4A 1Q54A 2O1CA 5ANTA 3FK9A 5BS6A 3FSPA 3I7UA 1NFZA 2KDVA 1PPWA 2FMLA 4NFXA 5GHPA 2I8TA 1X84A 2A8RA 2Q9PA 2A8PA 3SHDA 1JKNA 2QKMB 3MDIA 3P5TA 1VIUA 2DUKA 2A6TA 4JZUA 4N1UA 3A6TA 3SONA 1V8LA 3F13A 2GT2A 3BHOA 3O8SA 5BONA 3X0IA 1U20A 1OW2A 1V8NA 1PVFA 3L85A 1NQZA 3MGMA 3ACAA 3I9XA 3Q2SA 3X0OA 5DPKA 3QSJA 2RRKA 3CNGA 2YVMA 4S2XA 4C9XA 5ISYA 1GA7A 5GHNA 2A8SA 3BM4A 4S2WA 1MQEA 3A6VA 4C9WA 3X0QA 2O5FA 4YOQA 1Q33A 3A6SA 4ILQA 5GHIA 4KG4A 3X0PA 2G74A 4NFWA 2B06A 2A8TA 3X0LA 5HZXA 1SU2A 2GB5A 2ICJA 5C7TA 2B0VA 3U53A 2J8QA 3I7VA 1K26A 2CL3A 3A6UA 1MQWA 2XSQA 1V8IA 1Q27A 2ICKA 5IW4A 3X0KA 1PPXA 5FSKA 2W4EA 1V8WA 4HFQA 1VHZA 1MR2A 3RH7A 1NFSA 5IW5A 2B2KA 3MDGA 3O52A 3OGAA 2YVPA 3AC9A 5LPGA 4S2VA 2AZWA 3X0RA 5CFJA 4YPHA 3BAPA 1VIQA 3EEUA 2DSCA 1PUNA 1V8TA 3N9UA 5FSNA 1SJYA 4JZSA 1MUTA 3N77A 5GHQA 1VHGA 3Q4IA 3ZR0A 1QVJA 5I8UA 1JRKA 3GZ6A 2VNQA 1MK1A 4K6EA 3GRNA 1G0SA 1SOIA 1HZTA 1KHZA 4MPOA 1VK6A 3H95A 4KYXA 1KTGA 1K2EA 3X0SA 2G73A 2QJTA 5C8LA 3O69A 3X0NA 2YVOA 1RYAA 4KG3A 5FSOA 1VRLA 1PUSA 1TUMA 2DSBA 3HYQA 1V8MA 3KVHA 5ANUA 4DYWA 1RRSA 3ZR1A 3SMDA 1KT9A 2FKBA 3R03A 3DUPA 3DKUA 5GHJA 1XSAA 1V8VA 2KDWA 2A8QA 1RRQA 3Q93A 2I8UA 3Q91A 1PUQA
chains in the Genus database with same CATH superfamily
2YYHA 3Q2TA 1V8YA 3EXQA 3FCMA 4V14A 3X0JA 1G9QA 2PQVA 2YVNA 3O6ZA 5ANWA 1MP2A 5FSIA 4IJXA 5FSMA 2JVBA 3EESA 3GZ5A 2FVVA 2I6KA 3GZ8A 3GWYA 5CFIA 4JZVA 3COUA 5GHMA 5FSLA 1XSCA 1SZ3A 1HX3A 1VC8A 2DSDA 3EF5A 3F6AA 4ZG0A 2PNYA 5DDGA 2O5WA 3G0QA 3GG6A 1VCDA 4YPRA 1NQYA 1PPVA 1V8RA 3Q1PA 5C7QA 4HVYA 1V8SA 5DD4A 3E57A 1F3YA 1X83A 2QJOA 2R5WA 1R67A 4KTBA 3X0MA 5ANVA 2CZRA 4JZTA 1V8UA 4S2YA 2VNPA 1XSBA 1I9AA 3FFUA 1X51A 4ICKA 3MCFA 4N1TA 5DEQA 3J7Ye 3FJYA 3WHWA 1VC9A 2DHOA 3HHJA 1IRYA 3ID9A 3O61A 3P6YA 5ANSA 5GHOA 2GT4A 1Q54A 2O1CA 5ANTA 3FK9A 5BS6A 3FSPA 3I7UA 1NFZA 2KDVA 1PPWA 2FMLA 4NFXA 5GHPA 2I8TA 1X84A 2A8RA 2Q9PA 2A8PA 3SHDA 1JKNA 2QKMB 3MDIA 3P5TA 1VIUA 2DUKA 2A6TA 4JZUA 4N1UA 3A6TA 3SONA 1V8LA 3F13A 2GT2A 3BHOA 3O8SA 5BONA 3X0IA 1U20A 1OW2A 1V8NA 1PVFA 3L85A 1NQZA 3MGMA 3ACAA 3I9XA 3Q2SA 3X0OA 5DPKA 3QSJA 2RRKA 3CNGA 2YVMA 4S2XA 4C9XA 