3GZ5A

Crystal structure of shewanella oneidensis nrtr
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
218
structure length
214
Chain Sequence
QLLTVDAVLFTYHDQQLKVLLVQRSNHPFLGLWGLPGGFIDETCDESLEQTVLRKLAEKTAVVPPYIEQLCTVGNNSRDARGWSVTVCYTALMSYQACQIQIASVSDVKWWPLADVLQMPLAFDHLQLIEQARERLTQKALYSLVPGFALSEPFTLPELQHVHEVLLGKPIQGKSFRRRVEQADLLIDTGLKRTPANLYCLKPDTASYRFLRNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of an ADP-ribose-dependent transcriptional regulator of NAD metabolism
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Dna binding protein
molecule keywords MutT/nudix family protein
total genus 60
structure length 214
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gz5A02
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3gz5A01
3E57A 3SFZA 1G0SA 4A6DA 3QOPA 4EJTA 5LHIA 2PJPA 3O69A 3DKWA 4HX8A 3EDPA 2YX4A 1J75A 2E1NA 4NFXA 3ZMUA 2A8PA 1XSXA 2ZO4A 4XLPF 2OZ6A 4M74A 5IT3A 2PG4A 1ZGAA 4G94A 4WCGA 2Y48A 2O8XA 2NYXA 3BP8A 5E20A 4IPAA 1P4XA 3MZHA 3FM5A 4O3MA 1LB2A 4UXNA 2DSCA 1O3QA 3MDGA 2UXXA 1H9GA 4OIQF 2PMUA 3F22A 2STTA 3WHWA 1FP1D 3F8BA 4M9ZA 4S2YA 2P7VB 4CO8A 1G3SA 2QLZA 3T5XA 3E5QA 2X0LA 1X84A 2FU4A 5DCFA 1XCVA 2STWA 2XGXA 3V8KA 3EESA 4EVIA 1DDNA 1HXDA 1KU9A 3FFUA 3O6BB 1HZTA 3M7GA 2PQVA 4HBLA 3F23A 1U6GA 5ISYA 5F6FA 3NEUA 5FSOA 3BM4A 4P9FA 4P5OA 4KG3A 3IKVA 1V8RA 2GZWA 3CUQC 2LF8A 5LLQA 3VB2A 2OU2A 2YVNA 5J8FA 4YPHA 3QRFF 1OR7A 1IUYA 3JSOA 2M30A 3WG9A 2CSOA 1Z6TA 1XSAA 2O3FA 4BYYA 1R00A 5JHUA 2DTRA 2HKXA 2IPQX 2ZKZA 3EF5A 5DCMB 3T8RA 4EGZA 3IHUA 1DPUA 2XAJA 2GQQA 2L54A 4KIFA 1O57A 4L9VA 5A2QK 1SMYF 3LA7A 1J2XA 3I59B 1IN7A 3I5UA 1OPCA 5E8GA 3V7CA 1GHCA 1BC8C 2CQKA 1P4WA 3KLNA 2QBYB 5DD4A 3DP7A 1ZARA 4NB5A 1I5ZA 4EJVA 3I7UA 3Q2SA 2Q8KA 2PQ8A 1VRLA 5K5OA 2V9VA 1IRGA 1XMKA 1XSBA 4DYWA 2E7WA 2XAHA 4Q48A 3EXQA 1UHWA 3I58A 4LMYA 1YQAA 3VFZA 4HZFA 1P92A 3CLOA 5HDNA 3J7Ye 5LHGA 3C18A 2Y75A 1HW1A 2CYYA 2XHKA 1E17A 1VC9A 3QU3A 3BJAA 4ENNA 4UV9A 1H0MA 4Q47A 3X0KA 1ZH5A 3J80K 3R60A 1MJ9A 1O7LA 5K5RA 2O0YA 3K1PA 2YPRA 3TQNA 1SD6A 1ZYRF 3A6SA 4IJXA 5FLXK 3MDIA 4PZJA 2J5PA 1T98A 2ZMEB 5AIQA 1D3YA 2DBBA 3L09A 1V8VA 1BOAA 3TDZC 2FEZA 5E18F 1IRFA 2DU9A 5ERIA 1MP2A 3PQKA 2GA1A 2IA2A 5EEHA 2M87A 2QUFA 4LG0B 1FX7A 1XDUA 3J81K 5GHOA 3U1DA 3WODF 2X4HA 3IRQA 2RV8A 2KRFA 2V1XA 3WGIA 1X51A 4NQWA 2VC0A 4LGWA 5HVQC 5ILUA 3I71A 4BHBA 2XVCA 1RNLA 2EFOA 5JI6A 2IA1A 1ZREA 4N9HA 2FMYA 2EV0A 2KIFA 1K78B 3ISPA 3GFMA 3BJOA 1KGSA 5ILVA 1K6OA 3BJ6A 2H27A 4RAZA 3RH7A 5LPGA 5IT9Z 1B4AA 2IA0A 2B06A 1W7PA 1RZ4A 5CVVA 3KLOA 1SOIA 1CF7A 2W57A 3E6DA 1YLFA 3FMQA 3RYPA 1LDJA 2OZUA 3WE2A 3IRRA 4MTEA 3R0AA 2L3DA 5C8LA 4C9XA 2B0VA 1I6XA 2L02A 4KUMA 4WF2A 3FX3A 3BPVA 1Q33A 4IXAA 1QZZA 2VE8A 2GB5A 1V8LA 3HIFA 1RRQA 5EEGA 4LB6B 5FSIA 3ZMDA 2LSOA 3SZTA 2BYVE 1S8NA 4Y17A 1J0RA 2A5YB 4L5IA 4CDGA 5E17F 1LJ9A 2VC1A 1VK6A 1YTYA 5HS7A 5A2QZ 2H94A 3O2PE 1PUQA 3L2CA 3ECHA 3F6AA 3RKXA 5H6RA 2YU3A 1PUSA 2ZCWA 1FY7A 3BZ6A 3FM3A 1V8YA 1JRKA 1MJBA 2YSRA 3GFIA 2FMLA 4E70A 1D5VA 4AVPA 1G3WA 3X0LA 3FF5A 5I8UA 2GA2A 1R1UA 1PP8F 4JZUA 3LFKA 2K7LA 3GWYA 2IT0A 4WWCA 4L5JA 1Q27A 1B9NA 2OQGA 4FHTA 3K9TA 2HQNA 3DEUA 1S29A 2VE9A 3EQLF 4KMUX 2JVBA 1J59A 2EFQA 1IAWA 4HDVA 5FD6A 1USSA 1Q54A 2K4BA 3E6BA 1R23A 4DNCA 4Z2YA 1JHFA 2FA5A 5D4SA 3RPQA 1FSEA 2FBHA 4HYEA 3BROA 5IW4A 2FE3A 1IXRC 4O5VA 1KYZA 2UXNA 3SZPA 1RRSA 2KIUA 2DLLA 3I64A 5D4RA 3HOSA 2VT3A 1J5YA 4EGYA 3HUGA 1NHAA 1G9QA 3QU6A 3Q91A 1GXPA 2FSWA 1BIAA 2RVCA 4R8HA 2O5WA 1TUMA 1R1TA 4BXUA 1VIUA 1ZAOA 1IN6A 2FXAA 3ZP5A 5FSNA 1IXCA 4KICA 2O1CA 2GT4A 4CYDA 1QVJA 3GRNA 4IF4A 4G9YA 5IT9K 3ZN1A 3JTHA 4HOBA 3G3ZA 4G6DA 4RB0A 4L0YB 1ZGJA 2QWWA 3V8LA 4OU0A 5BPIA 3DPTA 5AONA 5DV5A 4G7ZF 3EYYA 2AZWA 1P2FA 3E97A 4ASNA 5ANSA 3QAHA 3KP4A 3ZMSA 2QQAA 3CUQB 4GYIA 4LFUA 4KYWA 4IVNA 2MBFA 3VOEA 3RI4A 5FLXZ 1A04A 1YO5C 5D5XB 2DK5A 1F4KA 4M6YA 4U0WA 2LKPA 3GF2A 3K1NA 3FXUA 1KU7A 2B2KA 2EFPA 5J8CA 1QGPA 4IRGA 3GLXA 3KEOA 2DUKA 1ZN2A 2ZXJA 1SD4A 2ZJ2A 1PDNC 3D5LA 4GGGA 2AXLA 2I6KA 3TGNA 5L3BA 4UNOA 3X0NA 5D6EA 4HF0A 2H09A 2V1UA 2Z9OA 1NQZA 5F64A 3ML6A 4WXCA 3FMRA 3Q4IA 4I09A 4IHSA 5DCMA 3HYQA 2P5LC 3ELKA 5HLIA 1FBSA 3RKYA 1F9NA 4JQFA 5CVIA 2GXBA 4I0AA 2RKHA 2BV6A 4XRFA 4RB3C 1TQIA 4ENMA 4LLNA 4B09A 2A6EF 4RB2C 3HRUA 3I59A 4OINF 2VNPA 1WRJA 5IW5A 2A3SA 1HW2A 3HTSB 3AAFA 4FT8A 2UWMA 3MCFA 5D6FA 1ZRFA 2A6TA 1VIQA 4JZTA 2RDPA 4UVAA 1TNSA 2QBYA 1YIOA 3ZMTA 1KU3A 3CNGA 1EV7A 3F8FA 2I8TA 4EV0A 3HRMA 4GCVA 2R7FA 2QKMB 2LF7A 1W5SA 1PPWA 4QLCU 3P9CA 1IZ1A 2QJTA 5E1XA 3SXYA 1E2XA 5DPKA 1CGPA 3A6UA 1G3YA 4OIOF 2V1DA 3M9AA 3WU1B 4S05A 4EM2A 4JZVA 2HKOA 2DQRA 3AC9A 1T2KA 3SHFA 3HSFA 2QQBA 4FX4A 4HV6A 3KFWX 1FZPB 1V8MA 1MQWA 1DPRA 2ZFWA 4EM0B 2V79A 4S2WA 1QO0D 1G4DA 2OD5A 2F5EA 4JK1X 2KJCA 1T39A 3CO7C 1KA8A 2PMHA 3GFJA 3M1EA 1GXQA 4WK8F 4N1UA 1JGSA 5KVRA 4EQQA 3B73A 1PUNA 1NQYA 2CG4A 2JPCA 5FSKA 1KQ8A 2EV5A 1U2WA 2D45A 4Q5SF 3H92A 5DDGA 2EJRA 1SAXA 2A8RA 2QQ9A 5ICGA 5BPDA 4MPOA 4XBFA 3E6CC 4ESJA 2GXGA 2ESHA 3T1BA 2M5WA 5JFRA 4PCQA 5DEQA 4LLLA 4MQVA 2K27A 3JAMK 2P7CB 3O3KA 1IF1A 2XV4S 4H0EA 1F1ZA 