3GZ5A

Crystal structure of shewanella oneidensis nrtr
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
218
structure length
214
Chain Sequence
QLLTVDAVLFTYHDQQLKVLLVQRSNHPFLGLWGLPGGFIDETCDESLEQTVLRKLAEKTAVVPPYIEQLCTVGNNSRDARGWSVTVCYTALMSYQACQIQIASVSDVKWWPLADVLQMPLAFDHLQLIEQARERLTQKALYSLVPGFALSEPFTLPELQHVHEVLLGKPIQGKSFRRRVEQADLLIDTGLKRTPANLYCLKPDTASYRFLRNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords MutT/nudix family protein
publication title Structure and function of an ADP-ribose-dependent transcriptional regulator of NAD metabolism
pubmed doi rcsb
source organism Shewanella oneidensis
total genus 60
structure length 214
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gz5A02
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3gz5A01
2A6TA 3SHFA 2Y75A 1R5GA 1S6LA 4C9WA 4EJVA 3FM5A 2QLZA 3I5UA 4KUMA 4HV5A 3LA3A 3Q91A 2EA4A 2XIGA 3V4GA 3NRVA 4RGSA 4F7ZA 3TDUC 4ZYEA 1VK6A 2VBZA 1O3QA 3KEQA 3A6TA 5FSKA 3L9FA 1KYZA 3I7UA 5C7TA 1SD6A 1USSA 1FNNA 3NQOA 1IN6A 3WGHA 3QU3A 1I9AA 3FX3A 5CYVA 5L3DA 2DFIA 4L9TA 3L85A 4KIFA 3F22A 2OA4A 3LSTA 1O7LA 3ZMZA 3SHDA 1TTYA 4U7DA 2BGCA 5IT3A 4EJTA 1NFSA 3O6ZA 5HS9A 1LDDA 5FO5A 4WCGA 3ZR1A 1V8LA 3KP2A 5F64A 4MQVA 1ZGJA 4UUVA 4YG2F 3TKYA 3SXYA 2GB5A 3KVHA 1KU7A 1ZREA 3CUQB 2DI3A 3X0OA 4O5VA 1R1TA 4EJOA 5L3CA 3HHGA 1KA8A 4M9XA 1G4DA 3COUA 1E2XA 3ISPA 5K5QA 5JR3A 1HKTA 5C7QA 2OQGA 4C9XA 1PPXA 4S04A 5ANTA 2LDUA 3A6SA 2XAGA 4YFKF 4BAYA 2KIFA 1XGSA 4O3MA 3BROA 5ISYA 4M73A 3TDZC 1U6GA 2TDXA 5ED4A 2AS5F 1YIOA 5LEJA 1BOAA 3QRFF 5BMZA 4L0YB 1S29A 1DDNA 4KMFA 3T8RA 1LDKB 2F5CA 1PP8F 1WKMA 2JPCA 1ON2A 1IXRC 2L4MA 4Y17A 3X0PA 2HQRA 1JGSA 1BM9A 1A04A 4ENKA 1YG2A 4BXUA 3J81Z 4Q5SF 5HDGA 5L3GA 4AIKA 3I0TA 2K7LA 1B4AA 3E5QA 3VODA 2Z99A 4Y15A 3LFKA 3CO6C 4MEYF 1OPCA 4G9YA 4ZYDA 3X0QA 5H20A 1HBXG 2HEOA 1GXQA 4OU0A 2L01A 4IRGA 2NYXA 1FPQA 4H0EA 3KP6A 1V8YA 3ML6A 4PGGA 3FMRA 1MGTA 3HRTA 2FBIA 3M1EA 2PQVA 1GXPA 2M45A 2KIMA 3Q2TA 5D5UB 5IT9Z 3I7VA 4CO8A 1QZZA 3F13A 3LAJA 1RIOH 5L3BA 1HW1A 2JT1A 1SJYA 5HZXA 4LG0A 1FOKA 4RB3C 1HQCA 2E1CA 3FXUA 2NNNA 2G7UA 2O8XA 2BBYA 1QVJA 3I58A 3MDIA 5ILUA 1VIUA 4IF4A 1TQPA 3C3WA 1QO0D 1U78A 3R03A 3ERED 2IA2A 5LHHA 1B9MA 2YPRA 2QUFA 3HOSA 5E1XA 5GHPA 1K78A 1P4XA 2MLGA 3U1DA 1V8NA 1YS7A 1JHFA 1Z6TA 2DTRA 2FNPA 4G7ZF 1V8WA 4ON0A 2FXAA 2H94A 4PCQA 5D6FA 3MZHA 3J7Ye 4OIRF 5HLHA 3EXQA 5FSIA 5LRSA 1PUEE 4KFCA 2WWYA 3PQKA 1U8RA 3FFUA 1NFZA 2HDCA 1YQAA 1RRQA 3KP5A 2GXBA 5GHNA 3WTZA 4P55A 1XSBA 3MZYA 4MGRA 3LA7A 4S2WA 1L0OC 3FXRA 3F21A 3FZVA 2DBBA 3V8JA 3Q4IA 5CVRA 2RVCA 2YYHA 4EJUA 2STWA 2ESNA 5DD4A 2A68F 1BI1A 3V7SA 3CUOA 2IP2A 5DV5A 4ZYHA 2D1VA 2O6GE 4HF2A 1R5HA 3Q9VA 4I7HA 3VFZA 2RC4A 3F3XA 3O2PE 1K7AA 5K5OA 1VTNC 2EFWA 3U53A 4EV0A 3WTWC 2COMA 4KIGA 4I0BA 2VT2A 2VNPA 5ILSA 2FF4A 3FWEA 1SFEA 2MH2A 1I5ZA 5FSMA 4YPRA 2BEOA 3IKVA 3EESA 5JVTA 2ICKA 1QZYA 3I9XA 3E6BA 3JTHA 4HDVA 3FCMA 1PUNA 1RZ4A 5E8GA 1XGNA 4LMYA 3F23A 2WV0A 2QYOA 1PDNC 4CYDA 1W4MA 1FWZA 5E8IA 1U5TC 3EF5A 3U9GA 3ZMSA 4A2UA 4HVYA 2EK5A 5LGUA 5FSOA 3J7AO 5D4RA 4ESJA 1O3RA 3IRRA 3TQNA 4LGWA 5LLQA 1HKSA 1WQ2A 3TO9A 1VCDA 5CVUA 5CVIA 4CXFA 3WTYC 4PZJA 1LEBA 2KRFA 4LG0B 2KIUA 2Z3YA 1T6SA 4AWXB 4ENMA 4L0ZB 1FZPB 2BV6A 3V8KA 4UVAA 1YS6A 3QP5A 1I6XA 2RDPA 2XSQA 1REPC 3RPQA 1AOYA 4YIFA 3C18A 1RYAA 4MQ9F 3H95A 2ELHA 2PN6A 3BM4A 3JSOA 3O8SA 1USTA 3F6OA 2EB7A 1XGOA 2VBYA 3ULQB 2GXGA 2D2WA 1IXSB 4RAZA 1WI9A 1K78B 5LGNA 3L7WA 5E1ZB 3IKTA 2B0VA 4M71A 2IPQX 3GG6A 1IN7A 3JAMZ 2C6YA 5ICFA 1MP2A 4KYXA 1XCVA 2CG4A 3BWGA 3I59A 1K2EA 4PGHA 1ZRCA 3HHHA 4FX0A 3MCFA 2ZO4A 1QNTA 1W5SA 2DU9A 5D5WB 4I2OA 1F9NA 2FRHA 4PDKA 4BQAA 2EFOA 2FBKA 3IL2A 3E97A 2KJCA 3Q9SA 3X0LA 2A6HF 1R23A 2E7WA 3ELKA 2P6SA 4NFWA 2ZBKA 4M9ZA 2IVMA 5C8LA 4A0YA 1LEAA 4IRIA 1JRKA 3ZMUA 1UHWA 3QU6A 4HOBA 4MTEA 2PNYA 4HX4A 3R60A 4EGYA 1G3SA 2CQKA 4UVCA 2HQNA 2Z9OA 5ANUA 3DKUA 4L5JA 4M9SA 1BJAA 5DCMB 2L4AA 2VC0A 4KIBA 2B2KA 1EH6A 3REOA 3K1PA 2ZNYA 5H6RA 5E18F 2MA3A 5IW4A 3GZ5A 4E70A 3F6VA 3E5XA 5FLXK 1ULYA 3B02A 3GFLA 1SMYF 3QPTA 3X0JA 2L3DA 2F5DA 5CJ9A 3V7CA 1ZN2A 2JRTA 2O3FA 5DEQA 2IT0A 2DSBA 2DK5A 2JZYA 5GHOA 3ZPLA 2VODA 1WWXA 2MC3A 4ZH4F 2I8TA 1TLHB 2STTA 5FFZA 2ZKZA 1LJ9A 2KKOA 2IRFG 2MD5A 2UXXA 5F6FA 3S2WA 4EQQA 3TOAA 4HBLA 5LRRA 3ZN1A 2ZJ2A 1KU2A 1JE8A 4WK8F 1O7FA 1HXDA 2JSCA 4UV8A 4G7OF 5ANVA 1IRFA 4XRFA 3SONA 1SD7A 2PMUA 2AZWA 2QKMB 2MBFA 2W84A 1MDMB 5FB2A 4ZG0A 2YU3A 2GA1A 4LK1F 1G9QA 2BYVE 3WODF 4L9NA 1IN4A 4P9UA 3LAPA 1V3FA 2EWNA 1XCBA 1YO5C 4A5MA 1NQYA 2A5YB 3DQVC 3PQJA 4LD5A 3D5LA 1CGPA 2LNBA 3RPUA 4KTBA 5LHIA 4GO1A 5EEHA 2G7HA 4UNOA 3DUPA 3EUHA 5A2QK 2HZTA 3A6UA 1RRSA 2RKHA 1DPRA 2J8QA 1NHAA 3I64A 3OGAA 5F1RA 2OZUA 4DQ2A 4KG4A 2G73A 1H9GA 3SQNA 2K02A 1IN8A 1W5TA 3F72A 1FSEA 2OBPA 4OIPF 2WC2A 1MJAA 2YVPA 5AONA 3KLOA 3I59B 4D0PA 2EV5A 4Y13A 2CL3A 3RKWA 2DUKA 1VHZA 2HOEA 3M8FA 3HSEA 2XAQA 1KU9A 1H9TA 3O6BB 1QQIA 3F8BA 2UXNA 5AIQA 2HKXA 1XSVA 2CWEA 4HQMA 4UHTA 4A12A 3L00A 4KT5C 4M72A 1BI3A 2VN2A 1KGSA 4GGGA 1S8NA 2KJBA 5LGTA 3HHJA 2VOOA 2B06A 1RUNA 3KP3A 3G3ZA 1SU2A 1TUMA 1U20A 3R0AA 3P9CA 