5ISYA 1GA7A 5GHNA 2A8SA 3BM4A 4S2WA 1MQEA 3A6VA 4C9WA 3X0QA 2O5FA 4YOQA 1Q33A 3A6SA 4ILQA 5GHIA 4KG4A 3X0PA 2G74A 4NFWA 2B06A 2A8TA 3X0LA 5HZXA 1SU2A 2GB5A 2ICJA 5C7TA 2B0VA 3U53A 2J8QA 3I7VA 1K26A 2CL3A 3A6UA 1MQWA 2XSQA 1V8IA 1Q27A 2ICKA 5IW4A 3X0KA 1PPXA 4J7HA 5FSKA 2W4EA 1V8WA 4HFQA 1VHZA 1MR2A 3RH7A 1NFSA 5IW5A 2B2KA 3MDGA 3O52A 3OGAA 2YVPA 3AC9A 5LPGA 4S2VA 2AZWA 3X0RA 5CFJA 4YPHA 3BAPA 1VIQA 3EEUA 2DSCA 1PUNA 1V8TA 3N9UA 5FSNA 1SJYA 4JZSA 1MUTA 3N77A 5GHQA 1VHGA 3Q4IA 3ZR0A 1QVJA 5I8UA 1JRKA 3GZ6A 2VNQA 1MK1A 4J7GA 3GRNA 4K6EA 1G0SA 1SOIA 1HZTA 1KHZA 4MPOA 1VK6A 3H95A 4KYXA 1KTGA 1K2EA 3X0SA 2G73A 2QJTA 5C8LA 3O69A 3X0NA 2YVOA 1RYAA 4KG3A 5FSOA 1VRLA 1PUSA 1TUMA 2DSBA 3HYQA 1V8MA 3KVHA 5ANUA 4DYWA 1RRSA 3ZR1A 3SMDA 1KT9A 2FKBA 3R03A 3DUPA 3DKUA 5GHJA 1XSAA 1V8VA 2KDWA 2A8QA 1RRQA 3Q93A 2I8UA 3Q91A 1PUQA
chains in the Genus database with same CATH topology
2YYHA 3Q2TA 1V8YA 3EXQA 3FCMA 4V14A 3X0JA 1G9QA 2PQVA 2YVNA 3O6ZA 5ANWA 1MP2A 5FSIA 4IJXA 5FSMA 2JVBA 3EESA 3GZ5A 2FVVA 2I6KA 3GZ8A 3GWYA 5CFIA 4JZVA 3COUA 5GHMA 5FSLA 1XSCA 1SZ3A 1HX3A 1VC8A 2DSDA 3EF5A 3F6AA 4ZG0A 2PNYA 5DDGA 2O5WA 3G0QA 3GG6A 1VCDA 4YPRA 1NQYA 1PPVA 1V8RA 3Q1PA 5C7QA 4HVYA 1V8SA 5DD4A 3E57A 1F3YA 1X83A 2QJOA 2R5WA 1R67A 4KTBA 3X0MA 5ANVA 2CZRA 4JZTA 1V8UA 4S2YA 2VNPA 1XSBA 1I9AA 3FFUA 1X51A 4ICKA 3MCFA 4N1TA 5DEQA 3J7Ye 3FJYA 3WHWA 1VC9A 2DHOA 3HHJA 1IRYA 3ID9A 3O61A 3P6YA 5ANSA 5GHOA 2GT4A 1Q54A 2O1CA 5ANTA 3FK9A 5BS6A 3FSPA 3I7UA 1NFZA 2KDVA 1PPWA 2FMLA 4NFXA 5GHPA 2I8TA 1X84A 2A8RA 2Q9PA 2A8PA 3SHDA 1JKNA 2QKMB 3MDIA 3P5TA 1VIUA 2DUKA 2A6TA 4JZUA 4N1UA 3A6TA 3SONA 1V8LA 3F13A 2GT2A 3BHOA 3O8SA 5BONA 3X0IA 1U20A 1OW2A 1V8NA 1PVFA 3L85A 1NQZA 3MGMA 3ACAA 3I9XA 3Q2SA 3X0OA 5DPKA 3QSJA 2RRKA 3CNGA 2YVMA 4S2XA 4C9XA 5ISYA 1GA7A 5GHNA 2A8SA 3BM4A 4S2WA 1MQEA 3A6VA 4C9WA 3X0QA 2O5FA 4YOQA 1Q33A 3A6SA 4ILQA 5GHIA 4KG4A 3X0PA 2G74A 4NFWA 2B06A 2A8TA 3X0LA 5HZXA 1SU2A 2GB5A 2ICJA 5C7TA 2B0VA 3U53A 2J8QA 3I7VA 1K26A 2CL3A 3A6UA 1MQWA 2XSQA 1V8IA 1Q27A 2ICKA 5IW4A 3X0KA 1PPXA 4J7HA 5FSKA 2W4EA 1V8WA 4HFQA 1VHZA 1MR2A 3RH7A 1NFSA 5IW5A 2B2KA 