2WTEA 3B02A 4GYGA 2HDCA 5KK1A 5D5VB 1MDMA 4BHPA 2GT2A 3SONA 5JR3A 3MEXA 1TW2A 5HZXA 1FBUA 1VC8A 5GHIA 3W6KB 1TTYA 4LK1F 4K2EA 1ZG1A 3K2ZA 3KETA 3FMSA 3QP6A 5E1WA 3BAPA 2FQ3A 5LGUA 3I53A 1TW3A 5FO5A 3X0IA 1V8TA 1KHZA 2NS0A 2Q2EA 1C0WA 1FBQA 3ERED 3O52A 2XAGA 4ZYGA 1FYKA 2VT2A 4IRHA 1YS7A 4NFWA 1R22A 5BS6A 2D1VA 5L3GA 2MLGA 2PBIA 3KP6A 1HKSA 2G74A 1U5TC 1V8SA 1Z91A 4ZZLA 4Y13A 1F3YA 3RDIA 2F2EA 2ZNZA 5CLSA 3TO7A 1ZRCA 2R5WA 4A0ZA 2Q9PA 1U78A 2RRKA 2W24A 4KYXA 3J81Z 1Z1DA 4G7OF 4HA8A 1IN4A 1UCRA 4EJUA 5FSMA 4JBAA 2ZNYA 2F5FA 5TJJA 3N77A 2JRTA 1W5TA 3BHOA 3MCZA 1I1SA 3CUOA 2DI3A 3TO6A 1H9TA 3CUQA 4AD9A 1KU2A 4CXFA 1FT9A 4PDKA 2O61A 1SU2A 5CVUA 3U53A 3L85A 5DUIA 2DAOA 1LEBA 2P8TA 2HYGD 4R1HA 2GIVA 3KP2A 3ROUA 1MQEA 4IHTA 5LEJA 2NNYA 2HQRA 3NQOA 2A8SA 2HR3A 3TDUC 5AIPA 2A61A 3HTUA 4ZZDA 4IRIA 3FHZA 2C6YA 1OYWA 3H95A 5ANVA 2Z33A 1F5TA 4A0XA 3KP5A 2HS5A 4FX0A 5ED4A 1W4MA 3IWZA 2KDVA 1UHMA 1J7KA 3ZN0A 1W7PB 1WSUA 1LDDA 4MGRA 5HLGA 1REPC 4I02A 5C7QA 4XSXF 1IRYA 5FSLA 1D8KA 4U7BA 2EWNA 4KA4A 4M71A 5BOXA 3I0TA 2PLYA 3RTRA 3I7VA 4Q4ZF 2QENA 1B1BA 4RGRA 4ESBA 3DV8A 3P9KA 4YFKF 3FSPA 4YOQA 1LEAA 3GZ6A 1WI9A 4U0YA 1NFSA 1PUEE 3L9FA 4A6EA 4LD5A 1HQCA 4DQ2A 4I98B 1U3EM 5LGNA 2FRHA 4GO1A 1QQIA 3T0YA 1UFMA 4YIFA 1U5TB 3GEZA 1Z7UA 3S2WA 4HLXA 3NRVA 5ANTA 4AIHA 1BJAA 2ISZA 3KP3A 2WWYA 4ESFA 3PQJA 2BGCA 3WTWC 4KN4X 2G73A 1K26A 3H3UA 4UV8A 2FBIA 1S6LA 4CHUA 4G7HF 1JHHA 3P7NA 3M8FA 5H6QA 3CTAA 3F3XA 1FYMA 4HF1A 2QJOA 3N4MA 3TO9A 4HW0A 3N97A 2O6GE 3FXQA 5HS9A 2RN7A 1MUTA 1XSDA 3LA2A 2E1CA 2LNBA 3P5TA 4TV7A 4I7HA 2WC2A 1MJAA 3JW4A 4P96A 2OA4A 4EM1A 1MR2A 1T0FA 3MQ0A 1BI1A 1RYAA 4M9XA 1WWXA 3C3WA 2HGCA 3L00A 3VEPA 3E5XA 3IL2A 3REOA 3LAPA 1OKRA 2M45A 5E1ZB 2FNPA 1SJYA 3C1DA 1K7AA 3ZPLA 2MA3A 1AOYA 2QM3A 3ULQB 2TDXA 2DFIA 2DQLA 1EH6A 4A5NA 1CF7B 3EEUA 4BNCA 1R5HA 3GXOA 4Y15A 1XGSA 2L4AA 1VTNC 1LQ1A 1BI0A 1LVAA 3LQRA 1MGTA 3HOTA 1OW2A 4KFCA 2EFWA 4IJAA 3WU0A 1ON2A 1TQMA 1P6RA 2FKBA 1NFZA 1TBXA 3M8EA 3X0OA 4A12A 1R5GA 2P6TA 1SD7A 3X0QA 2XIGA 2F5DA 1FOKA 1QZYA 1JKNA 3KE2A 1S7AA 3W6JB 1IW7F 3P6YA 1XSVA 2OQRA 4MHGA 4ZYDA 5CFIA 2CL3A 2VXZA 3HRSA 4RGSA 1VCDA 2DSDA 5FFZA 1LDKB 3DUPA 2P6SA 5CFJA 3E3VA 5E8IA 4WX9A 3Q1PA 2ICKA 1WKMA 4ZYHA 2JSCA 3FK9A 5TRDA 1O7FA 1X3UA 3TKYA 3X0RA 4L9TA 2YVPA 3WGHA 4CZZA 5ICFA 1IN5A 2VBZA 3CO6C 4HF2A 3ABUA 1QPMA 3SMDA 2V6CA 1MZBA 2XRNA 4OIPF 2EK5A 4BH9A 2D1HA 2JTVA 1YW8A 1T6SA 3X0MA 5K1YA 2KIMA 2Z3YA 2R7DA 3F6OA 3FZVA 3ID9A 2IVMA 2ESNA 4WXHA 4MTDA 3JAMZ 3Q2TA 3RJPA 3CDHA 3J80Z 3WTUC 4OMYA 4P9UA 4HFQA 5DYMA 5HOOA 2O5FA 2IP2A 1P4AA 1I27A 2DW4A 1G3TA 2XAFA 3BWGA 2ADUA 2QZ8A 3G0QA 2ETHA 2IW5A 5BQTA 2W85A 5FD5A 2A69F 2DSBA 2XKPA 3EUHA 4BHCA 2Z99A 3KZZA 3U2RA 1U5TA 3WTYC 4U0VA 3ZR1A 2HWVA 1K79A 3ZMZA 1HX3A 4JZSA 1YS6A 3COUA 1YFHA 2AS5F 3HRTA 1O3SA 1FNNA 3DPLC 2L4MA 2CFXA 5L3EA 2K02A 5HDGA 5J6XA 5L3FA 3C7JA 4PGHA 2D2WA 2WV0A 3KCCA 1T38A 1FC3A 2XUBA 3MAJA 3KEQA 1OYYA 1SFXA 1AWCA 2MH9A 4N0BA 5ANWA 3KVHA 4RGXA 2DPDA 4AWXB 3I54A 1XN7A 1BI3A 4D0PA 3DKUA 2EFNA 2VNQA 2EA2A 2UZKA 2PFBA 2RQPA 4KN7X 3GZ5A 2G7UA 3G73A 3BDDA 4HQEA 2JZYA 1KT9A 2NAZA 4EMSA 1OMIA 3Q9VA 3GFLA 5ICEA 3ECOA 3RKWA 2PN6A 1ZG3A 2NNNA 1DP7P 1XDSA 2P5VA 1B6AA 3BPXA 5HDKA 1O3TA 3COAC 2Q0OA 4KIGA 4LJZF 3FCMA 1YYVA 3HHGA 3HSRA 1I1GA 1SZ3A 3DFGA 3J7AO 5FB2A 1STZA 1HKTA 1JE8A 3OOPA 2J8QA 3WTTC 4LK0F 1HBXG 4KG4A 1SFUA 1Q1HA 2EV6A 3LWFA 2G7HA 4EJWA 4B8XA 3WTSC 1V4RA 1V8IA 2FNAA 4LG0A 4I2OA 2Z5UA 2K4JA 3IC7A 2HFHA 3GUDA 3WE3A 2KDWA 4ENJA 2QVOA 5DD8A 2HEOA 3FWEA 4RAYA 2I8UA 2DK8A 2H6BA 3LA3A 1RIOH 3GX4X 1D8JA 3GO5A 1ZRDA 4S2XA 1KYWA 2VN2A 1MKMA 1PVFA 1KTGA 5DUKA 5K5QA 5GHJA 1VHGA 5GHPA 5H20A 4KNYA 4R79A 1HW5A 1K78A 4I01A 4L9JA 3QSJA 5C7TA 2FF4A 3LAJA 1QBJA 1V8WA 3BOQA 2MC3A 2QYOA 3GG6A 1WQ2A 3L7WA 3VODA 2YVMA 2Y0MA 3K0LA 3GYHX 4MEYF 1L0OC 3WGGA 5D8LB 5HS8A 4ENKA 4HV5A 1Z6RA 3O8SA 1Z05A 2J5OA 1YW9A 3R4KA 4L18B 1HSTA 2GAUA 4HX4A 2FOKA 5CVJA 3QP5A 3RIRA 3QPHA 3R03A 2HYFA 3Q9SA 3H3ZA 3OGAA 4UVBA 1FYLA 2VBWA 3A6TA 3V8JA 4KIBA 1RI7A 1XGOA 3V7SA 5ICCA 2BEOA 2YVOA 5D8KB 5CJ9A 2A8QA 3GWZA 2IJLA 3GVAA 2KKOA 1EH7A 5D5WB 3BY6A 4G8XA 1RUOA 2B0LA 2P5KA 2E7XA 3MFKA 3X0JA 1V8NA 2ZBKA 1TLHB 4I0BA 4S04A 3JTGA 1HKQA 3ZQ7A 3GZ8A 3KP7A 2MD5A 2ELHA 3TOBA 3F8NA 5ILSA 3P9IA 3FJYA 2PNYA 1V8UA 3ZR0A 1R36A 3F21A 1ZG5A 4A2UA 2XAQA 4M9SA 3SHDA 4U88A 5HLHA 3R6SA 1O3RA 2M8EA 3PFIA 4MNUA 1Y0UA 4M6XA 4CGZA 1G6NA 3K1MA 1YW7A 4CICA 1FP2A 4LLGF 2DHOA 1I9AA 3HYIA 2W84A 5GHMA 1XCBA 3WTVC 3I9XA 3QPTA 2R3SA 4QWQA 4S2VA 1ODDA 3LQQA 4HDUA 2K86A 2CW0F 2ISYA 1LNWA 4HQMA 4NHJA 1V3FA 1BN5A 5LHHA 3K69A 2OBPA 1XGNA 5LRSA 1FPQA 1VHZA 1MDMB 4ILQA 1JXSA 5BMZA 4HAMA 4P55A 4U7DA 5GHQA 4M72A 2ACJA 1DUXC 2JT1A 1S7OA 4L0ZB 4F7ZA 3ZMVA 1BM9A 5LEKA 2VOPA 2JPBA 3EYIA 1U8RA 2HOEA 4OOIA 2LDUA 3DF8A 3HHHA 1ULYA 1MD0A 5FGMA 4ICKA 4ZH4F 4N9IA 2PEXA 4A5MA 1MK1A 2O03A 4V14A 4EJOA 4KDPA 2W4EA 2KJBA 4WXDA 1TQPA 3LSTA 1W7PD 4RB1A 2XROA 1FWZA 2EB7A 4UVCA 2CGPA 4XSZF 4ZG0A 4BQAA 3OV8A 3SQNA 3X0SA 3D0SA 4RS8A 1K2EA 1R1VA 1UB9A 2BE5F 2DT5A 1SMTA 4GXOA 5ANUA 2FBKA 1KQ9A 5JVTA 3Q5FA 3O6ZA 4KMFA 1GVJA 3O61A 3IWFA 2W25A 5GHNA 3DXJF 2XKOA 4ETSA 1SD5A 3JSPA 1EH8A 2RGVA 1R7JA 1XB4A 3U9GA 3Q93A 4PGGA 3MGMA 2EA4A 3MZYA 1ON1A 4OIRF 3IKTA 1U20A 4ON0A 1XGMA 1R67A 5L3DA 2YYHA 3I4PA 2HTJA 3WTZA 5L3CA 3R0JA 2VONA 5LBQA 4YPRA 5FFXA 1FSHA 2MH2A 2A07F 2HZTA 4C9WA 3A6VA 4YFXF 2P4WA 2BBYA 3MWMA 3T8TA 3KZYA 5D5UB 1ZHFA 2XSQA 1IXSB 1ZLKA 2M1BA 1QNTA 2RC4A 1XMAA 3F13A 1BIBA 1S3JA 3WTXC 4UHTA 1USTA 2ZMEA 1KQ0A 3F6VA 2VODA 1HSJA 4LB5A 1L3LA 4M73A 6PAXA 2VBYA 1TNTA 2COMA 4YG2F 2RNJA 5F1RA 4ZYEA 2F5CA 4HVYA 2GWRA 1BC7C 4O6JA 5CYVA 1ZLJA 2L01A 1Z9CA 1GA7A 1X83A 4KT5C 4KTBA 3X0PA 3RPUA 2VBXA 3EETA 4G6QA 4K6EA 4N1TA 3ACAA 4YFNF 5LRRA 1XSCA 3ABTA 3DQVC 3HSEA 1B59A 2A8TA 4XLNF 2DPUA 1RUNA 2DO7A 5LGTA 3TOAA 3FXRA 2CWEA 2A68F 2PI0A 4YIIA 3HHJA 3V7RA 4AIJA 4MEXF 2ICJA 2H6CA 1OYIA 1BI2A 1PPVA 2FVVA 5BONA 4HX7A 1YG2A 1PPXA 1ONVA 2IRFG 1IN8A 1FLIA 4RGUA 3V4GA 2YX7A 4MQ9F 3R61A 4L9NA 3F8MA 2MLKA 3CJNA 2NRAC 2HTSA 3RYRA 2A6HF 1PP7U 2XASA 4A0YA 2VOOA 1B9MA 3E6MA 1XD7A 3N9UA 4OMZA 4AIKA 1SFEA 4UUVA 1BBYA 2YR2A 3GW2A 3F8CA 5CVRA 4HLYA 2CO5A 2OAZA 3F72A 1R58A 4BAYA 1J9IA 2G9WA 3E5UA
chains in the Genus database with same CATH superfamily
3E57A 3SFZA 1G0SA 2Q2EB 4A6DA 4E4HA 3QOPA 1DP3A 2VASA 4EJTA 4DGWB 3CCYA 1X19A 2E1OA 5J40A 5LHIA 4IQJA 2PJPA 4A3KJ 2XGEA 4ZDOA 4F91B 3G71I 3TW6A 3O69A 3DKWA 4HX8A 3EDPA 1LUJB 2YX4A 1NK3P 1V55H 3ZQIA 1J75A 2E1NA 4NFXA 3ZMUA 1OLTA 2A8PA 1W36C 2AQFA 2KP6A 1XSXA 3L2QA 2ZO4A 4W1UA 4XLPF 2OZ6A 2DODA 3DKXA 3B6CA 4M74A 4F52A 5GP9A 2M34A 5IT3A 2KDZA 3CCQI 4MFEA 1S72I 2PG4A 2GOXB 4A3MJ 1UELB 1ZGAA 2F4MB 4FCYA 1GV2A 4G94A 3H36A 4WCGA 4XONA 2Y48A 4M6VA 1X1BA 2O8XA 2NYXA 3BP8A 5E20A 2TCTA 3S1MJ 3E1SA 4YEJA 1JT0A 3HOZJ 4AM3A 4IPAA 3OIQA 4ZJZA 1P4XA 3E7LA 3MZHA 1N78A 3FM5A 1R5ID 4O3MA 1LB2A 3ABLH 3K70C 4UXNA 2DSCA 3MVPA 1O3QA 2VQGA 3MDGA 2UXXA 1H9GA 4OIQF 2PMUA 3F22A 2STTA 3WHWA 1ETYA 1FP1D 2NVXJ 3F8BA 4M9ZA 1IJWC 4S2YA 2P7VB 4CO8A 1G3SA 3EUKL 4XLCA 2QLZA 2LKSA 3T5XA 3E5QA 2X0LA 3PUFA 1X84A 2FU4A 3OSFA 2OTLI 3LSKA 5DCFA 1XCVA 4ZC3A 3MKZA 2STWA 2XGXA 2ME6A 2BY0A 3M1CA 3SDBA 3V8KA 3EESA 4EVIA 1DDNA 2LY9A 1HXDA 2CS3A 2R5YA 1KU9A 3FFUA 1RETA 5K7FA 3O6BB 2K85A 4AU7A 2E34A 2MW8A 1HZTA 3M7GA 2PQVA 4HBLA 3F23A 1U6GA 5ISYA 1MSEC 1ZQ3P 4S0HB 3H5NA 4B48A 3CDLA 1WH7A 3DU5A 3NEUA 5F6FA 5FSOA 5KAFC 3PL8A 3BM4A 2OCCH 4P9FA 4P5OA 3DLLF 4KG3A 3IKVA 3Q0VA 2CV1A 1V8RA 2GZWA 2KFDA 3CUQC 1LPQA 3N05A 2LF8A 2ZXWH 5LLQA 2K9LA 2OU2A 3VB2A 2YVNA 5DM7F 3FBNB 2XGCA 5J8FA 1LFUP 2XPWA 2HVRA 1R4NB 4YPHA 3BCAA 3ONQA 4ANJA 1WJ5A 5LD2C 2W7NA 2LH9A 3BCBA 2NXNB 4BY7J 3QRFF 1UHSA 1OR7A 1IUYA 3JSOA 2WV1A 3ZOBA 1MMAA 2M30A 3WG9A 2CSOA 4JX6A 1Z6TA 4HEA2 1XSAA 2LOOA 2O3FA 4BYYA 3CESA 5EG0A 2IS1A 1R00A 5JHUA 1P7IA 2JWTA 3CP8A 4A3LJ 2DTRA 2E36A 2F4OB 2HKXA 2IPQX 2ZKZA 3EF5A 5DCMB 3T8RA 4EGZA 3IHUA 1D0YA 5FKMA 1DPUA 2XAJA 2ZXHA 2GQQA 2L54A 1ZELA 3RQIA 4KIFA 1O57A 4L9VA 5A2QK 5EGOB 1SMYF 3LA7A 1J2XA 3A01B 2V9PA 3I59B 3HDDA 3LL7A 1IN7A 4Y4RA 2WY8Q 3I5UA 1OPCA 3CCUI 5E8GA 3V7CA 1X1PA 3QPLA 1GHCA 4XLEA 2CQKA 1BC8C 1P4WA 2DOEA 3KLNA 2QBYB 2EH3A 3OS0A 5DD4A 1YOVB 3DP7A 1PYVA 1ZARA 4NB5A 3O8GA 4NUBA 4BQNA 5K7ZA 2UUZA 2CV2A 1I5ZA 4B44A 4EJVA 2VQCA 3I7UA 3Q2SA 2Q8KA 2X1DA 2PQ8A 1VRLA 4FE7A 4DBQA 2WADA 5K5OA 4XORA 3OY9A 2V9VA 3CZ6A 1IRGA 1XMKA 4C30A 1XSBA 4DYWA 4CYCB 1S9HA 2E7WA 2XAHA 3JREA 4Q48A 3EXQA 1UHWA 3I58A 4LMYA 1YQAA 3VFZA 4CCLA 4HZFA 1VQ9I 1P92A 2K9QA 5KNLA 3CLOA 5HDNA 1HC8A 3J7Ye 1LFPA 2FJ1A 5LHGA 3C18A 1WVRA 2Y75A 4QPQA 3LSHA 1ZR2A 4GRIA 2HDDA 4PJLA 4BEHB 1ERDA 2DXIA 3MN2A 1HW1A 2CYYA 2XHKA 1E17A 4IQ4A 1VC9A 4F3QA 3QU3A 1IRZA 1RR8C 3BJAA 4ENNA 3ZGKA 3BR5A 1RKWA 4UV9A 1H0MA 4Q47A 1U9OA 1Z77A 3X0KA 1ZH5A 3J80K 4BBSJ 2K5CA 3R60A 1MJ9A 1O7LA 5K5RA 2VB6A 2O0YA 3K1PA 2HOAA 2YPRA 3TQNA 1KZHA 3GTOJ 1SD6A 2R5ZA 1ZYRF 3A6SA 4IJXA 3HOVJ 5FLXK 3MDIA 4PZJA 2J5PA 1T98A 2ZMEB 2E1MB 4H4KC 3I55I 5AIQA 1D3YA 3QYFA 1VQ6I 2DBBA 3L09A 1V8VA 1XC5A 1BOAA 3TDZC 3A0BC 2FEZA 5E18F 2QF7A 5GPCA 1IRFA 2DU9A 4Y3OA 1SEUA 3H9JA 4J01A 1K4TA 3I9V2 4RM3A 5ERIA 1MP2A 3PQKA 1VF9A 4AVZA 2B63J 2GA1A 2IA2A 5EEHA 3PO3J 2M87A 2QUFA 4LG0B 1FX7A 1XDUA 3QOEA 3J81K 5GHOA 3U1DA 3WODF 2X4HA 3IRQA 2RV8A 2KRFA 2R7XA 2V1XA 5F0HA 3WGIA 2MYSA 5M3FJ 3IP4B 1ETVA 1X51A 4BGDA 4NQWA 2VC0A 4F92B 4LGWA 5HVQC 5ILUA 2L0KA 3I71A 3Q3SA 4BHBA 1NTCA 2XVCA 1RNLA 2EFOA 5JI6A 2IA1A 2HOSA 2Y2ZA 3S2HJ 1WH5A 1ZREA 4N9HA 2FMYA 1QHHD 5IOYA 2EV0A 4FASD 2BVMA 2PMZA 5EZHA 2DA5A 2KIFA 1K78B 4BL0B 3HOYJ 3ISPA 3GFMA 3ESWB 2VKDA 3BR6A 2XF5A 3BJOA 1KGSA 5ILVA 3CLQA 1K6OA 3BJ6A 4D1QA 2CUFA 3HEFA 2H27A 4RAZA 3RH7A 2M8GX 1K61A 5LPGA 5IT9Z 2VJIA 5B66C 1B4AA 2IA0A 2B06A 1W7PA 1RZ4A 5CVVA 4B3XA 3KLOA 4GDFA 1SOIA 2DYSH 3F0CA 2K9SA 1CF7A 2W57A 3E6DA 3Q0WA 1YLFA 3LNQA 3FMQA 3B6AA 3RYPA 4BACA 3FK7A 3KPHA 4XLFA 2LVSA 1LDJA 2OZUA 3WE2A 2ZC2A 5GADJ 3IRRA 4MTEA 4E7HA 3QQAA 4PK4A 3M8JA 4LITA 3R0AA 2L3DA 5C8LA 1AU7A 1B72A 3S14J 2B0VA 1I6XA 5C4JJ 2HXOA 4C9XA 1W1WE 2L02A 3HM5A 2DN0A 3H9QA 2Q1ZB 5DM6F 3SFIA 1I50J 4KUMA 4WF2A 3FX3A 3BPVA 1Q33A 4E6KG 3HOXJ 4IXAA 1QZZA 2VE8A 2GB5A 4HSTA 3IAS2 1E3OC 1VQ4I 3OS1A 1FTTA 