4QLCU 4WXHA 4OIQF 3GRNA 2ETHA 1MJBA 1CF7A 1XMKA 2R7DA 5I8UA 2GIVA 4YPHA 3BPVA 3X0IA 2XKPA 4HV6A 5BPIA 4G6QA 4L9JA 1E17A 1VHGA 4BHBA 1J0RA 3BJAA 4UVBA 2W25A 1WSUA 1J5YA 4I0AA 3V7RA 4LB5A 4ENJA 3WTUC 1H0MA 5BONA 4P5OA 1O57A 5CVVA 3DFGA 2DO7A 4RGRA 4WWCA 1J7KA 1YTYA 3P5TA 1U5TA 1LDJA 4B09A 1D8KA 3GYHX 1YW7A 2A69F 1T0FA 1C0WA 1HSJA 2J5OA 4IJXA 2OZ6A 2JVBA 1UB9A 1T38A 2YR2A 5HDKA 3T8TA 4YOQA 5LHGA 4JQFA 3EQLF 2HTJA 3DV8A 3TGNA 2NNYA 5ICEA 1V8VA 3RH7A 1QGPA 3J81K 1TQIA 2DK8A 1HW2A 5GHMA 2A3SA 1JKNA 2KDVA 4KMUX 1QPMA 4G6DA 3G73A 3K1NA 3C1DA 1V8IA 3KP7A 2GWRA 3O69A 5D8LB 3BZ6A 2LF7A 3ACAA 4GYGA 2G9WA 1FLIA 1P4WA 2G74A 2PMHA 2P5VA 5GHQA 1FBQA 1RI7A 3KZZA 3J80K 3QP6A 1PUQA 4AVPA 3MQ0A 1ZH5A 2RGVA 2QM3A 2P7VB 2DW4A 4N9IA 3HSFA 2DSCA 1V4RA 4U0WA 1Z1DA 3CLOA 2QQ9A 2Q8KA 4HQEA 2PJPA 2VBXA 3MEXA 4A6EA 3WE2A 2IA0A 3GW2A 4OIOF 1IF1A 1F3YA 1V8TA 1T2KA 3FXQA 3VEPA 3EDPA 4CDGA 2DLLA 3R4KA 3R6SA 3BJ6A 4HAMA 1YW8A 3GFJA 4LLGF 3N97A 1R7JA 2HKOA 3KCCA 1F5TA 4CICA 5L3EA 1HW5A 4ESBA 3HSRA 1IZ1A 3ZP5A 4HF1A 4ILQA 3E3VA 1Q33A 4L5IA 5BQTA 4MNUA 2ZXJA 2H27A 2PI0A 3BPXA 3COAC 2HWVA 2R7FA 1PPWA 4ZYGA 3HOTA 1I27A 3F8FA 4ICKA 2ZNZA 4KDPA 1VRLA 2V79A 4LFUA 1XSXA 1O3TA 1LVAA 1X84A 4K6EA 2VNQA 3SZPA 3GXOA 2YSRA 5DUIA 2QBYA 3LA2A 1SAXA 4RGUA 2VXZA 3BJOA 3GEZA 1B9NA 5D8KB 4EM0B 1SFXA 4R8HA 3TOBA 1I1GA 1R00A 3MCZA 1BC7C 2A8TA 3RIRA 4IHTA 3MFKA 3GZ8A 3BAPA 2O1CA 2FE3A 2NRAC 2A8PA 2PG4A 2YVMA 5J8FA 1CF7B 5CLSA 3N77A 3FMQA 5BOXA 1GA7A 3ZMDA 5FD6A 3KETA 4IJAA 3BP8A 2XRNA 3HIFA 4I09A 3B73A 2V1DA 2O5FA 2H6BA 2LSOA 4EMSA 2VE9A 4CHUA 5FGMA 2FQ3A 3D0SA 3P9KA 1X3UA 5K1YA 1U5TB 2Y48A 5LBQA 1X83A 3GFIA 3Q1PA 1D8JA 1ODDA 4HFQA 3ECHA 5IW5A 3M7GA 2XASA 2QVOA 2P5KA 1U3EM 3M9AA 3RKXA 2ADUA 2BE5F 4U88A 2KDWA 2EV6A 5AIPA 4U0YA 4A6DA 2YX4A 1Q54A 4YFXF 4A0ZA 5FFXA 1BI2A 1S3JA 1KYWA 1KQ9A 1K79A 3O61A 1KQ8A 2NS0A 4KA4A 3FHZA 1KU3A 1BIAA 2HS5A 4IHSA 2K4JA 1UFMA 2FSWA 1J9IA 3GWZA 5HVQC 2QZ8A 5DD8A 3DKWA 1V8UA 5K5RA 3I71A 3E6MA 4RB2C 3F8MA 4OMYA 1P2FA 5ANWA 1VIQA 1R58A 3KZYA 3WU0A 3K0LA 1LQ1A 1SFUA 1KTGA 1OW2A 2A61A 1BIBA 1OR7A 1VC8A 1XSAA 1T98A 3ZMTA 4ZZLA 3FSPA 1NQZA 1UCRA 1ZG3A 3RYRA 1BC8C 2Z5UA 2GT2A 5D4SA 1OYWA 2XVCA 3CJNA 3Q2SA 3WTXC 4TV7A 1LNWA 5DDGA 4ZZDA 4S2VA 1XSCA 3CTAA 1U2WA 3GO5A 4RAYA 5HDNA 1FYLA 1Z05A 3KFWX 3LWFA 4IVNA 4CZZA 3WGIA 2V1UA 4BYYA 1MUTA 3F8CA 2A07F 3X0KA 3DP7A 5HS7A 3QAHA 2ESHA 5DUKA 1GHCA 1DUXC 2XAJA 3HRSA 2FKBA 4B8XA 4YFNF 1YW9A 3RJPA 3ZQ7A 1ZG5A 2GZWA 3E6DA 4FX4A 4JZVA 4L18B 2O03A 2K86A 4CGZA 4FHTA 2D1HA 2E7XA 1PP7U 2A8QA 1UHMA 1P92A 1BN5A 1FBUA 1XDUA 1ZHFA 4Q4ZF 2Q0OA 3RI4A 1EH7A 4I98B 2JTVA 3PFIA 3TO7A 5HS8A 4EM1A 4K2EA 4KICA 5D6EA 3JSPA 2V9VA 4ENNA 4IPAA 3K1MA 3K2ZA 4S2YA 2W85A 5A2QZ 5CFJA 2Q9PA 4S2XA 2DPUA 3SZTA 3VB2A 2FMYA 1P6RA 3HRUA 1J2XA 1TBXA 5LEKA 3DEUA 3E5UA 2VONA 3G0QA 3KE2A 3HYQA 5FD5A 4N0BA 2HR3A 3KP4A 2FA5A 5HLIA 2DAOA 2FEZA 3T5XA 2CYYA 2VOPA 4NFXA 2QJOA 3A6VA 2XHKA 4GXOA 1D3YA 3DPTA 1RUOA 5D5XB 2ZMEA 4LB6B 3IC7A 1FYKA 1EH8A 2FMLA 4YIIA 4WXDA 3ABUA 4G94A 4RGXA 4HX8A 2HFHA 3X0MA 1P4AA 2I6KA 3Q93A 3ROUA 2QWWA 2PBIA 2ZCWA 5ILVA 3GVAA 3X0RA 3WGGA 4DNCA 4IXAA 4MPOA 2O0YA 2WTEA 1Z91A 4OINF 1J59A 3CUQC 4LLNA 1IUYA 2P6TA 1STZA 1D5VA 4HLXA 4BH9A 3GZ6A 1AWCA 2M8EA 3EYIA 1MZBA 3IRQA 1IXCA 1SMTA 4JBAA 3HTSB 1YYVA 3SFZA 4OOIA 1K6OA 1Q1HA 2PFBA 2EA2A 4M6XA 1FC3A 1FP1D 2O61A 2QENA 2JPBA 2M30A 1F4KA 2HTSA 3BDDA 3DPLC 2PQ8A 1MR2A 4HYEA 3WU1B 4N1UA 2M1BA 3FK9A 3I4PA 3H3ZA 3RKYA 1MJ9A 3AC9A 1B59A 4ASNA 2MH9A 2OD5A 3F8NA 3Q5FA 3CO7C 3N4MA 2W24A 5GHIA 3AAFA 1ZRFA 2L54A 4AIJA 1KQ0A 2DSDA 3LQQA 4P9FA 4BHPA 1ZG1A 1G0SA 4KG3A 3KLNA 1XB4A 1OYYA 2P8TA 5CVJA 5JHUA 2P5LC 5FSNA 2FOKA 2HYFA 1WRJA 1IW7F 3L2CA 4UV9A 3J80Z 4G7HF 4N1TA 1JHHA 2DQRA 2R5WA 2FNAA 2K27A 3WG9A 1MK1A 4EVIA 5J8CA 3O3KA 2F5EA 2H6CA 4N9HA 1MQEA 3WTSC 1DP7P 3P9IA 5BPDA 3HTUA 2B0LA 2ISYA 1W7PD 4GCVA 5DPKA 1V8MA 1BBYA 2MLKA 1IRYA 4HW0A 4Z2YA 1S7AA 1KT9A 3RTRA 1IN5A 3WTTC 2A8RA 2X0LA 1YFHA 1T39A 1FX7A 1PPVA 3SMDA 4KYWA 4KN4X 4A5NA 2W57A 4S05A 5TRDA 1TNTA 2OAZA 4NHJA 2Y0MA 3GLXA 4RB0A 5FSLA 2ZMEB 4Q47A 4XSZF 3HYIA 3IHUA 2Q2EA 3BY6A 1Z6RA 3GX4X 2GA2A 5ICCA 5IT9K 4XLPF 2L02A 3N9UA 5KK1A 1W7PA 2RNJA 1MQWA 2V6CA 3M8EA 4NB5A 2XV4S 1ONVA 4HZFA 3L09A 4L9VA 2FVVA 1ZLJA 1R22A 1ZYRF 3W6JB 1I1SA 5CFIA 3BHOA 3WE3A 1V8SA 1S7OA 4DYWA 4G8XA 1DPUA 3CDHA 4HA8A 3GF2A 2QQBA 1R1UA 5TJJA 3DF8A 2RN7A 3FF5A 2DHOA 3R61A 3GWYA 4MTDA 5E1WA 2P4WA 4FT8A 4HLYA 3DXJF 2I8UA 2E1NA 2Z33A 2RQPA 3QOPA 2D45A 2VBWA 2CO5A 3CNGA 1PVFA 1R36A 4QWQA 1O3SA 1OYIA 1SD5A 2A8SA 1PUSA 5KVRA 5DCFA 1G6NA 1RNLA 1IAWA 3P6YA 4XBFA 3HUGA 4UXNA 4WX9A 2CFXA 4XLNF 2FBHA 1R67A 2UZKA 3T1BA 2EFNA 3P7NA 2YVNA 2ISZA 5DCMA 2R3SA 5GHJA 3GFMA 1XGMA 1X51A 4R1HA 4HX7A 3ID9A 3KEOA 4AIHA 2XROA 4LK0F 2ZFWA 2DT5A 3X0NA 1ZAOA 2IJLA 5D5VB 1JXSA 4NQWA 2DPDA 2M5WA 3GUDA 1OMIA 2NAZA 4RB1A 4EGZA 2HYGD 3WTVC 1EV7A 3BOQA 2K4BA 1Z7UA 1GVJA 3TO6A 2OU2A 1F1ZA 1MKMA 1BI0A 1G3YA 2F5FA 3T0YA 2DQLA 2YVOA 3V8LA 2EJRA 5ANSA 2CW0F 1FBSA 1G3TA 2GQQA 2IW5A 4JZTA 4P96A 1ZRDA 2CSOA 4I01A 3LQRA 2QJTA 3R0JA 1ZLKA 4EJWA 1K26A 2YX7A 3U2RA 