3MDGA 3O52A 3OGAA 2YVPA 3AC9A 5LPGA 4S2VA 2AZWA 3X0RA 5CFJA 4YPHA 3BAPA 1VIQA 3EEUA 2DSCA 1PUNA 1V8TA 3N9UA 5FSNA 1SJYA 4JZSA 1MUTA 3N77A 5GHQA 1VHGA 3Q4IA 3ZR0A 1QVJA 5I8UA 1JRKA 3GZ6A 2VNQA 1MK1A 4J7GA 3GRNA 4K6EA 1G0SA 1SOIA 1HZTA 1KHZA 4MPOA 1VK6A 3H95A 4KYXA 1KTGA 1K2EA 3X0SA 2G73A 2QJTA 5C8LA 3O69A 3X0NA 2YVOA 1RYAA 4KG3A 5FSOA 1VRLA 1PUSA 1TUMA 2DSBA 3HYQA 1V8MA 3KVHA 5ANUA 4DYWA 1RRSA 3ZR1A 3SMDA 1KT9A 2FKBA 3R03A 3DUPA 3DKUA 5GHJA 1XSAA 1V8VA 2KDWA 2A8QA 1RRQA 3Q93A 2I8UA 3Q91A 1PUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YYH A;  3Q2T A;  1V8Y A;  3EXQ A;  3FCM A;  4V14 A;  3X0J A;  1G9Q A;  2PQV A;  2YVN A;  3O6Z A;  5ANW A;  1MP2 A;  5FSI A;  4IJX A;  5FSM A;  2JVB A;  3EES A;  3GZ5 A;  2FVV A;  2I6K A;  3GZ8 A;  3GWY A;  5CFI A;  4JZV A;  3COU A;  5GHM A;  5FSL A;  1XSC A;  1SZ3 A;  1HX3 A;  1VC8 A;  2DSD A;  3EF5 A;  3F6A A;  4ZG0 A;  2PNY A;  5DDG A;  2O5W A;  3G0Q A;  3GG6 A;  1VCD A;  4YPR A;  1NQY A;  1PPV A;  1V8R A;  3Q1P A;  5C7Q A;  4HVY A;  1V8S A;  5DD4 A;  3E57 A;  1F3Y A;  1X83 A;  2QJO A;  2R5W A;  1R67 A;  4KTB A;  3X0M A;  5ANV A;  4JZT A;  1V8U A;  4S2Y A;  2VNP A;  1XSB A;  1I9A A;  3FFU A;  1X51 A;  4ICK A;  3MCF A;  4N1T A;  5DEQ A;  3J7Y e;  3FJY A;  3WHW A;  1VC9 A;  2DHO A;  3HHJ A;  1IRY A;  3ID9 A;  3O61 A;  3P6Y A;  5ANS A;  5GHO A;  2GT4 A;  1Q54 A;  2O1C A;  5ANT A;  3FK9 A;  5BS6 A;  3FSP A;  3I7U A;  1NFZ A;  2KDV A;  1PPW A;  2FML A;  4NFX A;  5GHP A;  2I8T A;  1X84 A;  2A8R A;  2Q9P A;  2A8P A;  3SHD A;  1JKN A;  2QKM B;  3MDI A;  3P5T A;  1VIU A;  2DUK A;  2A6T A;  4JZU A;  4N1U A;  3A6T A;  3SON A;  1V8L A;  3F13 A;  2GT2 A;  3BHO A;  3O8S A;  5BON A;  3X0I A;  1U20 A;  1OW2 A;  1V8N A;  1PVF A;  3L85 A;  1NQZ A;  3MGM A;  3ACA A;  3I9X A;  3Q2S A;  3X0O A;  5DPK A;  3QSJ A;  2RRK A;  3CNG A;  2YVM A;  4S2X A;  4C9X A;  5ISY A;  1GA7 A;  5GHN A;  2A8S A;  3BM4 A;  4S2W A;  1MQE A;  3A6V A;  4C9W A;  3X0Q A;  2O5F A;  4YOQ A;  1Q33 A;  3A6S A;  4ILQ A;  5GHI A;  4KG4 A;  3X0P A;  2G74 A;  4NFW A;  2B06 A;  2A8T A;  3X0L A;  5HZX A;  1SU2 A;  2GB5 A;  2ICJ A;  5C7T A;  2B0V A;  3U53 A;  2J8Q A;  3I7V A;  1K26 A;  2CL3 A;  3A6U A;  1MQW A;  2XSQ A;  1V8I A;  1Q27 A;  2ICK A;  5IW4 A;  3X0K A;  1PPX A;  5FSK A;  2W4E A;  1V8W A;  4HFQ A;  1VHZ A;  1MR2 A;  3RH7 A;  1NFS A;  5IW5 A;  2B2K A;  3MDG A;  3O52 A;  3OGA A;  2YVP A;  3AC9 A;  5LPG A;  4S2V A;  2AZW A;  3X0R A;  5CFJ A;  4YPH A;  3BAP A;  1VIQ A;  3EEU A;  2DSC A;  1PUN A;  1V8T A;  3N9U A;  5FSN A;  1SJY A;  4JZS A;  1MUT A;  3N77 A;  5GHQ A;  1VHG A;  3Q4I A;  3ZR0 A;  1QVJ A;  5I8U A;  1JRK A;  3GZ6 A;  2VNQ A;  1MK1 A;  4K6E A;  3GRN A;  1G0S A;  1SOI A;  1HZT A;  1KHZ A;  4MPO A;  1VK6 A;  3H95 A;  4KYX A;  1KTG A;  1K2E A;  3X0S A;  2G73 A;  2QJT A;  5C8L A;  3O69 A;  3X0N A;  2YVO A;  1RYA A;  4KG3 A;  5FSO A;  1VRL A;  1PUS A;  1TUM A;  2DSB A;  3HYQ A;  1V8M A;  3KVH A;  5ANU A;  4DYW A;  1RRS A;  3ZR1 A;  3SMD A;  1KT9 A;  2FKB A;  3R03 A;  3DUP A;  3DKU A;  5GHJ A;  1XSA A;  1V8V A;  2KDW A;  2A8Q A;  1RRQ A;  3Q93 A;  2I8U A;  3Q91 A;  1PUQ A; 
#chains in the Genus database with same CATH topology
 2YYH A;  3Q2T A;  1V8Y A;  3EXQ A;  3FCM A;  4V14 A;  3X0J A;  1G9Q A;  2PQV A;  2YVN A;  3O6Z A;  5ANW A;  1MP2 A;  5FSI A;  4IJX A;  5FSM A;  2JVB A;  3EES A;  3GZ5 A;  2FVV A;  2I6K A;  3GZ8 A;  3GWY A;  5CFI A;  4JZV A;  3COU A;  5GHM A;  5FSL A;  1XSC A;  1SZ3 A;  1HX3 A;  1VC8 A;  2DSD A;  3EF5 A;  3F6A A;  4ZG0 A;  2PNY A;  5DDG A;  2O5W A;  3G0Q A;  3GG6 A;  1VCD A;  4YPR A;  1NQY A;  1PPV A;  1V8R A;  3Q1P A;  5C7Q A;  4HVY A;  1V8S A;  5DD4 A;  3E57 A;  1F3Y A;  1X83 A;  2QJO A;  2R5W A;  1R67 A;  4KTB A;  3X0M A;  5ANV A;  2CZR A;  4JZT A;  1V8U A;  4S2Y A;  2VNP A;  1XSB A;  1I9A A;  3FFU A;  1X51 A;  4ICK A;  3MCF A;  4N1T A;  5DEQ A;  3J7Y e;  3FJY A;  3WHW A;  1VC9 A;  2DHO A;  3HHJ A;  1IRY A;  3ID9 A;  3O61 A;  3P6Y A;  5ANS A;  5GHO A;  2GT4 A;  1Q54 A;  2O1C A;  5ANT A;  3FK9 A;  5BS6 A;  3FSP A;  3I7U A;  1NFZ A;  2KDV A;  1PPW A;  2FML A;  4NFX A;  5GHP A;  2I8T A;  1X84 A;  2A8R A;  2Q9P A;  2A8P A;  3SHD A;  1JKN A;  2QKM B;  3MDI A;  3P5T A;  1VIU A;  2DUK A;  2A6T A;  4JZU A;  