1V8LA 3HIFA 1RRQA 5EEGA 3S1NJ 4LB6B 3OS2A 5FSIA 3ZMDA 2LSOA 4Y7NJ 1RESA 5B1AH 3PM1A 5FROA 1BR1A 1IGNA 2L9VA 3SZTA 2VQHA 2LKXA 2HYJA 2DFHA 5J4VA 2BYVE 2VKVA 4XN0A 3TEDA 1S8NA 4Y17A 1J0RA 2A5YB 3OWTA 2W82A 4L5IA 4CDGA 5E17F 2EZKA 2RNGA 2ECBA 1LJ9A 2VC1A 1VK6A 1YTYA 5HS7A 2WB1N 5A2QZ 2H94A 3O2PE 1PUQA 4ITVA 1TWHJ 2VXDA 3G1MA 3K4BA 3K4KA 3L2CA 3ECHA 1Z3YA 2LYCA 3F6AA 2PJRB 3RKXA 3KYLA 1ZK8A 5H6RA 2YU3A 5JVGF 2AO9A 1PUSA 3IV5A 1J09A 2ZCWA 1FY7A 3SJMA 4BE2A 2N8GA 1YJWI 1T95A 4A69C 1Y8QB 3BZ6A 4IX7A 1XX5A 3FM3A 1G2HA 1V8YA 1JRKA 1MJBA 2YSRA 3JRHA 2AHQA 3GFIA 2FMLA 4E70A 3CJRB 1D5VA 4AVPA 1G3WA 3BR2A 3X0LA 1MNDA 3FF5A 2JA5J 5I8UA 2DA6A 1APLC 2GA2A 1R1UA 1RPWA 1PP8F 4JZUA 5EGOA 2CJJA 3CDIA 2EILH 3JRIA 3LFKA 2K7LA 2CFOA 4BDYA 3GWYA 2IT0A 4BY1J 2X1CA 4L5JA 4WWCA 4FTHA 1Q27A 2XDVA 4UUSA 4G12A 1B9NA 1X3ZB 2HPIA 2DFFA 2OQGA 4FHTA 2FX0A 1R9TJ 2BW3A 3K9TA 3AFHA 1NK2P 2HQNA 3DEUA 1S29A 1WI3A 2NVUB 2LLKA 3VYRB 2VE9A 3EQLF 4KMUX 2JVBA 2QKLB 2JUGA 1EA3A 1J59A 2EFQA 3LMMA 1IAWA 4HDVA 4PSWA 1ENHA 5FD6A 2YU9J 1USSA 1Q54A 2K4BA 3HGYA 3KZIC 3E6BA 1H88C 3K70D 1MBGA 1R23A 1PVEA 2WAQA 4DNCA 4Z2YA 1JHFA 2FA5A 1TT5B 3RPQA 5D4SA 3NAUA 1FSEA 2FBHA 4HYEA 3BROA 5IW4A 4XKWA 2FE3A 2MSYA 3K4CA 1IXRC 2M7AA 1KYZA 2UXNA 4O5VA 1OCCH 1T08B 2DA3A 3SZPA 1RRSA 2KIUA 2DLLA 4AUXA 3I64A 5D4RA 1S7EA 3HOSA 2VT3A 1J5YA 4EGYA 3CCRI 5M3MJ 3HUGA 1NHAA 2LFBA 3A4CA 1Z3XA 2FOWA 1G9QA 2L7KA 1LFBA 1LVKA 3LSMA 3QU6A 4PJNA 1GXPA 2FSWA 3Q91A 1BIAA 3CC2I 2RVCA 4R8HA 2O5WA 4PFPA 1TUMA 1R1TA 5CQGA 3HBLA 4BXUA 1ZAOA 1IN6A 2FXAA 3ZP5A 1VIUA 1IXCA 5FSNA 4KICA 2O1CA 3DWLE 2GT4A 4CYDA 1QVJA 3GRNA 4IF4A 4G9YA 5IT9K 3ZN1A 2WBMA 3IH2A 3JTHA 5FKNA 3HOUJ 1WGXA 1TP4A 1X1DA 4HOBA 3G3ZA 2KMUA 4G6DA 4RB0A 4AYBN 4HRIA 4L0YB 1ZGJA 2QWWA 3V8LA 4OU0A 5BPIA 2EIKH 4HNVA 3BTCA 3DPTA 1VNDA 5AONA 3PO2J 5DV5A 1TT0A 4II3A 1JKOC 4G7ZF 3EYYA 2AZWA 3S8PA 1P2FA 2CQ7A 3E97A 4ASNA 3EUAA 3QAHA 3KP4A 5ANSA 3ZMSA 2QQAA 3CUQB 4GYIA 4LFUA 4KYWA 3RZOJ 4IVNA 4QTRA 2MBFA 3VOEA 3H9GA 3RI4A 3KIOA 5FLXZ 2ZB9A 3OYGA 2GIZA 1A04A 2E5ZA 1YO5C 5D5XB 2DK5A 1F4KA 4M6YA 2DT7B 4U0WA 4B43A 3ZQGA 1TWFJ 2LKPA 3GF2A 3K1NA 3FXUA 1KU7A 3OYCA 2B2KA 1MMDA 4E7LA 1MBFA 2EFPA 5J8CA 2JRMA 1QGPA 4A3EJ 1QA6A 2Y30A 4IRGA 3GBGA 3GLXA 3KEOA 2M2EA 2Y69H 2ZJRF 1ZN2A 2DUKA 4B4CA 2ZXJA 3CCJI 1SD4A 3BR0A 4XICA 2CUJA 2ZJ2A 2L9NA 5IP7J 1PDNC 4XMYA 3D5LA 2L7FP 3WU2C 4GGGA 4BUPA 1A31A 1NG7A 2AXLA 2I6KA 3TGNA 1OCPA 3HJEA 5L3BA 3NWSA 4UNOA 3X0NA 5D6EA 2BY2A 4HF0A 2R93J 2EIJH 3H1CA 2H09A 1S5LC 2V1UA 2Z9OA 1NQZA 2DJIA 3CCSI 2E60A 4L5EA 1YX3A 5F64A 3PJRA 5E3OA 3ML6A 4WXCA 2GOMA 3FMRA 3Q4IA 4I09A 3SDGA 4IHSA 5DCMA 3HYQA 2P5LC 1OCZH 3ELKA 1PUFA 3DTEA 5IYBJ 5HLIA 1FBSA 2ECCA 1F9NA 3RKYA 5E3MA 1XG1A 4EEFG 4QIWN 4JQFA 5CVIA 2GXBA 3FKIJ 2YUSA 4I0AA 3CCMI 3A2KA 2RKHA 2BV6A 2WY7Q 4XRFA 4RB3C 1TQIA 3RSNA 4ENMA 3HPGA 4LLNA 2AQEA 1IG7A 1WCMJ 4LIVA 2A6EF 4B09A 4RB2C 4D5CA 3HRUA 3I59A 3HL2A 4OINF 2VNPA 4Z6YA 3TMOA 1Z0XA 1WRJA 5IW5A 1X3WB 2A3SA 1HW2A 3HTSB 4A3IJ 5FKKA 2JUCA 1VQLI 3AAFA 3S1RJ 4X6AJ 3BC8A 4FT8A 2UWMA 1N75A 3MCFA 5D6FA 1ZRFA 2A6TA 1VIQA 1IDYA 4JZTA 2RDPA 4UVAA 1TNSA 2R0QC 2VJJA 2QBYA 1N25A 4KJZA 1YIOA 1F36A 3ZMTA 1KU3A 3CNGA 3DBHB 1YIJI 1MBEA 1EV7A 5M5WJ 2X51A 3DKYA 3F8FA 2I8TA 3DEWA 1HDDC 4EV0A 3HRMA 4GCVA 4B3AA 1A6QA 2R7FA 2QKMB 2LF7A 1W5SA 1PPWA 4QLCU 3P9CA 1IZ1A 4YELA 2EQRA 2QJTA 3CMMA 2FD5A 5E1XA 4DYCA 2VUMJ 1I3QJ 1TWGJ 3OSGA 3SXYA 3J7ZI 1E2XA 3MZ8A 1JTYA 2LK2A 5DPKA 3AL0B 1YRNB 1CGPA 4NC8A 1ACIA 3A6UA 1P7JA 1G3YA 4OIOF 2V1DA 3M9AA 3S15J 4BEHA 3WU1B 3S17J 4AIDA 4S05A 2EZIA 4EM2A 3Q0UA 1QPIA 4JZVA 4IHWA 2HKOA 4CCMA 2DQRA 3A0HC 2KRHA 3AC9A 1T2KA 1MMSA 3SHFA 3FXOA 3HSFA 4KISA 2Y31A 2QA4I 2QQBA 2KZGA 5H2FC 4FX4A 4HV6A 3KFWX 1FZPB 2D5VA 1MQWA 1JKPC 1V8MA 1DPRA 1YX5A 2KT0A 2ZFWA 5EZGA 3VSKA 4M3GA 4EM0B 2V79A 2DMTA 3CCVI 1FEXA 4S2WA 1QO0D 1G4DA 4NDLA 2M3AA 2OD5A 1H8AC 2F5EA 4JK1X 2KJCA 1T39A 1O4XA 2NVQJ 3CO7C 3OR1C 1AKHA 1KA8A 2PMHA 1A35A 3GFJA 3M1EA 1GXQA 2QSFX 1W0UA 4DJAA 4WK8F 2Z1DA 4N1UA 1JGSA 4C3IJ 5KVRA 1F43A 4EQQA 4C2UA 3B73A 3PNVA 1PUNA 1NQYA 2CG4A 1H89C 2KISA 2JPCA 4J19A 3CQZJ 5FSKA 1KQ8A 1BR2A 2EV5A 1U2WA 2D45A 4Q5SF 3JRBA 2NVTJ 3H92A 3KX2A 5DDGA 2EJRA 2KZVA 2R4GA 2P0WA 1SAXA 3GTGJ 2A8RA 4NQWB 2DMUA 1X58A 1MMGA 1HCRA 2QQ9A 1AKHB 4XR6A 4E7ZA 2LD5A 2DFEA 3OYDA 5ICGA 5BPDA 4MPOA 2OV7A 2KRCA 4XBFA 3CCLI 3E6CC 2K3PA 2LBFA 4ESJA 2GXGA 2IEKA 2ESHA 3T1BA 3ASOH 2M5WA 5JFRA 2XB0X 4PCQA 5DEQA 4LLLA 2VKHA 4MQVA 4E7JA 2K27A 1QZEA 2JA2A 3JAMK 2QEXI 2P7CB 2R7RA 3O3KA 2VQLA 1IF1A 2XV4S 3D1NI 4H0EA 2Y9YA 1F1ZA 3K4JA 4CZCA 2KPMA 2P81A 2WTEA 1GUUA 1WJFA 3B02A 4GYGA 2HQ5A 4ZDPA 4RDUA 2HDCA 5GTIC 3CC7I 5KK1A 5D5VB 2CW7A 4BHPA 1MDMA 2GT2A 3BG3A 3SONA 5JR3A 3HKZN 3AKZA 1IC8A 5CKTA 5TISC 3OYBA 3MEXA 4CCJA 1TW2A 5HZXA 3AG3H 1Z67A 1FBUA 1VC8A 3PIOF 5GHIA 4CH7A 2ZSIB 2CQNA 3W6KB 2RREA 1U8BA 1TTYA 4LK1F 4K2EA 1ZG1A 3K2ZA 3L2WA 3KETA 1RC9A 4BJ6C 3FMSA 3QP6A 5E1WA 3BAPA 2FQ3A 3DCFA 4UUSB 5LGUA 3I53A 2I8DA 3RZDJ 1TW3A 5FO5A 3X0IA 5DTDA 1V8TA 1KHZA 1ZR4A 2NS0A 2Q2EA 1YRNA 1C0WA 2DOFA 1FBQA 4CYCA 3ERED 3O52A 2XAGA 4ZYGA 1FYKA 