1FSHA 4MEXF 2XAHA 5L3FA 4U0VA 1R1VA 4R79A 4M74A 1KHZA 1B6AA 3C7JA 4JK1X 4KNYA 5HOOA 3EEUA 1IRGA 3FMSA 2LF8A 1MDMA 5H6QA 4BNCA 1TQMA 2QQAA 3FM3A 2XUBA 1G3WA 2RRKA 5DYMA 4JZSA 2CGPA 2ICJA 1FY7A 2A6EF 2VT3A 2OQRA 3IWFA 3HRMA 1QBJA 3RYPA 3ABTA 5HLGA 3CUQA 2HGCA 3W6KB 1FP2A 1FT9A 2O5WA 1XMAA 2EFQA 5E20A 4Q48A 1XD7A 5JFRA 1ZARA 4O6JA 3MGMA 1B1BA 4EM2A 4LJZF 1OKRA 3ZR0A 3H92A 6PAXA 2XGXA 1W7PB 5JI6A 5EEGA 4U7BA 2RV8A 4GYIA 4JZUA 4MHGA 4WF2A 1Y0UA 2XAFA 5FLXZ 2UWMA 2VC1A 1Q27A 2X4HA 1FYMA 1HKQA 4OMZA 4WXCA 3OOPA 3K9TA 4ETSA 1ZGAA 1XDSA 1HSTA 2P7CB 2M87A 2H09A 2GAUA 1LB2A 1J75A 1MD0A 3H3UA 4RS8A 2QBYB 1Z9CA 1SZ3A 2LKPA 3WHWA 4LLLA 5LPGA 2F2EA 5BS6A 5ICGA 3QSJA 4KN7X 4HDUA 3IWZA 3RDIA 4A0XA 2PLYA 3E6CC 2XKOA 3EYYA 5J6XA 3JAMK 2ACJA 3E57A 2EFPA 4XSXF 3X0SA 3F6AA 3NEUA 3JTGA 1TW2A 3MWMA 1TNSA 1TW3A 1SD4A 4I02A 1HX3A 3JW4A 3EETA 5E17F 2W4EA 2EV0A 4M6YA 4ESFA 1XN7A 4V14A 3ZN0A 2V1XA 3I54A 4IRHA 3ECOA 3FJYA 1ON1A 2J5PA 2FU4A 2IA1A 2VE8A 2AXLA 1V8RA 3ZMVA 4BHCA 3K69A 4HF0A 2PEXA 1VC9A 1XSDA 5ERIA 3VOEA 2GT4A 3O52A 3MAJA 1L3LA 1HZTA 3QPHA 3MDGA 3OV8A 4AD9A 3I53A 1YLFA 1SOIA
chains in the Genus database with same CATH superfamily
1PVEA 2A6TA 3SHFA 2KMUA 2Y75A 1H88C 3E0JB 1R5GA 2MD0A 1U8BA 2KHMA 2YS9A 3CC4I 1S6LA 4QPQA 4C9WA 4EJVA 3FM5A 2QLZA 3H0DA 2R5YB 3I5UA 1RKWA 1VQ7I 4KUMA 4HV5A 1XX5A 3LA3A 2EIMH 4F55A 1LFUP 3A2KA 4MFEA 3Q91A 2CV1A 3M1CA 1GUUA 3C2HA 2MYSA 2EA4A 2XIGA 5F08A 2DN0A 3V4GA 3NRVA 4RGSA 1T08B 4BQOA 4F7ZA 2R7WA 2ZJQF 3H5RA 3OIQA 3TDUC 4ZYEA 1VK6A 2EIKH 3CMEI 2VBZA 1O3QA 3PUBA 1K83J 3KEQA 3A6TA 5FSKA 1R4NB 3HC7A 3L9FA 4JOMA 1KYZA 3I7UA 5C7TA 1SD6A 1USSA 4II2A 4HG2A 1FNNA 1SANA 2ZXIA 3NQOA 1IN6A 3CCQI 3WGHA 3M07A 3QU3A 1I9AA 1JKOC 2L9RA 3FX3A 5CYVA 5L3DA 2DFIA 4L9TA 3L85A 4KIFA 3F22A 3OR2C 2OA4A 3LSTA 3B6CA 4FISA 1O7LA 3ZMZA 3SHDA 1TTYA 4U7DA 2XPWA 2BGCA 5IT3A 2W4SA 4EJTA 2HZDA 1NFSA 3O6ZA 5HS9A 1LDDA 5FO5A 4WCGA 5E3OA 3ZR1A 1V8LA 3KP2A 5F64A 2ZB9A 4MQVA 1ZGJA 4EEFG 1UJ8A 2V4JC 4UUVA 4YG2F 3TKYA 2CJJA 3SXYA 2GB5A 2CUJA 4XIDA 1KU7A 3KVHA 2EH3A 1ZREA 3BG9A 3CUQB 4UUSA 2AQFA 4X0GA 2R4GA 2JVHA 2DI3A 3X0OA 4F52A 4O5VA 1R1TA 4EJOA 5L3CA 3HHGA 1KA8A 4M9XA 1G4DA 4DW6A 3COUA 1E2XA 3ISPA 5K5QA 5JR3A 1HKTA 3ZQIA 2OQGA 5C7QA 4C9XA 2BW3A 1YJNI 1PPXA 4S04A 2LBFA 3IH2A 1IC8A 5ANTA 3GTPJ 2LDUA 2FX0A 3A6SA 2XAGA 4BKXA 4YFKF 1VQ4I 4BAYA 2KIFA 2O7OA 1XGSA 2ELKA 2DA2A 3CP2A 3BROA 4O3MA 4PK4A 1IRZA 5ISYA 4M73A 2W82A 3TDZC 4DBQA 2WB1A 1U6GA 3TW6A 2QSGX 2TDXA 2V9PA 4NUBA 5ED4A 2DDBA 1WJDA 2OF7A 2AS5F 1YIOA 5LEJA 2BXYA 1BOAA 3QRFF 5BMZA 4RAFA 2X6WA 4L0YB 1S29A 1DDNA 4KMFA 1N25A 2HYJA 3T8RA 2HQ5A 4AC0A 2QKLB 1LDKB 1MSFC 3AFHA 2F5CA 2KP6A 3H9QA 1PP8F 2VQHA 1WKMA 3G1MA 2JPCA 2FJ1A 3V42A 4D1QA 4XONA 1ON2A 1IXRC 3LSRA 4GDFA 1WJFA 2L4MA 3ESWB 4DBRA 1LPQA 2A5WA 4Y17A 3QOEA 2I8DA 1QU3A 3X0PA 2HQRA 5F1JA 1JGSA 2MW8A 1JGGA 1BM9A 1A04A 4ENKA 1YG2A 3BG7A 4BXUA 3J81Z 5HDGA 4Q5SF 4C3HJ 3NWSA 3FXLA 1U0JA 2R5ZB 1TL8A 2ECBA 1W36D 5L3GA 4AIKA 3ERMA 3I0TA 5HNFA 2K7LA 4NC8A 1B4AA 1FTZA 3E5QA 4ZYAA 2VIXA 3VODA 1MBJA 2Z99A 3LFKA 4Y15A 3CO6C 4MEYF 1OPCA 4G9YA 4ZYDA 1MMGA 3X0QA 5H20A 1HBXG 2H8RA 2HEOA 2L7KA 1GXQA 4OU0A 4JYKA 2CQXA 2EQRA 4V2GA 3DTEA 1PUFB 2L01A 2KLOA 4IRGA 2Y0SA 2NYXA 1FPQA 3GTGJ 3S32A 1OCTC 4F91B 4H0EA 3KP6A 1V8YA 3JCUC 1X2NA 3ML6A 4PGGA 2NVYJ 2VQLA 3FMRA 1MGTA 3HRTA 2FBIA 3M1EA 2PQVA 1GXPA 2E2JJ 2M45A 4F3QA 2KIMA 1FIAA 5J47A 4A93J 4IL6C 3Q2TA 3BTJA 2LG4A 2HXOA 5H2FC 1B8IB 5D5UB 1IG7A 5IT9Z 3I7VA 4CO8A 4HEA2 3OWTA 1QZZA 1TWAJ 3F13A 3LAJA 1RIOH 3RCOA 5L3BA 4UY8I 4BXXJ 5JLWA 2V1NA 4NC6A 3DKYA 1OCOH 2VQCA 2VPLA 1HW1A 2JT1A 2VJJA 1SJYA 1G8XA 5HZXA 2I5UA 2PMZA 4LG0A 1QA6A 1FOKA 1QPIA 2D5VA 2E2HJ 4RB3C 3KEYA 1HQCA 1OQYA 3CCYA 5C3EJ 2E1CA 3FXUA 3D5RC 3S2HJ 3ZRGA 1ZR4A 2KT0A 2NNNA 5FRNA 2L7MP 2G7UA 4BY1J 2O8XA 2BBYA 1QVJA 3I58A 4BDZA 3MDIA 5ILUA 1VIUA 4IF4A 1TQPA 4XN3A 3C3WA 1W1WE 2XF6A 1QO0D 1U78A 3K10A 3R03A 4PSXA 1Z3YA 1G2HA 4FE4A 2IA2A 5LHHA 3J7YJ 3ERED 1B9MA 2YPRA 2HOAA 1IJWC 2QUFA 1MMSA 5GTHC 3HOSA 5E1XA 5GHPA 4E4HA 3OYLA 1P4XA 1K78A 1D5YA 2MLGA 3U1DA 1V8NA 4E7HA 1YS7A 3K4BA 3GTKJ 5EZHA 2B63J 4AYBN 3BTLA 1JHFA 1CQTA 1AA7A 1Z6TA 1ZQ3P 2L7ZA 2DTRA 2FNPA 4G7ZF 1V8WA 4ON0A 2FXAA 2H94A 4PCQA 1S5LC 5D6FA 3MZHA 3K70D 3ZQQA 4XORA 1A36A 2OPTA 2ZXHA 1T33A 3J7Ye 4OIRF 5HLHA 3EXQA 2V6EA 1V5GA 1YE9A 3Q0UA 5FSIA 5LRSA 1PUEE 1U9OA 4XKWA 4UUSB 4KFCA 2WWYA 1X2MA 2AHQA 4XKCA 1ETYA 4IEJA 3PQKA 5KHDA 1U8RA 3FFUA 2O8KA 1NFZA 2HDCA 2V26A 1YQAA 2XGDA 3IUOA 1RRQA 4BS9A 3KP5A 1QHHD 2GXBA 5GHNA 3TMOA 2B9SA 3WTZA 2BW3B 4P55A 2DA4A 2LBFB 1XSBA 3MZYA 4MGRA 5HODA 2E19A 3MD2A 3LA7A 4S2WA 5J1UA 2CQ7A 3OSGA 1L0OC 3FXRA 2H1LA 3F21A 4KISA 3S1MJ 1D1BA 1TP4A 3FZVA 2DBBA 3V8JA 3Q4IA 4E7ZA 5CVRA 1YRNB 2RVCA 1D1AA 2YYHA 4EJUA 3NAUA 2STWA 2ESNA 1MBHA 5DD4A 1JJ6C 2A68F 4G12A 1BI1A 2EZKA 3V7SA 3CUOA 2DJIA 4J7GA 2IP2A 5DV5A 4ZYHA 2D1VA 2EBIA 2B7EA 1XTAA 2O6GE 4HF2A 1R5HA 3Q9VA 4I7HA 3VFZA 2RC4A 1DU6A 5CQEA 3F3XA 3OS2A 3O2PE 1WJ5A 1K7AA 5K5OA 1VTNC 2EFWA 3U53A 4EV0A 3WTWC 5J3LA 2COMA 1WJCA 4DOZA 4KIGA 4I0BA 2VT2A 5M5XJ 3TW7A 2HPIA 2M34A 2VNPA 