4N1U A;  3A6T A;  3SON A;  1V8L A;  3F13 A;  2GT2 A;  3BHO A;  3O8S A;  5BON A;  3X0I A;  1U20 A;  1OW2 A;  1V8N A;  1PVF A;  3L85 A;  1NQZ A;  3MGM A;  3ACA A;  3I9X A;  3Q2S A;  3X0O A;  5DPK A;  3QSJ A;  2RRK A;  3CNG A;  2YVM A;  4S2X A;  4C9X A;  5ISY A;  1GA7 A;  5GHN A;  2A8S A;  3BM4 A;  4S2W A;  1MQE A;  3A6V A;  4C9W A;  3X0Q A;  2O5F A;  4YOQ A;  1Q33 A;  3A6S A;  4ILQ A;  5GHI A;  4KG4 A;  3X0P A;  2G74 A;  4NFW A;  2B06 A;  2A8T A;  3X0L A;  5HZX A;  1SU2 A;  2GB5 A;  2ICJ A;  5C7T A;  2B0V A;  3U53 A;  2J8Q A;  3I7V A;  1K26 A;  2CL3 A;  3A6U A;  1MQW A;  2XSQ A;  1V8I A;  1Q27 A;  2ICK A;  5IW4 A;  3X0K A;  1PPX A;  4J7H A;  5FSK A;  2W4E A;  1V8W A;  4HFQ A;  1VHZ A;  1MR2 A;  3RH7 A;  1NFS A;  5IW5 A;  2B2K A;  3MDG A;  3O52 A;  3OGA A;  2YVP A;  3AC9 A;  5LPG A;  4S2V A;  2AZW A;  3X0R A;  5CFJ A;  4YPH A;  3BAP A;  1VIQ A;  3EEU A;  2DSC A;  1PUN A;  1V8T A;  3N9U A;  5FSN A;  1SJY A;  4JZS A;  1MUT A;  3N77 A;  5GHQ A;  1VHG A;  3Q4I A;  3ZR0 A;  1QVJ A;  5I8U A;  1JRK A;  3GZ6 A;  2VNQ A;  1MK1 A;  4J7G A;  3GRN A;  4K6E A;  1G0S A;  1SOI A;  1HZT A;  1KHZ A;  4MPO A;  1VK6 A;  3H95 A;  4KYX A;  1KTG A;  1K2E A;  3X0S A;  2G73 A;  2QJT A;  5C8L A;  3O69 A;  3X0N A;  2YVO A;  1RYA A;  4KG3 A;  5FSO A;  1VRL A;  1PUS A;  1TUM A;  2DSB A;  3HYQ A;  1V8M A;  3KVH A;  5ANU A;  4DYW A;  1RRS A;  3ZR1 A;  3SMD A;  1KT9 A;  2FKB A;  3R03 A;  3DUP A;  3DKU A;  5GHJ A;  1XSA A;  1V8V A;  2KDW A;  2A8Q A;  1RRQ A;  3Q93 A;  2I8U A;  3Q91 A;  1PUQ A; 
#chains in the Genus database with same CATH homology
 2YYH A;  3Q2T A;  1V8Y A;  3EXQ A;  3FCM A;  4V14 A;  3X0J A;  1G9Q A;  2PQV A;  2YVN A;  3O6Z A;  5ANW A;  1MP2 A;  5FSI A;  4IJX A;  5FSM A;  2JVB A;  3EES A;  3GZ5 A;  2FVV A;  2I6K A;  3GZ8 A;  3GWY A;  5CFI A;  4JZV A;  3COU A;  5GHM A;  5FSL A;  1XSC A;  1SZ3 A;  1HX3 A;  1VC8 A;  2DSD A;  3EF5 A;  3F6A A;  4ZG0 A;  2PNY A;  5DDG A;  2O5W A;  3G0Q A;  3GG6 A;  1VCD A;  4YPR A;  1NQY A;  1PPV A;  1V8R A;  3Q1P A;  5C7Q A;  4HVY A;  1V8S A;  5DD4 A;  3E57 A;  1F3Y A;  1X83 A;  2QJO A;  2R5W A;  