1WFXA 2VT2A 1YS7A 4IRHA 4NFWA 4YRVA 1R22A 5BS6A 1VQPI 2XF6A 1G8XA 2D1VA 1IUFA 3PUBA 5L3GA 2MLGA 2PBIA 3KP6A 4KT6A 1HKSA 1HOMA 2G74A 3H5AA 1U5TC 2KQRA 3BTLA 1V8SA 1Z91A 1DGWY 5B1BH 4ZZLA 1A6IA 4Y13A 2VI6A 2CQXA 1MNMC 1F3YA 2YS9A 3RDIA 2AXTC 2F2EA 2ZNZA 5CLSA 3TO7A 3VYUB 1ZRCA 3VDXA 4IHVA 4D7MA 4N4NB 4ZDLA 2R5WA 4A0ZA 2Q9PA 1U78A 2RRKA 2W24A 4KYXA 3G4SI 3LSIA 3J81Z 1Z1DA 1FMWA 2E2IJ 3WHBA 4G7OF 4HA8A 1IN4A 3BR3A 1GDTA 1UCRA 3W6VA 4EJUA 5FSMA 5M5XJ 2ELJA 3K7AJ 3G2BA 3OL3A 4JBAA 1WJBA 2XGDA 2ZNYA 2F5FA 2W48A 5TJJA 4MO7A 2IGMA 3N77A 2JRTA 4A3GJ 1W5TA 3BHOA 3MCZA 1I1SA 2CUZA 2L7ZA 3CUOA 2R7QA 3M4OJ 3GMEA 1D5YA 2A05A 3HB9A 2DI3A 3TO6A 1H9TA 3CUQA 2EINH 4AD9A 1GVDA 1KU2A 1G59A 1TWCJ 4CXFA 5J1RA 1X1CA 4UB8C 1FT9A 4PDKA 2O61A 1JUPA 1SU2A 1SFKA 5CVUA 3U53A 3ZQCA 3L85A 2ME0A 2XSDC 5DUIA 2BW3B 2DAOA 2K9NA 4RA2A 1LEBA 2DOAA 5JLWA 3HZJA 2P8TA 1WJDA 4BE1A 2HYGD 2KHMA 2WA0A 4R1HA 2GIVA 4UUTA 3KP2A 3BTJA 3ROUA 1MQEA 4IHTA 5LEJA 3S93A 2HQRA 2NNYA 3NQOA 2A8SA 3OYIA 2HR3A 3TDUC 4HG2A 1GLNA 5AIPA 1YHQI 2A61A 3HTUA 4ZZDA 3OYFA 4IRIA 3FHZA 1OYWA 2C6YA 3H95A 1JKRC 5ANVA 2Z33A 1F5TA 4A0XA 4IKFA 3KP5A 2HS5A 4FX0A 3OYKA 1UG2A 2HXIA 1Y1VJ 5ED4A 3MKYB 3A02A 1W4MA 1XMXA 3IWZA 3I3LA 2R7OA 2KDVA 1UHMA 1J7KA 3ZN0A 1W7PB 4C3HJ 3HG9A 1LDDA 4MGRA 1WSUA 5HLGA 1REPC 2O9LA 4I02A 3A03A 2DA7A 1MSFC 5C7QA 1TZLA 1E3HA 3OL4A 1LE8A 2F4IA 4MLOA 4XSXF 2X6YA 5FSLA 1IRYA 3JRFA 2EZHA 1D8KA 4F55A 3UKGA 2E2HJ 3ZRGA 2BXYA 4XKBA 4BS9A 4U7BA 4IHYA 2EWNA 1UMQA 2KIQA 3BG5A 4KA4A 4I6ZA 4HNUA 1JI8A 4M71A 2LC2A 5BOXA 3I0TA 3CC4I 2PLYA 3RTRA 3I7VA 4Q4ZF 4A3CJ 2R7VA 1ETWA 4RBOA 2QENA 1B1BA 4RGRA 4ESBA 2DDAA 3DV8A 3LSRA 3P9KA 2CZRA 4G6TB 4YFKF 3FSPA 4YOQA 5HLTA 2XSJC 1LEAA 3GZ6A 1R4MB 1WI9A 3QPSA 4U0YA 1NFSA 1UZCA 1PUEE 3ZQQA 3L9FA 4A6EA 4LD5A 1HQCA 4DQ2A 4I98B 2HVSA 5C44J 1U3EM 5LGNA 2Z2SB 2FRHA 3C2HA 4GO1A 1QQIA 3T0YA 1GV5A 1UFMA 2E5NA 2BOLA 4YIFA 5M5YJ 2M0CA 2IGOA 2M4GA 1U5TB 3GEZA 1Z7UA 3S2WA 4HLXA 3NRVA 1Y39A 5ANTA 4AIHA 1BJAA 4HNTA 4D5FA 1BJZA 4XOPA 1IV8A 4DIQA 2COBA 2LRDA 1NH3A 2ISZA 5F27A 3EPZA 3KP3A 2PJRA 2WWYA 4ESFA 3O8HA 3G1OA 3PQJA 2BGCA 3WTWC 5HNFA 3CF2A 4KN4X 1OQYA 2ICWG 2G73A 1K26A 3H3UA 3ZCOA 3FISA 4UV8A 1Z21A 4V2FA 2FBIA 2E71A 3JRDA 1S6LA 3C2GA 4CHUA 4G7HF 1JHHA 3P7NA 3M8FA 5J4YA 5H6QA 3CTAA 3PNYA 1IRXA 1QVUA 3F3XA 1FYMA 1FTZA 1SVLA 4HF1A 2QJOA 4U87A 3N4MA 3BQZA 2XRLA 3TO9A 4HW0A 3N97A 2O6GE 1U9NA 3VWBA 3FXQA 5IP6A 5J1UA 3AL0C 5HS9A 2RN7A 2X6XA 2R5YB 1MUTA 1XSDA 2A5WA 3LA2A 2LNBA 2E1CA 4IO9F 3OYAA 3P5TA 4TV7A 4I7HA 2WC2A 4XRMA 2B7EA 1MJAA 2M9HA 3JW4A 4P96A 2OA4A 3SEZA 2CW8A 4EM1A 2CRGA 1MR2A 1Y56A 1T0FA 3MQ0A 3PIPF 1MBKA 1FMVA 1BI1A 3JRGA 1RYAA 1OJLA 4M9XA 1WWXA 3C3WA 2HGCA 3L00A 5IYCJ 3VEPA 4J00A 1FOYA 3E5XA 1TWAJ 5HNHA 3IL2A 4X0GA 3REOA 3IAM2 2L2OA 3LAPA 1OKRA 1KONA 2K40A 3RQ4A 4BKXA 2M45A 5E1ZB 2FNPA 2DMQA 1EJ9A 1CQTA 1SJYA 1OISA 3C1DA 9ANTA 1LE8B 3CJQB 4XQFA 1K7AA 3F9KA 3ZPLA 2MA3A 5BNGA 5LFAA 5FJ8J 1AOYA 2QM3A 3ULQB 3L2RA 4EATA 2TDXA 1DGRM 2DFIA 2DQLA 1EH6A 2X1EA 4A5NA 1CF7B 2OF7A 3MKWB 2GLOA 3EEUA 4C2TA 4A93J 4BNCA 4A3BJ 1R5HA 3OYNA 5J1YA 3GXOA 4Y15A 1XGSA 2HNHA 2L4AA 4B1RA 3QWLA 1VTNC 1LQ1A 3X2QH 1ZTRA 2ZMEC 1ETOA 2WAEA 1BI0A 2Y0SA 1LVAA 3LQRA 1MGTA 3JRCA 1QRYA 2ZJQF 5FKLA 3HOTA 1OW2A 1YJNI 4KFCA 2EFWA 4IJAA 3WU0A 1ON2A 1TQMA 4BJ5C 3OIPA 1P6RA 4LIUA 2FKBA 1NFZA 1TBXA 2NS7A 3M8EA 2L9SA 3X0OA 2JA6J 4A12A 2Y9ZA 1R5GA 1VI0A 2P6TA 4NC7A 3H35A 1SD7A 4RAFA 3X0QA 1WPKA 1IV6A 2XAUA 3TW7A 2XIGA 3L2VA 1JGGA 2IS6A 5E3NA 2F5DA 5E3LA 4BDZA 1FOKA 1QZYA 1JKNA 4M3FA 3KE2A 1S7AA 3W6JB 1IW7F 3P6YA 1XSVA 2OQRA 4MHGA 1UJ8A 4ZYDA 4JOMA 1DQUA 3HGGA 1RR7A 5CFIA 3LOCA 2CL3A 1X2NA 3U1KA 3IH3A 3HKZA 2VXZA 3HRSA 3JR9A 4RGSA 1VCDA 3D5SC 3PFYA 2DSDA 5FFZA 1LDKB 3SYTA 5CPRB 1P9QC 5IOZA 3DUPA 3TL4X 2P6SA 5CFJA 3E3VA 2GM4A 5E8IA 3HPHA 2F6CA 5IYDJ 2M4KA 4WX9A 4IZZA 3Q1PA 3IUOA 2DDBA 4PJ0C 2ICKA 1WKMA 4ZYHA 5B5EC 2JSCA 3I56I 2R7UA 3FK9A 2OJED 4FISA 5TRDA 3RCOA 2LP0A 1W0TA 4E7SA 1O7FA 1X3UA 4BQOA 4ZTJA 3TKYA 3X0RA 4L9TA 2YVPA 3WGHA 4CZZA 2DCEA 5ICFA 3ZR8X 1IN5A 2VBZA 3DLAA 3CO6C 4B47A 1WJAA 2OCEA 1JJ8C 4HF2A 2IS2A 1Q1VA 1MW7A 2LG4A 3S3OA 3ABUA 1SFOJ 3GTLJ 4I99C 2XPUA 3UR3C 1QPMA 3MMYB 4A3DJ 2BHZA 2X48A 3FXJA 4OAYA 3SMDA 2V6CA 1MZBA 2XRNA 4OIPF 2O5RA 2RQQA 1X4OA 4HPQA 4CCKA 2XC7A 1VQOI 2EK5A 4JX5A 4X1EA 4XK4A 1K83J 4BH9A 2D1HA 3NARA 2JTVA 1LKXA 1YW8A 4JP0A 4ZTFA 1T6SA 3HUGB 3X0MA 2IBDA 3W2VA 2IGKA 3VPRA 5K1YA 1BR4A 2KIMA 2Z3YA 4AC0A 4QPOA 1HA8A 2W1OA 3JRAA 3DEEA 4DW6A 2R7DA 3F6OA 1XTAA 3FZVA 3ID9A 2HU9A 2IVMA 5IP9J 4AYBA 2MC4A 3OOUA 2ESNA 4WXHA 3GZNB 4MTDA 4XRSG 3JAMZ 4D7NA 3Q2TA 2L5QA 2EPFA 4IL6C 2VPRA 2LY1A 3ABKH 5CQEA 4BXXJ 3RJPA 3W3CA 2K9MA 3CDHA 3FBIB 3J80Z 2H8WA 4DYQA 3WTUC 4OMYA 3M3YJ 4XL9A 4P9UA 4HFQA 5DYMA 2KL4A 5HOOA 1PJRA 2O5FA 2IP2A 2HI3A 2OC6A 1P4AA 1I27A 4JX4A 2DW4A 1G3TA 2PMZN 3BLYA 2XAFA 2UV1A 4CCOA 3BWGA 2ADUA 2OUMA 2QZ8A 3VSLA 3CF5F 2ETHA 3G0QA 4IOAF 2IW5A 5BQTA 2R7ZJ 1ORKA 2W85A 5FD5A 2A69F 2BY1A 1XPXA 2XKPA 2DSBA 3EUHA 1VQMI 3K4MA 4BHCA 3FDYA 1R49A 2Z99A 2ZXIA 3KZZA 5JHFA 4FQGA 3U2RA 1U5TA 4M3EA 1Y0NA 3WTYC 4XLHA 