1MNDA 5ILSA 2FF4A 2K9QA 1BR1A 3C2BA 2UUZA 3OL3A 3FWEA 1VQKI 1SFEA 2MH2A 5C44J 1YJWI 2NOJB 1I5ZA 3L2QA 2JSPA 2K3PA 5FSMA 3OOUA 4YPRA 2K3FA 2LY1A 4OWRB 2MSYA 3K4LA 2BEOA 2NXNB 5IPAA 2F48A 2VPRA 3IKVA 3LSIA 3EESA 2DMUA 2JMWA 2KISA 5JVTA 2ICKA 1QZYA 3I9XA 3E6BA 3JTHA 1DGRM 2Y2ZA 4HDVA 1XG1A 3FCMA 3HKZA 1PUNA 1RZ4A 5E8GA 1M1EB 1XGNA 3QODA 3AL0B 1J09A 1N75A 4LMYA 3F23A 2WV0A 2QYOA 2GOMA 3S17J 1G59A 1PDNC 3CCSI 3OYMA 4CYDA 4C2MJ 1W4MA 4B1RA 2DXIA 1FWZA 2R7RA 5E8IA 4IHWA 2CUZA 3OYNA 3NARA 3CJQB 1I6HJ 1U5TC 3ZCOA 4E6KG 2LD5A 3EF5A 3U9GA 3ZMSA 4A2UA 4HVYA 3OYFA 2EK5A 5LGUA 5FSOA 1TT0A 4C30A 3J7AO 5D4RA 5IYBJ 4ESJA 1O3RA 3FXKA 3FK6A 3IRRA 1TWCJ 4DYCA 1IRXA 1I3AA 1I50J 5E3LA 3TQNA 1Z77A 4LGWA 4B4CA 5LLQA 1HKSA 1WQ2A 3GBGA 2Y30A 4BGDA 4HNVA 2LFBA 3TO9A 1VCDA 5CVUA 1A31A 5CVIA 4CXFA 3WTYC 4PZJA 1LEBA 3KYCB 3FBNB 2KRFA 4LG0B 2KIUA 1MMAA 2Z3YA 1T6SA 2E36A 2VKDA 4AWXB 4ENMA 1QZEA 4L0ZB 1FZPB 2BV6A 3JRIA 3DU6A 4UVAA 2M8GX 3V8KA 2X6OA 2H1KA 1YS6A 3QP5A 1I6XA 2RDPA 3Q0VA 1X1AA 3LSMA 2WAQA 2XSQA 3GMEA 1SVOA 3L1PA 1REPC 3RPQA 2CRGA 2LC2A 1AOYA 4YIFA 3C18A 1RYAA 4A3DJ 2OC6A 4MQ9F 3H95A 2ELHA 2PN6A 3BM4A 4E7KA 3JSOA 3VPRA 3O8SA 1USTA 4A69C 3F6OA 2EB7A 4PJNA 1XGOA 2VBYA 5CKTA 3RZDJ 1V5FA 1T56A 1D0ZA 3ULQB 3TEDA 3BG3A 2GXGA 2D2WA 1IXSB 4RAZA 1WI9A 1GV2A 1YX3A 3HPHA 3DBLB 3CCVI 1S72I 1K78B 5LGNA 3L7WA 5E1ZB 3IKTA 2R7UA 2JJ7A 2B0VA 4M71A 1LVKA 3BCBA 2IPQX 3PFYA 4BBSJ 3GG6A 1IN7A 4XN0A 4ZJZA 3G4SI 3JAMZ 2C6YA 1SFOJ 3CJRB 3K6GA 3ZQHA 5ICFA 1VQ6I 1MP2A 4KYXA 1XCVA 4BU2A 4EATA 2CG4A 2F5VA 3BWGA 3I59A 2NVTJ 1K2EA 1F36A 1X58A 4PGHA 1ZRCA 1ZGWA 2CH0A 3OIPA 2W48A 2ELJA 3HHHA 1BL0A 4IKFA 4FX0A 3MCFA 2ZO4A 4CCOA 1AKHA 1X1BA 1QNTA 1W5SA 4RDUA 4PUSA 4FASD 2DU9A 5D5WB 1ZKGA 4I2OA 1F9NA 2FRHA 4PDKA 4BQAA 1HDPA 5EGOA 2R7ZJ 1BW5A 2EFOA 2FBKA 3IL2A 4RAGA 3E97A 2KJCA 3Q9SA 2G0EA 3X0LA 3H3VK 1Q1VA 2A6HF 1R23A 2E7WA 3ELKA 3OL4A 2P6SA 3BTIA 5J40A 4CYCA 2GBYA 2ZBKA 4NFWA 4M9ZA 1SEUA 1HDDC 4OAYA 3BR1A 2IVMA 5C8LA 1TWGJ 4A0YA 1ETXA 5IP7J 2YUSA 2HU9A 2JUGA 1LEAA 5J4YA 3VYTB 4IRIA 1JRKA 3ZMUA 3S3MA 1UHWA 3QU6A 4HOBA 4Y3OA 2E60A 3PNVA 2BHZA 1MBKA 3MZ8A 4MTEA 3U21A 1GT0C 2PNYA 4HX4A 3R60A 4EGYA 1G3SA 2CQKA 3PSFA 1OFCX 4UVCA 2HQNA 3CMMA 2Z9OA 3HUGB 3WHCA 3DKUA 5ANUA 1JI8A 4L5JA 4RA2A 2X48A 2XGEA 4M9SA 3TBIA 1BJAA 1MSEC 2GM4A 2YU9J 5DCMB 2K85A 2L4AA 2VC0A 4KIBA 2B2KA 1EH6A 5M3MJ 3H9GA 3REOA 5E3MA 2AQEA 2W1OA 3K1PA 2ZNYA 2HPMA 5H6RA 5E18F 2L9NA 2MA3A 4L5EA 4B3AA 1NK3P 5IW4A 3KYLA 3GZ5A 1QVUA 4IZZA 4E70A 2VB6A 3F6VA 4BQNA 2DMNA 3E5XA 4BE0A 4E7JA 1A35A 3OYGA 5FLXK 1ULYA 3B02A 3GFLA 1SMYF 3QPTA 3LSKA 3X0JA 1JUSA 1R5ID 2L3DA 4C3JJ 2OJED 5KAIC 4HNUA 3OYIA 2F5DA 5TGTA 5CJ9A 3V7CA 1ZN2A 2JRTA 2O3FA 2DA1A 4CCMA 5DEQA 2X85A 2W7NA 1E3PA 2VUMJ 2IT0A 2BY2A 2DSBA 2DK5A 2JZYA 5GHOA 5EG0A 3RPUD 4Z6YA 1MNMC 5TISC 4JX4A 3ZPLA 4D7NA 2VODA 1WWXA 3HOZJ 3SEZA 3FKIJ 1VNDA 2MC3A 4ZH4F 3VYUB 4D5CA 2I8TA 1TLHB 2STTA 5FFZA 2FOWA 2ZKZA 1LJ9A 4IX7A 1N78A 4Y52J 2KKOA 2IRFG 2MD5A 2UXXA 3MN2A 4PJJA 5F6FA 4KT6A 3S2WA 4EQQA 3TOAA 4M3GA 4HBLA 3IAM2 5LRRA 1V5EA 3ZN1A 2ZJ2A 1KU2A 1JE8A 3J7ZI 1D0XA 3GTQJ 2HNHA 4BY7J 4WK8F 2KDOA 1O7FA 3W2VA 1HXDA 2JSCA 4UV8A 1LFBA 2VJIA 3AG3H 4G7OF 1BA5A 5ANVA 3W2WA 1IRFA 4BBRJ 4XRFA 5IYDJ 1SD7A 2PMUA 1W0UA 2AZWA 3SONA 4PJLA 3PNTA 2QKMB 2MBFA 2W84A 1MDMB 1MW7A 2MGQA 2QGUA 5FB2A 1X1PA 2JA5J 4ZG0A 2YU3A 2GA1A 4LK1F 5CPRB 2BYVE 1G9QA 1VQLI 3RZOJ 4DJAA 1LKXA 3WODF 3JRBA 4L9NA 1IN4A 1S7EA 4P9UA 3LAPA 1V3FA 2CQNA 2DT6A 2EWNA 2QSFX 3UNGC 2R7XA 1XCBA 4XQFA 1YO5C 2IEKA 4A5MA 1NQYA 2A5YB 3DQVC 3PQJA 3H5AA 4LD5A 4XLCA 5K7ZA 3D5LA 3ABMH 4PSWA 1CGPA 4NBQA 2LNBA 2EINH 3FHNA 3RPUA 4KTBA 5LHIA 4GO1A 5EEHA 4KITB 2G7HA 4UNOA 3DUPA 3EUHA 5A2QK 2HZTA 3CMAI 3Q0WA 3A6UA 1RRSA 3L2VA 2E1OA 2RKHA 1DPRA 4C2UA 2R0QC 5J1YA 2J8QA 1NHAA 2WY7Q 3I64A 2DYRH 3OGAA 5F1RA 2OZUA 5GTIC 4A3LJ 1NK2P 4DQ2A 4KG4A 2G73A 3L2WA 2E1MC 4BE1A 4V19K 1H9GA 1MMNA 3SQNA 1OR7C 1IN8A 2K02A 1W5TA 3F72A 3ZXSA 1FSEA 2OBPA 3LSGA 4OIPF 2WC2A 2M7BA 3QWLA 1MJAA 2YVPA 5AONA 3KLOA 3I59B 4D0PA 2JA8J 2ME6A 2EV5A 4Y13A 5EYRA 3H0GJ 1P7JA 4H4KC 4J01A 5FKLA 2CL3A 3RKWA 2DUKA 4XK4A 1VHZA 2HOEA 3M8FA 3S14J 3HSEA 2XAQA 1KU9A 3EUKL 1H9TA 3GLLA 3O6BB 1QQIA 2L5QA 1WI3A 5M5WJ 3F8BA 1Y1VJ 2UXNA 5AIQA 2HKXA 1XSVA 1ZK8A 2CWEA 4HQMA 4UHTA 4A12A 3PJRA 3L00A 3K4CA 4KT5C 2KPMA 2Y0SN 4M72A 2CZRA 2DMPA 1BI3A 2VN2A 1X3ZB 1KGSA 1WJEA 4GGGA 1S8NA 2KJBA 5LGTA 4CYCB 3CD6I 2VOOA 3HHJA 1MIJA 2B06A 2JUCA 2LP0A 1RUNA 3KP3A 2VLAA 3K4NA 3G3ZA 1SU2A 1TUMA 1U20A 2RREA 3R0AA 1P7IA 3P9CA 1NTCA 4ABZA 3BR6A 4WXHA 4D7MA 4QLCU 3G71I 1Y39A 4OIQF 3GRNA 1GVDA 2CFOA 2ETHA 1MJBA 4ZC3A 1CF7A 1XMKA 2OTLI 2CV0A 2R7DA 3EUAA 5I8UA 2GIVA 2M7AA 4YPHA 3BPVA 3OMYA 3HDDA 2VXDA 2XKPA 3X0IA 4HV6A 5BPIA 2LH9A 4G6QA 4L9JA 1E17A 1MMDA 1VHGA 4BHBA 2CUFA 2VI6A 2X6YA 4RM3A 1J0RA 3BJAA 4UVBA 1MH3A 3WU2C 2PMZN 2W25A 1MBEA 1A6QA 4MO7A 1WSUA 1J5YA 1LUJB 1U9NA 2Q1ZB 4I0AA 3V7RA 1IDYA 3JRHA 1LE8A 3BR5A 4LB5A 3PL8A 4ENJA 3RQIA 3WTUC 1H0MA 2DFFA 5BONA 2DCEA 1O57A 4P5OA 5CVVA 4MIMA 4BJ5C 3DFGA 2DO7A 1VQPI 1E0EA 4RGRA 4WWCA 1J7KA 1TWFJ 1YTYA 3P5TA 1U5TA 