1R67 A;  4KTB A;  3X0M A;  5ANV A;  2CZR A;  4JZT A;  1V8U A;  4S2Y A;  2VNP A;  1XSB A;  1I9A A;  3FFU A;  1X51 A;  4ICK A;  3MCF A;  4N1T A;  5DEQ A;  3J7Y e;  3FJY A;  3WHW A;  1VC9 A;  2DHO A;  3HHJ A;  1IRY A;  3ID9 A;  3O61 A;  3P6Y A;  5ANS A;  5GHO A;  2GT4 A;  1Q54 A;  2O1C A;  5ANT A;  3FK9 A;  5BS6 A;  3FSP A;  3I7U A;  1NFZ A;  2KDV A;  1PPW A;  2FML A;  4NFX A;  5GHP A;  2I8T A;  1X84 A;  2A8R A;  2Q9P A;  2A8P A;  3SHD A;  1JKN A;  2QKM B;  3MDI A;  3P5T A;  1VIU A;  2DUK A;  2A6T A;  4JZU A;  4N1U A;  3A6T A;  3SON A;  1V8L A;  3F13 A;  2GT2 A;  3BHO A;  3O8S A;  5BON A;  3X0I A;  1U20 A;  1OW2 A;  1V8N A;  1PVF A;  3L85 A;  1NQZ A;  3MGM A;  3ACA A;  3I9X A;  3Q2S A;  3X0O A;  5DPK A;  3QSJ A;  2RRK A;  3CNG A;  2YVM A;  4S2X A;  4C9X A;  5ISY A;  1GA7 A;  5GHN A;  2A8S A;  3BM4 A;  4S2W A;  1MQE A;  3A6V A;  4C9W A;  3X0Q A;  2O5F A;  4YOQ A;  1Q33 A;  3A6S A;  4ILQ A;  5GHI A;  4KG4 A;  3X0P A;  2G74 A;  4NFW A;  2B06 A;  2A8T A;  3X0L A;  5HZX A;  1SU2 A;  2GB5 A;  2ICJ A;  5C7T A;  2B0V A;  3U53 A;  2J8Q A;  3I7V A;  1K26 A;  2CL3 A;  3A6U A;  1MQW A;  2XSQ A;  1V8I A;  1Q27 A;  2ICK A;  5IW4 A;  3X0K A;  1PPX A;  4J7H A;  5FSK A;  2W4E A;  1V8W A;  4HFQ A;  1VHZ A;  1MR2 A;  3RH7 A;  1NFS A;  5IW5 A;  2B2K A;  3MDG A;  3O52 A;  3OGA A;  2YVP A;  3AC9 A;  5LPG A;  4S2V A;  2AZW A;  3X0R A;  5CFJ A;  4YPH A;  3BAP A;  1VIQ A;  3EEU A;  2DSC A;  1PUN A;  1V8T A;  3N9U A;  5FSN A;  1SJY A;  4JZS A;  1MUT A;  3N77 A;  5GHQ A;  1VHG A;  3Q4I A;  3ZR0 A;  1QVJ A;  5I8U A;  1JRK A;  3GZ6 A;  2VNQ A;  1MK1 A;  4J7G A;  3GRN A;  4K6E A;  1G0S A;  1SOI A;  1HZT A;  1KHZ A;  4MPO A;  1VK6 A;  3H95 A;  4KYX A;  1KTG A;  1K2E A;  3X0S A;  2G73 A;  2QJT A;  5C8L A;  3O69 A;  3X0N A;  2YVO A;  1RYA A;  4KG3 A;  5FSO A;  1VRL A;  1PUS A;  1TUM A;  2DSB A;  3HYQ A;  1V8M A;  3KVH A;  5ANU A;  4DYW A;  1RRS A;  3ZR1 A;  3SMD A;  1KT9 A;  2FKB A;  3R03 A;  3DUP A;  3DKU A;  5GHJ A;  1XSA A;  1V8V A;  2KDW A;  2A8Q A;  1RRQ A;  3Q93 A;  2I8U A;  3Q91 A;  1PUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...