3MKLA 4U0VA 3ZR1A 2HWVA 2LR8A 3ZMZA 4C2MJ 1K79A 1HX3A 4JZSA 1YS6A 3COUA 5FKOA 1YFHA 2CV0A 2AS5F 3HRTA 1Y1WJ 2MG4A 1O3SA 1VQ7I 3S2DJ 1FNNA 1QHGA 3DPLC 4RLQA 2M7BA 2L4MA 2CFXA 4I76A 5L3EA 3BG9A 4DOZA 4UY8I 2K02A 4XN3A 5HDGA 5J6XA 4RMNA 5L3FA 5KAIC 3C7JA 4PGHA 5J3LA 3S16J 2D2WA 1D1CA 2WV0A 3KCCA 1T38A 1FC3A 2XUBA 3MAJA 2G0EA 2Z16A 2DMPA 3KEQA 1SFXA 1OYYA 1B8IB 2HDWA 1AWCA 2MH9A 2QGUA 4XKVA 4N0BA 5ANWA 5C4XJ 3KVHA 4OAZA 4RGXA 1E3PA 2TRTA 2V7FA 2DPDA 4NC6A 1OFCX 4AWXB 4IOCF 3I54A 2V1NA 1XN7A 1BI3A 4C9YA 4D0PA 3DKUA 2EFNA 2KDOA 2EA2A 2UZKA 2VNQA 2PFBA 2RQPA 4KN7X 3GZ5A 2QSGX 2ZSHB 2WB1A 2G7UA 3G73A 3BDDA 2HOTA 5K7HA 4HQEA 1T0FC 2JZYA 1V5EA 2DMNA 1KT9A 1BL0A 2NAZA 1ITYA 1YJ9I 4EMSA 1UAAA 1OMIA 5EF6A 3ZQLA 3Q9VA 3GFLA 5ICEA 3ECOA 5F0FA 1SVMA 3RKWA 3W2AA 2PN6A 3AG4H 2BXZA 1ZG3A 1B8IA 2NNNA 1DU6A 2ELKA 1DP7P 1U0JA 1XDSA 2R7WA 2P5VA 1B6AA 1WJEA 1JJ6C 2V4JC 3BPXA 5HDKA 1O3TA 1IO2A 3COAC 2Q0OA 1T56A 1FIPA 4KIGA 4LJZF 3FCMA 1YYVA 3HHGA 3HSRA 5EJCA 1I1GA 2LBFB 4BXFA 3DFGA 3J7AO 1SZ3A 2EIMH 5FB2A 1STZA 1HKTA 4QSHA 1JE8A 1D1BA 3OOPA 2H1LA 2J8QA 3WTTC 4LK0F 1HBXG 4KG4A 4XIDA 1SFUA 1Q1HA 1Y8RB 2EV6A 2JVHA 3LWFA 2G7HA 3U21A 1ETKA 4M3DA 1JTXA 4EJWA 2WAFA 4XRSA 4B8XA 1EKEA 5FRNA 3WTSC 1V4RA 1E0EA 5FRMA 2OTJI 1MIJA 1V8IA 2FNAA 3ERMA 1M1EB 4LG0A 2O8KA 4I2OA 2F5VA 2Z5UA 2K4JA 3IC7A 2JA8J 2QCOA 2HFHA 3GUDA 3WE3A 4BE0A 1A36A 1K6YA 1B72B 2KDWA 1T33A 4ENJA 2QVOA 5DD8A 1Y6IA 2HEOA 2VIXA 3FWEA 2V9KA 4RAYA 4IEJA 3A01A 2I8UA 2NVYJ 2DK8A 1BOBA 2H6BA 3LA3A 5KCMA 2R7SA 1RIOH 3GX4X 1D8JA 2DJNA 3GO5A 4Y33A 3BG7A 1ZRDA 4S2XA 1KYWA 2R5ZB 2VN2A 1MKMA 1PVFA 5GTHC 3V42A 5DUKA 5K5QA 3LFUA 1KTGA 1VHGA 5GHJA 1V5FA 1ZKGA 5GHPA 5H20A 3GLLA 4KNYA 4R79A 2L7MP 1VQNI 1HW5A 1K78A 4I01A 4L9JA 3QSJA 5C7TA 2FF4A 2R92J 1R71A 4Y52J 3LAJA 4PJJA 1QBJA 1V8WA 3BOQA 3AG2H 2MC3A 3DBLB 2QYOA 1HDPA 3GG6A 3WG7H 3GCMA 1WQ2A 3ZXSA 3L7WA 3VODA 3BZKA 2L9RA 2BY3A 2VPLA 5JLXA 2YVMA 2Y0MA 1BW6A 3K0LA 3GYHX 3S1QJ 3HC7A 2E2JJ 4MEYF 1L0OC 3WGGA 5D8LB 1FIAA 3L1PA 3BR1A 3C2BA 5HS8A 4M3BA 3E0JB 4ENKA 4HV5A 1Z6RA 1WHUA 3SZGA 3O8SA 1Z05A 2MABA 4HSRA 2BHYA 2J5OA 5GAEJ 1YW9A 1PUFB 3JCUC 2X6WA 3HOWJ 3R4KA 4L18B 1FOWA 4YIRX 1HSTA 2GAUA 3QODA 4HX4A 2HQAA 1N77A 2FOKA 5CVJA 1V5GA 3QP5A 3RIRA 3QPHA 3R03A 2RAEA 3L2UA 2IAIA 2HYFA 4A3JJ 3Q9SA 3H3ZA 1MBJA 3OGAA 4UVBA 1FYLA 2VBWA 3A6TA 3V8JA 4KIBA 5C3EJ 1RI7A 1RKTA 4ZYAA 1XGOA 4GFBA 3LSJA 3V7SA 2F48A 5J47A 5ICCA 2BEOA 4MFDA 2YVOA 5D8KB 3DTIA 2DTZA 3DTKA 4XLAA 2HVQA 5CJ9A 2A8QA 3GWZA 3BTIA 3CJTB 2IJLA 4NNJA 2EZLA 3GVAA 2KKOA 1EH7A 3OYLA 5D5WB 1X2MA 3BY6A 2I5UA 4G8XA 1RUOA 2JN6A 2B0LA 4P1WA 2P5KA 3FXMA 2E7XA 3MFKA 2I10A 1BA5A 3X0JA 2JK3A 3FXLA 1D0XA 2ZBKA 1V8NA 1TLHB 4I0BA 2CMPA 4S04A 3J7YJ 3JTGA 1HKQA 3ZQ7A 3OYMA 3KP7A 3GZ8A 1BW5A 2MD5A 2ELHA 2JQ7A 2DYRH 1T8IA 3ZQHA 3TOBA 4CUGA 3F8NA 2HZDA 2MGQA 3P9IA 3K6GA 5ILSA 5GPAA 2PNYA 3FJYA 1IDZA 3FXKA 1V8UA 3BQYA 3DPUA 3KYDB 5F04A 1R36A 3S3NA 3F21A 3ZR0A 1ZG5A 4A2UA 3CD6I 2XAQA 3FK6A 4M9SA 1YI2I 3CCEI 3SHDA 3W2WA 4U88A 1XS9A 5HLHA 1UG0A 3R6SA 1OCRH 1O3RA 2M8EA 3PFIA 5FLVA 2DT6A 2MFZA 1YE9A 5KHDA 4MNUA 4PUSA 1K4SA 1Y0UA 5B3SH 5IPAA 4M6XA 4W97A 4CGZA 2VJ5A 3AG1H 3VYSB 1G6NA 3K1MA 4BU2A 1YW7A 1MMNA 4CICA 1FP2A 2E19A 4LLGF 1VQKI 3HYIA 3GTMJ 1I9AA 2DHOA 2W84A 5GHMA 1XCBA 3WTVC 1NG6A 3I9XA 1W36D 3QPTA 4RAGA 2LREA 5EEAA 2R3SA 2LMDA 1VQ5I 2BVLA 4QWQA 1R6RA 4S2VA 4UB6C 3G1LA 1ODDA 3LQQA 4HDUA 3PSFA 3OIOA 2K86A 2CW0F 2ISYA 2VLAA 1LNWA 4LOCA 4HQMA 1SC7A 4NHJA 4DBRA 3J7AY 2IS4A 1V3FA 2E1MC 1BN5A 2JJ7A 1MH4A 5LHHA 3GTPJ 3K69A 2JVGA 2X6OA 2OBPA 3FHNA 1XGNA 5LRSA 1FPQA 1VHZA 2VKEA 4V2GA 1V54H 1MDMB 4ILQA 1JXSA 5BMZA 4HAMA 4P55A 1OR7C 3TP0A 4U7DA 5GHQA 3K10A 1HF0A 5FLMJ 4M72A 2ACJA 2DA2A 2ZFUA 1DUXC 1QU3A 4XNFA 1VZ0A 2JT1A 1S7OA 4L0ZB 4F7ZA 1HLVA 3ZMVA 2EBIA 2DA4A 1BM9A 2JA7J 5LEKA 2XF7A 2ZJPF 2VOPA 2JPBA 2XB5A 3EYIA 1U8RA 2HOEA 4OOIA 1WZ2A 3G6EI 2LDUA 1X1AA 3DF8A 1ULYA 1MD0A 3HHHA 3DU6A 3ABMH 1AA7A 1I39A 4PFOA 3D5RC 5FGMA 4ICKA 4ZH4F 4N9IA 2PEXA 4A5MA 1MK1A 3WHCA 1TC3C 2O03A 4V14A 3MD2A 1POGA 1JUSA 4EJOA 5F08A 4KDPA 2MD0A 3S3MA 2KJBA 4WXDA 2W4EA 1TQPA 3LSTA 1W7PD 4RB1A 3OYJA 3OMYA 2XROA 1FWZA 2ID6A 2EB7A 3LSGA 4UVCA 4FETA 4E7IA 2CGPA 1MNEA 2GBYA 4XSZF 5IY5H 4ZG0A 3GTQJ 3PSIA 4BQAA 2CUEA 3OV8A 3SQNA 3X0SA 3D0SA 4NBQA 4RS8A 3QYBA 1K2EA 2JMWA 3I4MJ 1R1VA 1UB9A 2BE5F 4JYKA 2DT5A 3H0DA 4BJTA 1SMTA 1WJCA 2Y0SN 4GXOA 2KLOA 2H1KA 2FBKA 5ANUA 3NWTA 1KQ9A 5JVTA 3TP3A 3Q5FA 3O6ZA 4KMFA 1GVJA 1SAUA 3O61A 3IWFA 2QQ8A 2B9SA 2W25A 5TGTA 1VQ8I 2E35A 5GHNA 3DXJF 2XKOA 4F93B 4ETSA 2NOGA 1SD5A 3JSPA 1EH8A 2RGVA 1R7JA 1XB4A 2CH0A 3U9GA 4BQQA 3Q93A 2XPVA 2FQ4A 4PGGA 3MGMA 2EA4A 3MZYA 4KITB 1ON1A 3RPUD 4OIRF 3IKTA 3OYEA 3M07A 1U20A 4ON0A 4CSWA 1XGMA 4E7KA 2O7OA 1R67A 2OPTA 2V6EA 5F0CA 1Z7LA 4LG3A 5L3DA 2YYHA 2HPMA 3I4PA 1DU0A 2HTJA 3WTZA 5L3CA 3R0JA 2VONA 4FE4A 3H3VK 5LBQA 2LTPA 4PJMA 1SVOA 2JSPA 4YPRA 5FFXA 1FSHA 4XM3A 2W4SA 4RLFA 3CMEI 2MH2A 2A07F 2HZTA 4C9WA 5EYRA 3GTKJ 3A6VA 4V19K 4YFXF 4RM2A 1FOXA 3UNGC 2P4WA 2BBYA 3MWMA 3T8TA 2ID3A 3KZYA 5D5UB 4XKCA 1ZHFA 2XSQA 3ASNH 1IXSB 3OR2C 4OWRB 2M1BA 