2BVLA 1LDJA 4B09A 1D8KA 5M5YJ 3MKZA 3GYHX 1YW7A 2A69F 2FQ4A 1T0FA 2JA7J 1C0WA 1IDZA 1HSJA 2J5OA 3GTOJ 3BR0A 4YELA 2OZ6A 4IJXA 2JVBA 2JWTA 1D0YA 1UB9A 1T38A 1JKPC 2WAFA 3BLYA 2YR2A 1DU0A 5EG0B 5HDKA 5F27A 3T8TA 1VF9A 3SDGA 4YOQA 4B48A 5LHGA 4JQFA 3EQLF 2QSHX 1K6YA 1AHDP 3ZQGA 2DFHA 2EZHA 2HTJA 1ETOA 1WJAA 3DV8A 3TGNA 3VYRB 5ICEA 2NNYA 1V8VA 2OTJI 3RH7A 2IGOA 2GOXB 1QGPA 3DPUA 2COBA 1TQIA 3J81K 2DK8A 2DYSH 5DTDA 1HW2A 2A3SA 2E35A 2X1CA 5GHMA 4BJ6C 2KDVA 1JKNA 4KMUX 1QPMA 3DU5A 4G6DA 3G73A 1BW6A 4M3BA 4B44A 3K1NA 2CV2A 3C1DA 1V8IA 3IH4A 4E7LA 3KP7A 2GWRA 3O69A 5D8LB 5KAFC 3BZ6A 2LF7A 3A4CA 2O9LA 3ACAA 4GYGA 2G9WA 1FLIA 1P4WA 1P9QC 2G74A 5JHFA 2PMHA 2P5VA 5GHQA 1FBQA 1IV6A 1AU7A 1RI7A 3KZZA 5B66C 3J80K 1JKRC 2VKVA 3QP6A 4XKBA 3SDBA 1PUQA 3HZJA 4AVPA 3MQ0A 5HNHA 1ZH5A 2H8WA 4BJTA 1R71A 2RGVA 2QM3A 1X1CA 4X6AJ 2P7VB 1Y8RB 2X1EA 2DW4A 4N9IA 3HSFA 3S1NJ 2DSCA 1V4RA 4U0WA 4IQ4A 2DFEA 1Z1DA 3CLOA 2QQ9A 2Q8KA 3KX2A 4HQEA 4W1UA 5M3FJ 1K4TA 2PJPA 5FKMA 2VBXA 3MKYB 3QPSA 1X4OA 3EUHC 4LG3A 3MEXA 3PM1A 4A6EA 3WE2A 2IA0A 1POGA 3GW2A 2E71A 4IOCF 4CCKA 4OIOF 3P5JA 1IF1A 3CF5F 1F3YA 1V8TA 3JRAA 1IUFA 2JQ7A 1KZHA 3FXQA 3VEPA 1T2KA 3EDPA 4CDGA 2DLLA 3R4KA 1Y6IA 4LIUA 4BE2A 3R6SA 3BJ6A 4HAMA 1YW8A 3GFJA 3SZGA 2NVXJ 1HC8A 4LLGF 3N97A 2VL8A 3A01A 1R7JA 2HKOA 1FMVA 3KCCA 5HLTA 2BHYA 1F5TA 4CICA 2X51A 5L3EA 1A5JA 1FIPA 1HW5A 4ESBA 3HSRA 1JT6A 1IZ1A 3ZP5A 4HF1A 4ILQA 3E3VA 1Q33A 4L5IA 1YHQI 5BQTA 4MNUA 2ZXJA 4C9YA 1I3QJ 4YRVA 2H27A 3MKLA 2PI0A 1RR7A 3BPXA 3COAC 4HPQA 2HWVA 2R7FA 1PPWA 3OR1C 4ZYGA 2A05A 3HOTA 1I27A 3CLQA 3UKGA 3F8FA 4ICKA 2ZNZA 4KDPA 1VRLA 2V79A 4LFUA 1XSXA 1ZTRA 1O3TA 1LVAA 1X84A 1ZELA 4NC7A 4K6EA 2VNQA 3SZPA 2BOLA 4QIWN 4X1EA 3GXOA 2YSRA 5DUIA 2KZGA 4CCJA 2QBYA 3DBRB 3LA2A 1SAXA 4N4OB 3HKZN 4RGUA 4CSWA 2VXZA 3BJOA 3GEZA 4E7IA 1B9NA 3LSHA 4B43A 1E3HA 4RLFA 3W3CA 5D8KB 4J00A 4EM0B 1GV5A 2IGNA 1UAAA 1SFXA 3GZNB 4NNJA 4R8HA 1I1GA 1R00A 3TOBA 3MCZA 1BC7C 3VSLA 2L2OA 3HGYA 1QRYA 2QA4I 2A8TA 3RIRA 4IHTA 3MFKA 3ZQFA 3GZ8A 2R7VA 5EZGA 3BAPA 2O1CA 2ZJRF 2FE3A 2NRAC 2A8PA 2PG4A 4XL9A 2Y9ZA 2YVMA 5J8FA 4W97A 2E2IJ 4ZDPA 3S2DJ 3IAS2 4BDYA 2WAEA 3A1YA 3VSKA 1CF7B 1WH5A 2KRHA 2DOAA 4LOCA 3OSFA 2DTZA 1SVLA 5CLSA 4BQQA 3N77A 2DA7A 1K4SA 3FMQA 3BT9A 5BOXA 1GA7A 4GFBA 2ZSIB 3ZMDA 1FOXA 5FD6A 3KETA 2MG4A 4IJAA 1YIJI 3BP8A 3CJTB 2XRNA 5IYCJ 5IP6A 3ONQA 2OCEA 3HIFA 1X1DA 3C2GA 4I09A 4J19A 3B73A 1LE8B 2V1DA 2O5FA 1EKEA 3HPGA 4JX5A 4AIDA 3DTIA 2H6BA 3SYTA 2WAQN 4F92B 2LSOA 1E3OC 4LIVA 5B1BH 4EMSA 3ASNH 2VE9A 4CHUA 5FGMA 1JUPA 2FQ3A 2QF7A 3D0SA 1MBFA 3P9KA 4RM2A 3FK7A 1T0FC 1X3UA 1X19A 2MC4A 5K1YA 1U5TB 2Y48A 2ID3A 5LBQA 1X83A 3GFIA 2DA5A 2VJ5A 4IHYA 3Q1PA 5CQGA 1ODDA 1D8JA 5GAHJ 3ECHA 4HFQA 2NOGA 2P81A 5KCMA 3KIOA 3BQYA 3NWTA 5IW5A 3M7GA 2XASA 2QVOA 2CS3A 1MNEA 2P5KA 2RQQA 4FE7A 3M9AA 1U3EM 1HOMA 3RKXA 2ADUA 2BE5F 3LL7A 2HQAA 2M9HA 3BG5A 2IBDA 4U88A 2KDWA 2EV6A 5AIPA 2F4OB 4U0YA 3DEWA 4A6DA 3IP4B 3BTCA 2YX4A 2IS4A 1Q54A 4YFXF 2LREA 1VQMI 4A0ZA 5FFXA 1BI2A 2IXSA 1S3JA 1KYWA 3M4OJ 1KQ9A 2XSDC 1K79A 3LOCA 3O61A 4DIQA 4QPOA 1YOVB 1KQ8A 1RESA 1OCCH 3PNYA 4ITVA 2NS0A 4KA4A 3FHZA 1KU3A 4FCYA 3F9KA 1ZR2A 1BIAA 2HS5A 4IHSA 2K4JA 2RNGA 1UFMA 2EZIA 2FSWA 1J9IA 3CESA 3GWZA 2BVMA 5HVQC 2QZ8A 5DD8A 3DKWA 1V8UA 2EZLA 1BJZA 3I71A 4PFOA 5K5RA 2GXAA 4F93B 1R9TJ 3E6MA 2AXTC 4RB2C 3F8MA 4OMYA 1P2FA 4XOPA 5ANWA 2V7FA 1R58A 1VFCA 1VIQA 3KZYA 4QTRA 4M3DA 2ME0A 5GP9A 3WU0A 3K0LA 1LQ1A 1SFUA 5GAGJ 2TCTA 3OIOA 4N4NB 1KTGA 1ETVA 1OW2A 2A61A 2JA6J 3LMMA 1BIBA 5FJ8J 1OR7A 1YI2I 3CF2A 5B3SH 2E5ZA 1VC8A 1XSAA 3A0BC 3BZCA 1T98A 4G6TB 3ZMTA 4B3XA 4ZZLA 3B6AA 1NQZA 3FSPA 2Y69H 1UCRA 4A3CJ 1Z7LA 3DWLE 1ZG3A 1SFKA 4XM3A 3HOVJ 3RYRA 1BC8C 2R92J 2Z5UA 2GT2A 5D4SA 3PIPF 1OYWA 2L7FP 2XVCA 3CJNA 3Q2SA 1XC5A 3ZR8X 3WTXC 4TV7A 1LNWA 2IS1A 5DDGA 4ZZDA 2XSJC 4S2VA 1XSCA 3CTAA 3PSIA 1U2WA 3UR3C 4IQJA 1JTYA 3GO5A 4RAYA 5HDNA 1FYLA 1Z05A 3KFWX 3LWFA 4IVNA 4M3FA 2LKXA 4CZZA 3WGIA 2V1UA 4S0HB 4BYYA 2DA3A 1FOWA 2NS7A 1MUTA 1A6IA 2OUMA 3F8CA 2DJNA 2A07F 3X0KA 3DP7A 1HCRA 2ZXWH 5HS7A 3S1RJ 3QAHA 2ESHA 5DUKA 1GHCA 1DUXC 2XAJA 3AKZA 3HRSA 2FKBA 3FISA 4B8XA 4YFNF 1YW9A 2NVQJ 3RJPA 3ZQ7A 1X3WB 1JT0A 4IOAF 1WJBA 1ZG5A 4CUGA 2GZWA 3FIWA 3E6DA 3A0HC 4UB8C 4FX4A 2V9KA 4XRSG 4JZVA 4L18B 2O03A 2K86A 3LFUA 4CGZA 2W00A 3K7AJ 4FHTA 2D1HA 3FXJA 2E7XA 1FMWA 1PP7U 3ZGKA 1UELB 2A8QA 1S9HA 1GLNA 3I55I 1FOYA 2R7SA 3H9JA 1UHMA 1P92A 1BN5A 1FBUA 4CA0A 5FRMA 1XDUA 2E5NA 1ZHFA 3CDIA 4Q4ZF 2Q0OA 2AO9A 3RI4A 5K7FA 1I39A 2KFDA 4JP0A 1EH7A 1BR4A 3L2UA 1RR8C 4I98B 3BR2A 2JTVA 3PFIA 3LSJA 4BUPA 1R6RA 3TO7A 5GPAA 1OCPA 2ZSHB 5HS8A 3VYSB 4EM1A 2Y9YA 3KZIC 4K2EA 4Y33A 4FTHA 2FUG2 4A3FJ 1OCZH 2GIZA 3DTKA 4KICA 5F0HA 1T95A 4A3EJ 5D6EA 1WCMJ 3JSPA 2V9VA 4ENNA 4IPAA 3K1MA 3K2ZA 4S2YA 2W85A 5A2QZ 5CFJA 4C2TA 2Q9PA 2DOEA 2LY9A 2L9VA 4ANJA 2DPUA 2F6CA 4S2XA 1K61A 3SZTA 3VB2A 4AM3A 3FDYA 1ETKA 2FMYA 3ASOH 1P6RA 5F0CA 2PX9A 3HRUA 1J2XA 1TBXA 5LEKA 3DEUA 3E5UA 2VONA 3RSNA 3G0QA 3KE2A 4P1WA 3HYQA 5FD5A 5EF6A 1QVTA 4N0BA 2HR3A 3KP4A 2FA5A 2HOSA 5HLIA 1JJ8C 3ABKH 1ENHA 2DAOA 4DGWB 2FEZA 