1ZLKA 5EDNA 1QNTA 2H8RA 5EG0B 2RC4A 1YITI 2X9DA 1XMAA 2NS8A 5GAHJ 3F13A 1BIBA 1S3JA 3WTXC 4UHTA 1USTA 2M0MA 2ZMEA 4PSXA 1KQ0A 1MH3A 3F6VA 2NOJB 5F1JA 2VODA 4CA0A 1HSJA 4LB5A 1JKQC 1L3LA 4N4OB 4M73A 6PAXA 2VBYA 2R7TA 5HODA 3FIWA 4D9JA 1TNTA 1TL8A 1SANA 2COMA 3IH4A 4YG2F 2RNJA 5F1RA 3OYHA 3CMAI 4ZYEA 1I6HJ 2F5CA 3LSPA 2QSHX 4HVYA 2GWRA 1BC7C 4O6JA 1ETQA 1ZLJA 1OCOH 2L01A 5CYVA 1Z9CA 1RRJA 5GAGJ 1GA7A 1X83A 4KT5C 2FUG2 4KTBA 4IHXA 3RPUA 3X0PA 2CQQA 2VBXA 3EETA 4G6QA 1FJLA 2LY2A 1EF4A 1D1AA 4DYRA 4K6EA 4N1TA 3ACAA 3VYTB 4YFNF 2WAQN 3CMYA 2V26A 5LRRA 4C3JJ 1XSCA 3K4NA 3ABTA 3DQVC 1A5JA 3HSEA 1B59A 2BZTA 2VJ4A 1MBHA 2A8TA 4XLNF 2CU7A 1ETXA 2DPUA 1RUNA 2DA1A 3TBIA 3P5JA 2DO7A 5LGTA 3TOAA 2K3FA 1D0ZA 1AHDP 3FXRA 3SEQA 2CWEA 3BG6A 1GT0C 2A68F 2PI0A 4YIIA 3HHJA 3H5RA 1JUMA 4XOTA 3V7RA 4DZJA 1OCTC 4AIJA 3GTJJ 4MEXF 1W5CC 2ICJA 2H6CA 4ABZA 1OYIA 4J7GA 1BI2A 1JT6A 3I4NJ 1PPVA 2FVVA 5BONA 3EUHC 1YG2A 4HX7A 1PPXA 1ONVA 5E79C 2IRFG 1X4PA 1IN8A 1FLIA 4RGUA 3V4GA 2YX7A 4MQ9F 3R61A 4L9NA 3F8MA 2MLKA 4II2A 1VFCA 3CJNA 2X85A 2NRAC 4CCNA 2HTSA 3CP2A 3RYRA 3BZCA 2A6HF 3KYCB 4A3FJ 1PP7U 2XASA 4A0YA 4J7HA 2VOOA 1B9MA 3HXLA 4BBRJ 5DS9A 1I3AA 4MIMA 3BT9A 3E6MA 1XD7A 1ZGWA 3FKJA 3N9UA 4OMZA 3DBRB 3H0GJ 3RKQA 2IGNA 4AIKA 1SFEA 2W00A 4UUVA 1QVTA 2IXSA 1BBYA 3K2AA 2YR2A 3GW2A 2GXAA 3F8CA 3PNTA 5CVRA 3S32A 3QYEA 4HLYA 2PX9A 3K4LA 2VL8A 2CO5A 2OAZA 4DZPA 3KEYA 3F72A 3ZQFA 1R58A 4BAYA 3A1YA 1J9IA 2G9WA 3E5UA
chains in the Genus database with same CATH topology
3E57A 3SFZA 1G0SA 4A6DA 3QOPA 4EJTA 5LHIA 2PJPA 3O69A 3DKWA 4HX8A 3EDPA 2YX4A 1J75A 2E1NA 4NFXA 3ZMUA 2A8PA 1XSXA 2ZO4A 4XLPF 2OZ6A 4M74A 5IT3A 2PG4A 1ZGAA 4G94A 4WCGA 2Y48A 2O8XA 2NYXA 3BP8A 5E20A 4IPAA 1P4XA 3MZHA 3FM5A 4O3MA 1LB2A 4UXNA 2DSCA 1O3QA 3MDGA 2UXXA 1H9GA 4OIQF 2PMUA 3F22A 2STTA 3WHWA 1FP1D 3F8BA 4M9ZA 4S2YA 2P7VB 4CO8A 1G3SA 2QLZA 3T5XA 3E5QA 2X0LA 1X84A 2FU4A 5DCFA 1XCVA 2STWA 2XGXA 3V8KA 3EESA 4EVIA 1DDNA 1HXDA 1KU9A 3FFUA 3O6BB 1HZTA 3M7GA 2PQVA 4HBLA 3F23A 1U6GA 5ISYA 5F6FA 3NEUA 5FSOA 3BM4A 4P9FA 4P5OA 4KG3A 3IKVA 1V8RA 2GZWA 3CUQC 2LF8A 5LLQA 3VB2A 2OU2A 2YVNA 5J8FA 4YPHA 3QRFF 1OR7A 1IUYA 3JSOA 2M30A 3WG9A 2CSOA 1Z6TA 1XSAA 2O3FA 4BYYA 1R00A 5JHUA 2DTRA 2HKXA 2IPQX 2ZKZA 3EF5A 5DCMB 3T8RA 4EGZA 3IHUA 1DPUA 2XAJA 2GQQA 2L54A 4KIFA 1O57A 4L9VA 5A2QK 1SMYF 3LA7A 1J2XA 3I59B 1IN7A 3I5UA 1OPCA 5E8GA 3V7CA 1GHCA 1BC8C 2CQKA 1P4WA 3KLNA 2QBYB 5DD4A 3DP7A 1ZARA 4NB5A 1I5ZA 4EJVA 3I7UA 3Q2SA 2Q8KA 2PQ8A 1VRLA 5K5OA 2V9VA 1IRGA 1XMKA 1XSBA 4DYWA 2E7WA 2XAHA 4Q48A 3EXQA 1UHWA 3I58A 4LMYA 1YQAA 3VFZA 4HZFA 1P92A 3CLOA 5HDNA 3J7Ye 5LHGA 3C18A 2Y75A 1HW1A 2CYYA 2XHKA 1E17A 1VC9A 3QU3A 3BJAA 4ENNA 4UV9A 1H0MA 4Q47A 3X0KA 1ZH5A 3J80K 3R60A 1MJ9A 1O7LA 5K5RA 2O0YA 3K1PA 2YPRA 3TQNA 1SD6A 1ZYRF 3A6SA 4IJXA 5FLXK 3MDIA 4PZJA 2J5PA 1T98A 2ZMEB 5AIQA 1D3YA 2DBBA 3L09A 1V8VA 1BOAA 3TDZC 2FEZA 5E18F 1IRFA 2DU9A 5ERIA 1MP2A 3PQKA 2GA1A 2IA2A 5EEHA 2M87A 2QUFA 4LG0B 1FX7A 1XDUA 3J81K 5GHOA 3U1DA 3WODF 2X4HA 3IRQA 2RV8A 2KRFA 2V1XA 3WGIA 1X51A 4NQWA 2VC0A 4LGWA 5HVQC 5ILUA 3I71A 4BHBA 2XVCA 1RNLA 2EFOA 5JI6A 2IA1A 1ZREA 4N9HA 2FMYA 2EV0A 2KIFA 1K78B 3ISPA 3GFMA 3BJOA 1KGSA 5ILVA 1K6OA 3BJ6A 2H27A 4RAZA 3RH7A 5LPGA 5IT9Z 1B4AA 2IA0A 2B06A 1W7PA 1RZ4A 5CVVA 3KLOA 1SOIA 1CF7A 2W57A 3E6DA 1YLFA 3FMQA 3RYPA 1LDJA 2OZUA 3WE2A 3IRRA 4MTEA 3R0AA 2L3DA 5C8LA 4C9XA 2B0VA 1I6XA 2L02A 4KUMA 4WF2A 3FX3A 3BPVA 1Q33A 4IXAA 1QZZA 2VE8A 2GB5A 1V8LA 3HIFA 1RRQA 5EEGA 4LB6B 5FSIA 3ZMDA 2LSOA 3SZTA 2BYVE 1S8NA 4Y17A 1J0RA 2A5YB 4L5IA 4CDGA 5E17F 1LJ9A 2VC1A 1VK6A 1YTYA 5HS7A 5A2QZ 2H94A 3O2PE 1PUQA 3L2CA 3ECHA 3F6AA 3RKXA 5H6RA 2YU3A 1PUSA 2ZCWA 1FY7A 3BZ6A 3FM3A 1V8YA 1JRKA 1MJBA 2YSRA 3GFIA 2FMLA 4E70A 1D5VA 4AVPA 1G3WA 3X0LA 3FF5A 5I8UA 2GA2A 1R1UA 1PP8F 4JZUA 3LFKA 2K7LA 3GWYA 2IT0A 4WWCA 4L5JA 1Q27A 1B9NA 2OQGA 4FHTA 3K9TA 2HQNA 3DEUA 1S29A 2VE9A 3EQLF 4KMUX 2JVBA 1J59A 2EFQA 1IAWA 4HDVA 5FD6A 1USSA 1Q54A 2K4BA 3E6BA 1R23A 4DNCA 4Z2YA 1JHFA 2FA5A 5D4SA 3RPQA 1FSEA 2FBHA 4HYEA 3BROA 5IW4A 2FE3A 1IXRC 4O5VA 1KYZA 2UXNA 3SZPA 1RRSA 2KIUA 2DLLA 3I64A 5D4RA 3HOSA 2VT3A 1J5YA 4EGYA 3HUGA 1NHAA 1G9QA 3QU6A 3Q91A 1GXPA 2FSWA 1BIAA 2RVCA 4R8HA 2O5WA 1TUMA 1R1TA 4BXUA 1VIUA 1ZAOA 1IN6A 2FXAA 3ZP5A 5FSNA 1IXCA 4KICA 2O1CA 2GT4A 4CYDA 1QVJA 3GRNA 4IF4A 4G9YA 5IT9K 3ZN1A 3JTHA 4HOBA 3G3ZA 4G6DA 4RB0A 4L0YB 1ZGJA 2QWWA 3V8LA 4OU0A 5BPIA 3DPTA 5AONA 5DV5A 4G7ZF 3EYYA 2AZWA 1P2FA 3E97A 4ASNA 5ANSA 3QAHA 3KP4A 3ZMSA 2QQAA 3CUQB 4GYIA 4LFUA 4KYWA 4IVNA 2MBFA 3VOEA 3RI4A 5FLXZ 1A04A 1YO5C 5D5XB 2DK5A 1F4KA 4M6YA 4U0WA 2LKPA 3GF2A 3K1NA 3FXUA 1KU7A 2B2KA 2EFPA 5J8CA 1QGPA 4IRGA 3GLXA 3KEOA 2DUKA 1ZN2A 2ZXJA 1SD4A 2ZJ2A 1PDNC 3D5LA 4GGGA 2AXLA 2I6KA 3TGNA 5L3BA 4UNOA 3X0NA 5D6EA 4HF0A 2H09A 2V1UA 2Z9OA 1NQZA 5F64A 3ML6A 4WXCA 3FMRA 3Q4IA 4I09A 4IHSA 5DCMA 3HYQA 2P5LC 3ELKA 5HLIA 1FBSA 3RKYA 1F9NA 4JQFA 5CVIA 2GXBA 4I0AA 2RKHA 2BV6A 4XRFA 4RB3C 1TQIA 4ENMA 4LLNA 4B09A 2A6EF 4RB2C 3HRUA 3I59A 4OINF 2VNPA 1WRJA 5IW5A 2A3SA 1HW2A 3HTSB 3AAFA 4FT8A 2UWMA 3MCFA 5D6FA 1ZRFA 2A6TA 1VIQA 4JZTA 2RDPA 4UVAA 1TNSA 2QBYA 1YIOA 3ZMTA 1KU3A 3CNGA 1EV7A 3F8FA 2I8TA 4EV0A 3HRMA 4GCVA 2R7FA 2QKMB 2LF7A 1W5SA 1PPWA 4QLCU 3P9CA 1IZ1A 2QJTA 5E1XA 3SXYA 1E2XA 5DPKA 1CGPA 3A6UA 1G3YA 4OIOF 2V1DA 3M9AA 3WU1B 4S05A 4EM2A 4JZVA 2HKOA 2DQRA 3AC9A 1T2KA 3SHFA 3HSFA 2QQBA 4FX4A 4HV6A 3KFWX 1FZPB 1V8MA 1MQWA 1DPRA 2ZFWA 4EM0B 2V79A 4S2WA 1QO0D 1G4DA 2OD5A 2F5EA 4JK1X 2KJCA 1T39A 3CO7C 1KA8A 2PMHA 3GFJA 3M1EA 1GXQA 4WK8F 4N1UA 1JGSA 5KVRA 4EQQA 3B73A 1PUNA 1NQYA 2CG4A 2JPCA 5FSKA 1KQ8A 2EV5A 1U2WA 2D45A 4Q5SF 3H92A 5DDGA 2EJRA 1SAXA 2A8RA 2QQ9A 5ICGA 5BPDA 4MPOA 4XBFA 3E6CC 4ESJA 2GXGA 2ESHA 3T1BA 2M5WA 5JFRA 4PCQA 5DEQA 4LLLA 4MQVA 2K27A 3JAMK 2P7CB 3O3KA 1IF1A 2XV4S 4H0EA 1F1ZA 2WTEA 3B02A 4GYGA 2HDCA 5KK1A 5D5VB 1MDMA 4BHPA 2GT2A 3SONA 5JR3A 3MEXA 1TW2A 5HZXA 1FBUA 1VC8A 5GHIA 3W6KB 1TTYA 4LK1F 4K2EA 1ZG1A 3K2ZA 3KETA 3FMSA 3QP6A 5E1WA 3BAPA 2FQ3A 5LGUA 3I53A 1TW3A 5FO5A 3X0IA 1V8TA 1KHZA 2NS0A 2Q2EA 1C0WA 1FBQA 3ERED 3O52A 2XAGA 4ZYGA 1FYKA 2VT2A 4IRHA 1YS7A 4NFWA 1R22A 5BS6A 2D1VA 5L3GA 2MLGA 2PBIA 3KP6A 1HKSA 2G74A 1U5TC 1V8SA 1Z91A 4ZZLA 4Y13A 1F3YA 3RDIA 2F2EA 2ZNZA 5CLSA 3TO7A 1ZRCA 2R5WA 4A0ZA 2Q9PA 1U78A 2RRKA 2W24A 4KYXA 3J81Z 1Z1DA 4G7OF 4HA8A 1IN4A 1UCRA 4EJUA 5FSMA 4JBAA 2ZNYA 2F5FA 5TJJA 3N77A 2JRTA 1W5TA 3BHOA 3MCZA 1I1SA 3CUOA 2DI3A 3TO6A 1H9TA 3CUQA 4AD9A 1KU2A 4CXFA 1FT9A 4PDKA 2O61A 1SU2A 5CVUA 3U53A 3L85A 5DUIA 2DAOA 1LEBA 2P8TA 2HYGD 4R1HA 2GIVA 3KP2A 3ROUA 1MQEA 4IHTA 5LEJA 2NNYA 2HQRA 3NQOA 2A8SA 2HR3A 3TDUC 5AIPA 2A61A 3HTUA 4ZZDA 4IRIA 3FHZA 2C6YA 1OYWA 3H95A 5ANVA 2Z33A 1F5TA 4A0XA 3KP5A 2HS5A 4FX0A 5ED4A 1W4MA 3IWZA 2KDVA 1UHMA 1J7KA 3ZN0A 1W7PB 1WSUA 1LDDA 4MGRA 5HLGA 1REPC 4I02A 5C7QA 4XSXF 1IRYA 5FSLA 1D8KA 4U7BA 2EWNA 4KA4A 4M71A 5BOXA 3I0TA 2PLYA 3RTRA 3I7VA 4Q4ZF 2QENA 1B1BA 4RGRA 4ESBA 3DV8A 3P9KA 2CZRA 4YFKF 3FSPA 4YOQA 1LEAA 3GZ6A 1WI9A 4U0YA 1NFSA 1PUEE 3L9FA 4A6EA 4LD5A 1HQCA 4DQ2A 4I98B 1U3EM 5LGNA 2FRHA 4GO1A 1QQIA 3T0YA 1UFMA 4YIFA 1U5TB 3GEZA 1Z7UA 3S2WA 4HLXA 3NRVA 5ANTA 4AIHA 1BJAA 2ISZA 3KP3A 2WWYA 4ESFA 3PQJA 2BGCA 3WTWC 4KN4X 2G73A 1K26A 3H3UA 4UV8A 2FBIA 1S6LA 4CHUA 4G7HF 1JHHA 3P7NA 3M8FA 5H6QA 3CTAA 3F3XA 1FYMA 4HF1A 2QJOA 3N4MA 3TO9A 4HW0A 3N97A 2O6GE 3FXQA 5HS9A 2RN7A 1MUTA 1XSDA 3LA2A 2E1CA 2LNBA 3P5TA 4TV7A 4I7HA 2WC2A 1MJAA 3JW4A 4P96A 2OA4A 4EM1A 1MR2A 1T0FA 3MQ0A 1BI1A 1RYAA 4M9XA 1WWXA 3C3WA 2HGCA 3L00A 3VEPA 3E5XA 3IL2A 3REOA 3LAPA 1OKRA 2M45A 5E1ZB 2FNPA 1SJYA 3C1DA 1K7AA 3ZPLA 2MA3A 1AOYA 2QM3A 3ULQB 2TDXA 2DFIA 2DQLA 1EH6A 4A5NA 1CF7B 3EEUA 4BNCA 1R5HA 3GXOA 4Y15A 1XGSA 2L4AA 1VTNC 1LQ1A 1BI0A 1LVAA 3LQRA 1MGTA 3HOTA 1OW2A 4KFCA 2EFWA 4IJAA 3WU0A 1ON2A 1TQMA 1P6RA 2FKBA 1NFZA 1TBXA 3M8EA 3X0OA 4A12A 1R5GA 2P6TA 1SD7A 3X0QA 2XIGA 2F5DA 1FOKA 1QZYA 1JKNA 3KE2A 1S7AA 3W6JB 1IW7F 3P6YA 1XSVA 2OQRA 4MHGA 4ZYDA 5CFIA 2CL3A 2VXZA 3HRSA 4RGSA 1VCDA 2DSDA 5FFZA 1LDKB 3DUPA 2P6SA 5CFJA 3E3VA 5E8IA 4WX9A 3Q1PA 2ICKA 1WKMA 4ZYHA 2JSCA 3FK9A 5TRDA 1O7FA 1X3UA 3TKYA 3X0RA 4L9TA 2YVPA 3WGHA 4CZZA 5ICFA 1IN5A 2VBZA 3CO6C 4HF2A 3ABUA 1QPMA 3SMDA 2V6CA 1MZBA 2XRNA 4OIPF 2EK5A 4BH9A 2D1HA 2JTVA 1YW8A 1T6SA 3X0MA 5K1YA 2KIMA 2Z3YA 2R7DA 3F6OA 3FZVA 3ID9A 2IVMA 2ESNA 4WXHA 4MTDA 3JAMZ 3Q2TA 3RJPA 3CDHA 3J80Z 3WTUC 4OMYA 4P9UA 4HFQA 5DYMA 5HOOA 2O5FA 2IP2A 1P4AA 1I27A 2DW4A 1G3TA 2XAFA 3BWGA 2ADUA 2QZ8A 3G0QA 2ETHA 2IW5A 5BQTA 2W85A 5FD5A 2A69F 2DSBA 2XKPA 3EUHA 4BHCA 2Z99A 3KZZA 3U2RA 1U5TA 3WTYC 4U0VA 3ZR1A 2HWVA 1K79A 3ZMZA 1HX3A 4JZSA 1YS6A 3COUA 1YFHA 2AS5F 3HRTA 1O3SA 1FNNA 3DPLC 2L4MA 2CFXA 5L3EA 2K02A 5HDGA 5J6XA 5L3FA 3C7JA 4PGHA 2D2WA 2WV0A 3KCCA 1T38A 1FC3A 2XUBA 3MAJA 3KEQA 1OYYA 1SFXA 1AWCA 2MH9A 4N0BA 5ANWA 3KVHA 4RGXA 2DPDA 4AWXB 3I54A 1XN7A 1BI3A 4D0PA 3DKUA 2EFNA 2VNQA 2EA2A 2UZKA 2PFBA 2RQPA 4KN7X 3GZ5A 2G7UA 3G73A 3BDDA 4HQEA 2JZYA 1KT9A 2NAZA 4EMSA 1OMIA 3Q9VA 3GFLA 5ICEA 3ECOA 3RKWA 2PN6A 1ZG3A 2NNNA 1DP7P 1XDSA 2P5VA 1B6AA 3BPXA 5HDKA 1O3TA 3COAC 2Q0OA 4KIGA 4LJZF 3FCMA 1YYVA 3HHGA 3HSRA 1I1GA 1SZ3A 3DFGA 3J7AO 5FB2A 1STZA 1HKTA 1JE8A 3OOPA 2J8QA 3WTTC 4LK0F 1HBXG 4KG4A 1SFUA 1Q1HA 2EV6A 3LWFA 2G7HA 4EJWA 4B8XA 3WTSC 1V4RA 1V8IA 2FNAA 4LG0A 4I2OA 2Z5UA 2K4JA 3IC7A 2HFHA 3GUDA 3WE3A 2KDWA 4ENJA 2QVOA 5DD8A 2HEOA 3FWEA 4RAYA 2I8UA 2DK8A 2H6BA 3LA3A 1RIOH 3GX4X 1D8JA 3GO5A 1ZRDA 4S2XA 1KYWA 2VN2A 1MKMA 1PVFA 1KTGA 5DUKA 5K5QA 5GHJA 1VHGA 5GHPA 5H20A 4KNYA 4R79A 1HW5A 1K78A 4I01A 4L9JA 3QSJA 5C7TA 2FF4A 3LAJA 1QBJA 1V8WA 3BOQA 2MC3A 2QYOA 3GG6A 1WQ2A 3L7WA 3VODA 2YVMA 2Y0MA 3K0LA 3GYHX 4MEYF 1L0OC 3WGGA 5D8LB 5HS8A 4ENKA 4HV5A 1Z6RA 3O8SA 1Z05A 2J5OA 1YW9A 3R4KA 4L18B 1HSTA 2GAUA 4HX4A 2FOKA 5CVJA 3QP5A 3RIRA 3QPHA 3R03A 2HYFA 3Q9SA 3H3ZA 3OGAA 4UVBA 1FYLA 2VBWA 3A6TA 3V8JA 4KIBA 1RI7A 1XGOA 3V7SA 5ICCA 2BEOA 2YVOA 5D8KB 5CJ9A 2A8QA 3GWZA 2IJLA 3GVAA 2KKOA 1EH7A 5D5WB 3BY6A 4G8XA 1RUOA 2B0LA 2P5KA 2E7XA 3MFKA 3X0JA 1V8NA 2ZBKA 1TLHB 4I0BA 4S04A 3JTGA 1HKQA 3ZQ7A 3GZ8A 3KP7A 2MD5A 2ELHA 3TOBA 3F8NA 5ILSA 3P9IA 3FJYA 2PNYA 1V8UA 3ZR0A 1R36A 3F21A 1ZG5A 4A2UA 2XAQA 4M9SA 3SHDA 4U88A 5HLHA 3R6SA 1O3RA