3T5XA 2CYYA 2VOPA 2BXZA 1ACIA 2QJOA 3A6VA 4NFXA 3AG1H 2XHKA 1UG2A 4GXOA 4DYRA 1D3YA 2JN6A 1APLC 3DPTA 2HVSA 4ZDLA 2ZJPF 1RUOA 3TP0A 5D5XB 2ZMEA 4LB6B 2XRLA 3IC7A 2M0CA 1FYKA 2DMTA 1EH8A 2FMLA 3PIOF 4YIIA 4WXDA 1WFXA 1OCRH 3ABUA 3CCLI 4IHVA 3FKJA 2VKHA 2LYCA 3ZQCA 4G94A 5J1RA 2LMDA 2WADA 4II3A 4MFDA 2WB1N 4RGXA 4HX8A 4XNFA 2Z16A 2CW7A 2HFHA 4AVZA 3X0MA 1P4AA 3S3NA 2LR8A 2QEXI 2I6KA 1WZ2A 2R7TA 3Q93A 3ROUA 3Q3SA 2BZTA 2QWWA 2PBIA 1EA3A 2ZCWA 5ILVA 3GVAA 3X0RA 3WGGA 2WA0A 4DNCA 5BNGA 4IXAA 3JRCA 4A3MJ 2O0YA 4MPOA 3HOWJ 2WTEA 1Z91A 2E34A 4OINF 1J59A 3CUQC 4LLNA 2XPVA 3L2RA 1IUYA 2P6TA 2BY1A 1STZA 2E1MB 4IO9F 1IO2A 2TRTA 1ERDA 3HOXJ 1D5VA 1YJ9I 4HLXA 2JK3A 4BH9A 3GZ6A 1AWCA 4AU7A 2M8EA 3BR3A 5K7HA 3JREA 1FEXA 3EYIA 2ECCA 3CCEI 4I6ZA 1AKHB 2K5CA 5GAEJ 1MZBA 1JKQC 3IRQA 1IXCA 1SMTA 4JBAA 1Z21A 3HTSB 3HJEA 1YYVA 3SFZA 4OOIA 3QYBA 1K6OA 1Q1HA 2PFBA 2EA2A 3ZQLA 4M6XA 1TWHJ 1FC3A 1FP1D 2XDVA 2O61A 5EGOB 1YRNA 2QENA 4JX6A 5LFAA 3I3LA 2JPBA 4BEHA 1Y56A 2M30A 3U1KA 3OYDA 2LRDA 1F4KA 2HTSA 3BDDA 3DPLC 3IV5A 2PQ8A 2XB5A 4XRMA 1BOBA 1B72A 3PO3J 1MR2A 1D1CA 4HYEA 3WU1B 5B1AH 4N1UA 2M1BA 3FK9A 1OJLA 3I4PA 3H3ZA 3OS1A 3RKYA 1MJ9A 3AC9A 1B59A 1ORKA 4ASNA 2MH9A 3HBLA 2XAUA 2OD5A 3F8NA 3Q5FA 2M3AA 3CO7C 3N4MA 2EPFA 2W24A 2CW8A 2M4GA 5GHIA 3AAFA 1ZRFA 2BY3A 2L54A 4AIJA 1KQ0A 2DSDA 3LQQA 4P9FA 1SC7A 2L0KA 4KJZA 4BHPA 1VI0A 3VDXA 1ZG1A 3I4NJ 1G0SA 4KG3A 4AUXA 3KLNA 1KONA 1XB4A 1OYYA 3CP8A 4MLOA 1W5CC 1HA8A 2LK2A 1RC9A 2P8TA 5CVJA 3RKQA 1BR2A 3HXLA 3QPLA 5JHUA 2P5LC 1MBGA 5FSNA 1DGWY 2FOKA 2HYFA 2DA6A 1WRJA 2HDWA 3OYEA 2PJRA 3PO2J 1IW7F 3L2CA 1TC3C 4UV9A 2VASA 1JUMA 4NDLA 4GRIA 3J80Z 4G7HF 4N1TA 1JHHA 3QYFA 2KQRA 2DQRA 4CCLA 3LSPA 2R5WA 3EPZA 5IOYA 2FNAA 2K27A 3G2BA 3WG9A 1WGXA 1UMQA 5IP9J 3OS0A 3HOUJ 2XF5A 3MKWB 1WPKA 1MK1A 4EVIA 4UB6C 2QCOA 5J8CA 3O3KA 4A3GJ 1XS9A 2F5EA 2H6CA 4N9HA 3OY9A 1MQEA 3WTSC 4BACA 1VZ0A 2DT7B 5E3NA 1DP7P 5JLXA 3P9IA 5BPDA 1Y1WJ 3BCAA 3K4MA 3HTUA 3FXOA 2B0LA 2ISYA 1LFPA 1W7PD 5IOZA 1VQNI 4CH7A 2MABA 4GCVA 5EEAA 3SJMA 5DPKA 1V8MA 2GLOA 1BBYA 1Y8QB 2MLKA 1IRYA 4HW0A 4Z2YA 4UUTA 4HSTA 1S7AA 1KT9A 3RTRA 1IN5A 3WTTC 2A8RA 2X0LA 3VWBA 4M6VA 3S15J 1YFHA 3IH3A 3O8GA 1T39A 1FX7A 1PPVA 2LY2A 3SMDA 4KYWA 3K4JA 1MH4A 3GTLJ 4KN4X 4A5NA 4Y7NJ 2RAEA 2W57A 3CZ6A 4ZTFA 1NG6A 4PJ0C 1ITYA 2ZMEC 3DBHB 4S05A 3O8HA 5TRDA 1TNTA 2OAZA 1EF4A 4NHJA 1TT5B 2Y0MA 3GLXA 4RB0A 4A3KJ 1T8IA 5FSLA 5EJCA 4D9JA 2JVGA 2X6XA 3GTJJ 2ZMEB 4Q47A 4XSZF 3HYIA 3IHUA 3KYDB 1Z3XA 2Q2EA 4V2FA 4BXFA 3BY6A 1NH3A 2NS8A 3M3YJ 3QQAA 1Z6RA 3RQ4A 3GX4X 4J7HA 4RMNA 2R93J 4XMYA 3JRFA 2GA2A 5ICCA 4XRSA 1HF0A 2K9MA 3MVPA 1N77A 5IT9K 3LNQA 2R7OA 4XLPF 3OYKA 4XLFA 2K9LA 2L02A 2QQ8A 3HB9A 3N9UA 1RKTA 5KK1A 1YITI 2K9NA 1Y0NA 1ETWA 5FLMJ 2WBMA 4RBOA 5FLVA 1W7PA 2VQGA 3HG9A 2N8GA 2RNJA 1MQWA 2V6CA 3H35A 3G1OA 3M8EA 2M0MA 4NB5A 2XV4S 1ONVA 2HI3A 3L09A 4HZFA 4L9VA 2FVVA 2I10A 1ZLJA 1R22A 1ZYRF 3W6JB 1I1SA 5CFIA 3AG2H 3WE3A 3BHOA 2DODA 1V8SA 1S7OA 4DYWA 2VKEA 4HRIA 4XLAA 4G8XA 4FQGA 1DPUA 3CDHA 4HA8A 1SAUA 3CDLA 3GF2A 2LTPA 2QQBA 5KNLA 3A03A 1R1UA 1ETQA 5TJJA 5IY5H 3DF8A 2RN7A 2NVUB 3BC8A 3FF5A 2DHOA 3R61A 3GWYA 3GCMA 4MTDA 5E1WA 1EJ9A 3DLAA 2P4WA 3CC2I 4FT8A 4AYBA 4HLYA 3DXJF 2CUEA 3CCJI 2XGCA 3S16J 4I99C 2I8UA 2E1NA 2Z33A 1DQUA 2RQPA 2F4MB 5C4XJ 3QOPA 2D45A 1V54H 2DMQA 4YEJA 3J7AY 1R49A 2VBWA 2CO5A 4HSRA 4BEHB 3N05A 1TZLA 3QYEA 3CNGA 1PVFA 1R36A 4QWQA 1B72B 3DEEA 1OYIA 3OYHA 1O3SA 1SD5A 2XC7A 2KL4A 2HOTA 2A8SA 1X4PA 1PUSA 1UG0A 3H5NA 4PFPA 5DCFA 5KVRA 5GADJ 1G6NA 1RNLA 1Z67A 3K2AA 4XBFA 1RRJA 1IAWA 3P6YA 3HUGA 4UXNA 2JRMA 4WX9A 2CFXA 4XLNF 3SFIA 2FBHA 3JRGA 5DM7F 1R67A 2CMPA 2MFZA 2UZKA 1JTXA 3T1BA 2EFNA 3P7NA 2YVNA 2ISZA 4RLQA 5DCMA 2R3SA 5GPCA 5GHJA 3HEFA 3GFMA 1XGMA 3DLLF 4XLEA 1X51A 4R1HA 4HX7A 4XKVA 3ID9A 3GTMJ 3KEOA 4XR6A 3HM5A 4AIHA 1OLTA 4LK0F 2XROA 3S3OA 2XB0X 4ZDOA 2ZFWA 2WY8Q 2K9SA 4I76A 2DT5A 3X0NA 1ZAOA 2IJLA 2IGMA 5D5VB 3DCFA 2HVQA 1JXSA 4NQWA 2DPDA 2M5WA 1W0TA 4Y4RA 2M4KA 3GUDA 1OMIA 2NAZA 4RB1A 4EGZA 2LLKA 2HYGD 4A3IJ 2JA2A 4D5FA 3WTVC 1EV7A 3BOQA 2K4BA 2PJRB 3AL0C 1Z7UA 1GVJA 4CCNA 1XMXA 2OU2A 1F1ZA 1MKMA 3TO6A 3I9V2 5EDNA 1BI0A 2HDDA 1G3YA 2F5FA 3T0YA 5J4VA 4XOTA 3CQZJ 5LD2C 2F4IA 5FKKA 2DQLA 3BZKA 2YVOA 5F0FA 3V8LA 2EJRA 2OCCH 5ANSA 2CW0F 1V55H 2R5YA 1FBSA 1G3TA 2LOOA 2GQQA 3BG6A 2IW5A 4JZTA 4P96A 1ZRDA 2CSOA 4I01A 4OAZA 3LQRA 1PYVA 2QJTA 3R0JA 1ZLKA 4EJWA 2R7QA 4A3JJ 1K26A 3H36A 2YX7A 3U2RA 1UHSA 1FSHA 4MEXF 2XAHA 5L3FA 4U0VA 3OYAA 1R1VA 4R79A 4XICA 3FBIB 4M74A 3I56I 1KHZA 1B6AA 2VJ4A 3C7JA 4JK1X 1W36C 4KNYA 5HOOA 3KPHA 3EEUA 2KIQA 1IRGA 3FMSA 2LF8A 4DZPA 3S93A 2IAIA 5B5EC 1MDMA 3S1QJ 5H6QA 3CMYA 4BNCA 2KRCA 4A3BJ 2ZFUA 1TQMA 4C3IJ 3MMYB 3CCMI 3H1CA 2QQAA 3FM3A 5FKNA 3D5SC 2XUBA 4PJMA 1G3WA 3F0CA 2RRKA 4CZCA 5JVGF 5DYMA 3G1LA 2IS2A 4JZSA 2XPUA 4LITA 2CGPA 2ICJA 1FY7A 4ZTJA 2A6EF 2VT3A 2OQRA 3M8JA 3IWFA 3TP3A 2KDZA 3HRMA 2Q2EB 1QBJA 3RYPA 1RPWA 3ABTA 2EIJH 5HLGA 1RETA 2DOFA 3CUQA 2HGCA 3W6KB 1VQ8I 3DKXA 1FP2A 3JRDA 5DM6F 2L9SA 1FT9A 2O5WA 1XMAA 2EFQA 5E20A 4Q48A 1XD7A 5JFRA 1ZARA 2XF7A 1HLVA 2X9DA 2HXIA 2IGKA 4O6JA 3MGMA 1O4XA 1F43A 1B1BA 3ABLH 2UV1A 2Z1DA 4EM2A 3CCUI 4LJZF 1OKRA 2DDAA 1FJLA 3ZR0A 3SEQA 3H92A 6PAXA 2XGXA 3A01B 2LVSA 3W6VA 1W7PB 5JI6A 5EEGA 2ID6A 2RV8A 4U7BA 4GYIA 2IS6A 4JZUA 4MHGA 4WF2A 5FKOA 2FD5A 3I4MJ 1Y0UA 1Z0XA 2XAFA 5FLXZ 3JR9A 2UWMA 2LKSA 2VC1A 1GDTA 1SVMA 1Q27A 3A02A 2X4HA 9ANTA 1FYMA 1HKQA 1VQOI 1NG7A 4OMZA 4WXCA 2OV7A 1XPXA 3OOPA 3K9TA 1PJRA 3WG7H 3CCRI 3OYCA 4ETSA 3K4KA 1ZGAA 4DYQA 4HNTA 1WVRA 1XDSA 1HSTA 2P7CB 3X2QH 2M87A 2H09A 4M3EA 2GAUA 1LB2A 1J75A 4E7SA 4BL0B 1MD0A 3H3UA 3OYJA 1WH7A 4RS8A 3ZOBA 1WHUA 2QBYB 1Z9CA 1SZ3A 2LKPA 1OISA 3WHWA 4LLLA 5LPGA 3E7LA 2F2EA 4U87A 5BS6A 5ICGA 2O5RA 1UZCA 4KN7X 3QSJA 4HDUA 2R5ZA 5E79C 3IWZA 2Y31A 3RDIA 1VQ9I 5FROA 3S8PA 4A0XA 2PLYA 5F04A 3E6CC 2XKOA 2HVRA 4FETA 3EYYA 5J6XA 2WV1A 2M2EA 3HGGA 3JAMK 2ACJA 3E57A 2EFPA 4XSXF 3CC7I 3K70C 3X0SA 3HL2A 3F6AA 3NEUA 3JTGA 1H89C 3D1NI 4B47A 1TW2A 3MWMA 1TNSA 1TW3A 1SD4A 4I02A 1VQ5I 2K40A 4IHXA 4DZJA 2ICWG 4QSHA 1HX3A 3PUFA 3JW4A 3EETA 1PUFA 3HOYJ 5E17F 2W4EA 3FXMA 5DS9A 2EV0A 3AG4H 3TL4X 1QHGA 4M6YA 4ESFA 1XN7A 2P0WA 4V14A 3E1SA 3ZN0A 2V1XA 3I54A 2KZVA 4IRHA 1FTTA 3ECOA 3FJYA 1ON1A 2J5PA 2FU4A 2IA1A 2VE8A 2AXLA 1DP3A 2Z2SB 1V8RA 3ZMVA 4BHCA 3K69A 4XLHA 1YX5A 3W2AA 4HF0A 1B8IA 2X1DA 2PEXA 4NQWB 1VC9A 1XSDA 2CU7A 5ERIA 3VOEA 2GT4A 3G6EI 4YIRX 2EILH 3O52A 2CQQA 3MAJA 1H8AC 5C4JJ 1L3LA 1HZTA 3QPHA 3MDGA 3OV8A 1R4MB 4AD9A 1IGNA 3OYBA 3I53A 1YLFA 2BY0A 2ZC2A 3BQZA 1IV8A 1SOIA 3WHBA
chains in the Genus database with same CATH topology
2A6TA 3SHFA 2Y75A 1R5GA 1S6LA 4C9WA 4EJVA 3FM5A 2QLZA 3I5UA 4KUMA 4HV5A 3LA3A 3Q91A 2EA4A 2XIGA 3V4GA 3NRVA 4RGSA 4F7ZA 3TDUC 4ZYEA 1VK6A 2VBZA 1O3QA 3KEQA 3A6TA 5FSKA 3L9FA 1KYZA 3I7UA 5C7TA 1SD6A 1USSA 1FNNA 3NQOA 1IN6A 3WGHA 3QU3A 1I9AA 3FX3A 5CYVA 5L3DA 2DFIA 4L9TA 3L85A 4KIFA 3F22A 2OA4A 3LSTA 1O7LA 3ZMZA 3SHDA 1TTYA 4U7DA 2BGCA 5IT3A 4EJTA 1NFSA 3O6ZA 5HS9A 1LDDA 5FO5A 4WCGA 3ZR1A 1V8LA 3KP2A 5F64A 4MQVA 1ZGJA 4UUVA 4YG2F 3TKYA 3SXYA 2GB5A 3KVHA 1KU7A 1ZREA 3CUQB 2DI3A 3X0OA 4O5VA 1R1TA 4EJOA 5L3CA 3HHGA 1KA8A 4M9XA 1G4DA 3COUA 1E2XA 3ISPA 5K5QA 5JR3A 1HKTA 5C7QA 2OQGA 4C9XA 1PPXA 4S04A 5ANTA 2LDUA 3A6SA 2XAGA 4YFKF 4BAYA 2KIFA 1XGSA 4O3MA 3BROA 5ISYA 4M73A 3TDZC 1U6GA 2TDXA 5ED4A 2AS5F 1YIOA 5LEJA 1BOAA 3QRFF 5BMZA 4L0YB 1S29A 1DDNA 4KMFA 3T8RA 1LDKB 2F5CA 1PP8F 1WKMA 2JPCA 1ON2A 1IXRC 2L4MA 4Y17A 3X0PA 2HQRA 1JGSA 1BM9A 1A04A 4ENKA 1YG2A 4BXUA 3J81Z 4Q5SF 5HDGA 5L3GA 4AIKA 3I0TA 2K7LA 1B4AA 3E5QA 3VODA 2Z99A 4Y15A 3LFKA 3CO6C 4MEYF 1OPCA 4G9YA 4ZYDA 3X0QA 5H20A 1HBXG 2HEOA 1GXQA 4OU0A 2L01A 4IRGA 2NYXA 1FPQA 4H0EA 3KP6A 1V8YA 3ML6A 4PGGA 3FMRA 1MGTA 3HRTA 2FBIA 3M1EA 2PQVA 1GXPA 2M45A 2KIMA 3Q2TA 5D5UB 5IT9Z 3I7VA 4CO8A 1QZZA 3F13A 3LAJA 1RIOH 5L3BA 1HW1A 2JT1A 1SJYA 5HZXA 4LG0A 1FOKA 4RB3C 1HQCA 2E1CA 3FXUA 2NNNA 2G7UA 2O8XA 2BBYA 1QVJA 3I58A 3MDIA 5ILUA 1VIUA 4IF4A 1TQPA 3C3WA 1QO0D 1U78A 3R03A 3ERED 2IA2A 5LHHA 1B9MA 2YPRA 2QUFA 3HOSA 5E1XA 5GHPA 1K78A 1P4XA 2MLGA 3U1DA 1V8NA 1YS7A 1JHFA 1Z6TA 2DTRA 2FNPA 4G7ZF 1V8WA 4ON0A 2FXAA 2H94A 4PCQA 5D6FA 3MZHA 3J7Ye 4OIRF 5HLHA 3EXQA 5FSIA 5LRSA 1PUEE 4KFCA 2WWYA 3PQKA 1U8RA 3FFUA 1NFZA 2HDCA 1YQAA 1RRQA 3KP5A 2GXBA 5GHNA 3WTZA 4P55A 1XSBA 3MZYA 4MGRA 3LA7A 4S2WA 1L0OC 3FXRA 3F21A 3FZVA 2DBBA 3V8JA 3Q4IA 5CVRA 2RVCA 2YYHA 4EJUA 2STWA 2ESNA 5DD4A 2A68F 1BI1A 3V7SA 3CUOA 4J7GA 2IP2A 5DV5A 4ZYHA 2D1VA 2O6GE 4HF2A 1R5HA 3Q9VA 4I7HA 3VFZA 2RC4A 3F3XA 3O2PE 1K7AA 5K5OA 1VTNC 2EFWA 3U53A 4EV0A 3WTWC 2COMA 4KIGA 4I0BA 2VT2A 2VNPA 5ILSA 2FF4A 3FWEA 1SFEA 2MH2A 1I5ZA 5FSMA 4YPRA 2BEOA 3IKVA 3EESA 5JVTA 2ICKA 1QZYA 3I9XA 3E6BA 3JTHA 4HDVA 3FCMA 1PUNA 1RZ4A 5E8GA 1XGNA 4LMYA 3F23A 2WV0A 2QYOA 1PDNC 4CYDA 1W4MA 1FWZA 5E8IA 1U5TC 3EF5A 3U9GA 3ZMSA 4A2UA 4HVYA 2EK5A 5LGUA 5FSOA 3J7AO 5D4RA 4ESJA 1O3RA 3IRRA 3TQNA 4LGWA 5LLQA 1HKSA 1WQ2A 3TO9A 1VCDA 5CVUA 5CVIA 4CXFA 3WTYC 4PZJA 1LEBA 2KRFA 4LG0B 2KIUA 2Z3YA 1T6SA 4AWXB 4ENMA 4L0ZB 1FZPB 2BV6A 3V8KA 4UVAA 1YS6A 3QP5A 1I6XA 2RDPA 2XSQA 1REPC 3RPQA 1AOYA 4YIFA 3C18A 1RYAA 4MQ9F 3H95A 2ELHA 2PN6A 3BM4A 3JSOA 3O8SA 1USTA 3F6OA 2EB7A 1XGOA 2VBYA 3ULQB 2GXGA 2D2WA 1IXSB 4RAZA 1WI9A 1K78B 5LGNA 3L7WA 5E1ZB 3IKTA 2B0VA 4M71A 2IPQX 3GG6A 1IN7A 3JAMZ 2C6YA 5ICFA 1MP2A 4KYXA 1XCVA 2CG4A 3BWGA 3I59A 1K2EA 4PGHA 1ZRCA 3HHHA 4FX0A 3MCFA 2ZO4A 1QNTA 1W5SA 2DU9A 5D5WB 4I2OA 1F9NA 2FRHA 4PDKA 4BQAA 2EFOA 2FBKA 3IL2A 3E97A 2KJCA 3Q9SA 3X0LA 2A6HF 1R23A 2E7WA 3ELKA 2P6SA 4NFWA 2ZBKA 4M9ZA 2IVMA 5C8LA 4A0YA 1LEAA 4IRIA 1JRKA 3ZMUA 1UHWA 3QU6A 4HOBA 4MTEA 2PNYA 4HX4A 3R60A 4EGYA 1G3SA 2CQKA 4UVCA 2HQNA 2Z9OA 5ANUA 3DKUA 4L5JA 4M9SA 1BJAA 5DCMB 2L4AA 2VC0A 4KIBA 2B2KA 1EH6A 3REOA 3K1PA 2ZNYA 5H6RA 5E18F 2MA3A 5IW4A 3GZ5A 4E70A 3F6VA 3E5XA 5FLXK 1ULYA 3B02A 3GFLA 1SMYF 3QPTA 3X0JA 2L3DA 2F5DA 5CJ9A 3V7CA 1ZN2A 2JRTA 2O3FA 5DEQA 2IT0A 2DSBA 2DK5A 2JZYA 5GHOA 3ZPLA 2VODA 1WWXA 2MC3A 4ZH4F 2I8TA 1TLHB 2STTA 5FFZA 2ZKZA 1LJ9A 2KKOA 2IRFG 2MD5A 2UXXA 5F6FA 3S2WA 4EQQA 3TOAA 4HBLA 5LRRA 3ZN1A 2ZJ2A 1KU2A 1JE8A 4WK8F 1O7FA 1HXDA 2JSCA 4UV8A 4G7OF 5ANVA 1IRFA 4XRFA 3SONA 1SD7A 2PMUA 2AZWA 2QKMB 2MBFA 2W84A 1MDMB 5FB2A 4ZG0A 2YU3A 2GA1A 4LK1F 1G9QA 2BYVE 3WODF 4L9NA 1IN4A 4P9UA 3LAPA 1V3FA 2EWNA 1XCBA 1YO5C 4A5MA 1NQYA 2A5YB 3DQVC 3PQJA 4LD5A 3D5LA 1CGPA 2LNBA 3RPUA 4KTBA 5LHIA 4GO1A 5EEHA 2G7HA 4UNOA 3DUPA 3EUHA 5A2QK 2HZTA 3A6UA 1RRSA 2RKHA 1DPRA 2J8QA 1NHAA 3I64A 3OGAA 5F1RA 2OZUA 4DQ2A 4KG4A 2G73A 1H9GA 3SQNA 2K02A 1IN8A 1W5TA 3F72A 1FSEA 2OBPA 4OIPF 2WC2A 1MJAA 2YVPA 5AONA 3KLOA 3I59B 4D0PA 2EV5A 4Y13A 2CL3A 3RKWA 2DUKA 1VHZA 2HOEA 3M8FA 3HSEA 2XAQA 1KU9A 1H9TA 3O6BB 1QQIA 3F8BA 2UXNA 5AIQA 2HKXA 1XSVA 2CWEA 4HQMA 4UHTA 4A12A 3L00A 4KT5C 4M72A 2CZRA 1BI3A 2VN2A 1KGSA 4GGGA 1S8NA 2KJBA 5LGTA 3HHJA 2VOOA 2B06A 1RUNA 3KP3A 3G3ZA 1SU2A 1TUMA 1U20A 3R0AA 3P9CA 4QLCU 4WXHA 4OIQF 3GRNA 2ETHA 1MJBA 1CF7A 1XMKA 2R7DA 5I8UA 2GIVA 4YPHA 3BPVA 3X0IA 2XKPA 4HV6A 5BPIA 4G6QA 4L9JA 1E17A 1VHGA 4BHBA 1J0RA 3BJAA 4UVBA 2W25A 1WSUA 1J5YA 4I0AA 3V7RA 4LB5A 4ENJA 3WTUC 1H0MA 5BONA 4P5OA 1O57A 5CVVA 3DFGA 2DO7A 4RGRA 4WWCA 1J7KA 1YTYA 3P5TA 1U5TA 1LDJA 4B09A 1D8KA 3GYHX 1YW7A 2A69F 1T0FA 1C0WA 1HSJA 2J5OA 4IJXA 2OZ6A 2JVBA 1UB9A 1T38A 2YR2A 5HDKA 3T8TA 4YOQA 5LHGA 4JQFA 3EQLF 2HTJA 3DV8A 3TGNA 2NNYA 5ICEA 1V8VA 3RH7A 1QGPA 3J81K 1TQIA 2DK8A 1HW2A 5GHMA 2A3SA 1JKNA 2KDVA 4KMUX 1QPMA 4G6DA 3G73A 3K1NA 3C1DA 1V8IA 3KP7A 2GWRA 3O69A 5D8LB 3BZ6A 2LF7A 3ACAA 4GYGA 2G9WA 1FLIA 1P4WA 2G74A 2PMHA 2P5VA 5GHQA 1FBQA 1RI7A 3KZZA 3J80K 3QP6A 1PUQA 4AVPA 3MQ0A 1ZH5A 2RGVA 2QM3A 2P7VB 2DW4A 4N9IA 3HSFA 2DSCA 1V4RA 4U0WA 1Z1DA 3CLOA 2QQ9A 2Q8KA 4HQEA 2PJPA 2VBXA 3MEXA 4A6EA 3WE2A 2IA0A 3GW2A 4OIOF 1IF1A 1F3YA 1V8TA 1T2KA 3FXQA 3VEPA 3EDPA 4CDGA 2DLLA 3R4KA 3R6SA 3BJ6A 4HAMA 1YW8A 3GFJA 4LLGF 3N97A 1R7JA 2HKOA 3KCCA 1F5TA 4CICA 5L3EA 1HW5A 4ESBA 3HSRA 1IZ1A 3ZP5A 4HF1A 4ILQA 3E3VA 1Q33A 4L5IA 5BQTA 4MNUA 2ZXJA 2H27A 2PI0A 3BPXA 3COAC 2HWVA 2R7FA 1PPWA 4ZYGA 3HOTA 1I27A 3F8FA 4ICKA 2ZNZA 4KDPA 1VRLA 2V79A 4LFUA 1XSXA 1O3TA 1LVAA 1X84A 4K6EA 2VNQA 3SZPA 3GXOA 2YSRA 5DUIA 2QBYA 3LA2A 1SAXA 4RGUA 2VXZA 3BJOA 3GEZA 1B9NA 5D8KB 4EM0B 1SFXA 4R8HA 3TOBA 1I1GA 1R00A 3MCZA 1BC7C 2A8TA 3RIRA 4IHTA 3MFKA 3GZ8A 3BAPA 2O1CA 2FE3A 2NRAC 2A8PA 2PG4A 2YVMA 5J8FA 1CF7B 5CLSA 3N77A 3FMQA 5BOXA 1GA7A 3ZMDA 5FD6A 3KETA 4IJAA 3BP8A 2XRNA 3HIFA 4I09A 3B73A 2V1DA 2O5FA 2H6BA 2LSOA 4EMSA 2VE9A 4CHUA 5FGMA 2FQ3A 3D0SA 3P9KA 1X3UA 5K1YA 1U5TB 2Y48A 5LBQA 1X83A 3GFIA 3Q1PA 1D8JA 1ODDA 4HFQA 3ECHA 5IW5A 3M7GA 2XASA 2QVOA 2P5KA 1U3EM 3M9AA 3RKXA 2ADUA 2BE5F 4U88A 2KDWA 2EV6A 5AIPA 4U0YA 4A6DA 2YX4A 1Q54A 4YFXF 4A0ZA 5FFXA 1BI2A 1S3JA 1KYWA 1KQ9A 1K79A 3O61A 1KQ8A 2NS0A 4KA4A 3FHZA 1KU3A 1BIAA 2HS5A 4IHSA 2K4JA 1UFMA 2FSWA 1J9IA 3GWZA 5HVQC 2QZ8A 5DD8A 3DKWA 1V8UA 5K5RA 3I71A 3E6MA 4RB2C 3F8MA 4OMYA 1P2FA 5ANWA 1VIQA 1R58A 3KZYA 3WU0A 3K0LA 1LQ1A 1SFUA 1KTGA 1OW2A 2A61A 1BIBA 1OR7A 1VC8A 1XSAA 1T98A 3ZMTA 4ZZLA 3FSPA 1NQZA 1UCRA 1ZG3A 3RYRA 1BC8C 2Z5UA 2GT2A 5D4SA 1OYWA 2XVCA 3CJNA 3Q2SA 3WTXC 4TV7A 1LNWA 5DDGA 4ZZDA 4S2VA 1XSCA 3CTAA 1U2WA 3GO5A 4RAYA 5HDNA 1FYLA 1Z05A 3KFWX 3LWFA 4IVNA 4CZZA 3WGIA 2V1UA 4BYYA 1MUTA 3F8CA 2A07F 3X0KA 3DP7A 5HS7A 3QAHA 2ESHA 5DUKA 1GHCA 1DUXC 2XAJA 3HRSA 2FKBA 4B8XA 4YFNF 1YW9A 3RJPA 3ZQ7A 1ZG5A 2GZWA 3E6DA 4FX4A 4JZVA 4L18B 2O03A 2K86A 4CGZA 4FHTA 2D1HA 2E7XA 1PP7U 2A8QA 1UHMA 1P92A 1BN5A 1FBUA 1XDUA 1ZHFA 4Q4ZF 2Q0OA 3RI4A 1EH7A 4I98B 2JTVA 3PFIA 3TO7A 5HS8A 4EM1A 4K2EA 4KICA 5D6EA 3JSPA 2V9VA 4ENNA 4IPAA 3K1MA 3K2ZA 4S2YA 2W85A 5A2QZ 5CFJA 2Q9PA 4S2XA 2DPUA 3SZTA 3VB2A 2FMYA 1P6RA 3HRUA 1J2XA 1TBXA 5LEKA 3DEUA 3E5UA 2VONA 3G0QA 3KE2A 3HYQA 5FD5A 4N0BA 2HR3A 3KP4A 2FA5A 5HLIA 2DAOA 2FEZA 3T5XA 2CYYA 2VOPA 4NFXA 2QJOA 3A6VA 2XHKA 4GXOA 1D3YA 3DPTA 1RUOA 5D5XB 2ZMEA 4LB6B 3IC7A 1FYKA 1EH8A 2FMLA 4YIIA 4WXDA 3ABUA 4G94A 4RGXA 4HX8A 2HFHA 3X0MA 1P4AA 2I6KA 3Q93A 3ROUA 2QWWA 2PBIA 2ZCWA 5ILVA 3GVAA 3X0RA 3WGGA 4DNCA 4IXAA 4MPOA 2O0YA 2WTEA 1Z91A 4OINF 1J59A 3CUQC 4LLNA 1IUYA 2P6TA 1STZA 1D5VA 4HLXA 4BH9A 3GZ6A 1AWCA 2M8EA 3EYIA 1MZBA 3IRQA 1IXCA 1SMTA 4JBAA 3HTSB 1YYVA 3SFZA 4OOIA 1K6OA 1Q1HA 2PFBA 2EA2A 4M6XA 1FC3A 1FP1D 2O61A 2QENA 2JPBA 2M30A 1F4KA 2HTSA 3BDDA 3DPLC 2PQ8A 1MR2A 4HYEA 3WU1B 4N1UA 2M1BA 3FK9A 3I4PA 3H3ZA 3RKYA 1MJ9A 3AC9A 1B59A 4ASNA 2MH9A 2OD5A 3F8NA 3Q5FA 3CO7C 3N4MA 2W24A 5GHIA 3AAFA 1ZRFA 2L54A 4AIJA 1KQ0A 2DSDA 3LQQA 4P9FA 4BHPA 1ZG1A 1G0SA 4KG3A 3KLNA 1XB4A 1OYYA 2P8TA 5CVJA 5JHUA 2P5LC 5FSNA 2FOKA 2HYFA 1WRJA 1IW7F 3L2CA 4UV9A 3J80Z 4G7HF 4N1TA 1JHHA 2DQRA 2R5WA 2FNAA 2K27A 3WG9A 1MK1A 4EVIA 5J8CA 3O3KA 2F5EA 2H6CA 4N9HA 1MQEA 3WTSC 1DP7P 3P9IA 5BPDA 3HTUA 2B0LA 2ISYA 1W7PD 4GCVA 5DPKA 1V8MA 1BBYA 2MLKA 1IRYA 4HW0A 4Z2YA 1S7AA 1KT9A 3RTRA 1IN5A 3WTTC 2A8RA 2X0LA 1YFHA 1T39A 1FX7A 1PPVA 3SMDA 4KYWA 4KN4X 4A5NA 2W57A 4S05A 5TRDA 1TNTA 2OAZA 4NHJA 2Y0MA 3GLXA 4RB0A 5FSLA 2ZMEB 4Q47A 4XSZF 3HYIA 3IHUA 2Q2EA 3BY6A 1Z6RA 3GX4X 4J7HA 2GA2A 5ICCA 5IT9K 4XLPF 2L02A 3N9UA 5KK1A 1W7PA 2RNJA 1MQWA 2V6CA 3M8EA 4NB5A 2XV4S 1ONVA 4HZFA 3L09A 4L9VA 2FVVA 1ZLJA 1R22A 1ZYRF 3W6JB 1I1SA 5CFIA 3BHOA 3WE3A 1V8SA 1S7OA 4DYWA 4G8XA 1DPUA 3CDHA 4HA8A 3GF2A 2QQBA