3GZ5A

Crystal structure of shewanella oneidensis nrtr
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
218
structure length
214
Chain Sequence
QLLTVDAVLFTYHDQQLKVLLVQRSNHPFLGLWGLPGGFIDETCDESLEQTVLRKLAEKTAVVPPYIEQLCTVGNNSRDARGWSVTVCYTALMSYQACQIQIASVSDVKWWPLADVLQMPLAFDHLQLIEQARERLTQKALYSLVPGFALSEPFTLPELQHVHEVLLGKPIQGKSFRRRVEQADLLIDTGLKRTPANLYCLKPDTASYRFLRNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of an ADP-ribose-dependent transcriptional regulator of NAD metabolism
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Dna binding protein
molecule keywords MutT/nudix family protein
total genus 60
structure length 214
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gz5A02
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3gz5A01
1MK1A 3ZN0A 2EWNA 3FHZA 1YW9A 5TJJA 2VN2A 4WCGA 1PPVA 2XROA 1JHHA 3DP7A 3WU1B 4D0PA 1HBXG 3ZMUA 1ZG3A 2DTRA 5IT3A 5DD4A 1ZLKA 4Q47A 5IT9Z 2P8TA 3J7AO 4Y15A 3BHOA 5E1ZB 3LSTA 1U5TA 3V7RA 1IN8A 5F1RA 1ZAOA 3KP7A 3VFZA 2F5DA 3GYHX 2OD5A 1T2KA 1R1TA 1QGPA 3KP3A 2KIFA 1IRFA 3A6SA 5E1WA 5CVJA 3F8BA 4AIJA 1XB4A 3I71A 2DAOA 1LNWA 3RDIA 2LDUA 2CG4A 2CQKA 2L4AA 5FD5A 2VODA 3HOTA 2DBBA 2DHOA 2CSOA 4HF0A 3P9KA 4S05A 2EB7A 5D5UB 5AONA 1GA7A 2A61A 4MQVA 1ONVA 5CVIA 4CICA 1MJ9A 2VBZA 5LEKA 3WTXC 1WI9A 4AD9A 2JT1A 2COMA 2P7VB 4JZSA 3QP6A 2XAJA 4EGYA 1VC8A 2XV4S 1UB9A 4N1UA 2ESHA 3F6AA 2O61A 3CNGA 3T8RA 3Q5FA 3F8MA 2VOOA 3IRRA 5BMZA 2IVMA 3IHUA 2NAZA 2DO7A 2ICJA 3FK9A 3X0OA 1YG2A 3I53A 3LAPA 1K6OA 1ZGJA 3MDIA 3WTWC 1KQ9A 3HHJA 1JHFA 2XAFA 1G6NA 2LSOA 1S6LA 1BC7C 2B0VA 4KIFA 1MP2A 1TQPA 4OOIA 4U0WA 1T0FA 2AS5F 3N77A 4NHJA 3K1PA 4L9NA 5HS7A 1O3QA 1IN7A 4RB0A 3O8SA 4P55A 2FSWA 3F13A 3SZTA 3S2WA 3RTRA 3WG9A 2FEZA 2M87A 1V8LA 1J7KA 2MH2A 4M71A 2YU3A 4AVPA 4FX4A 1U3EM 1U2WA 4KIGA 1V8RA 3FCMA 1VRLA 5HDGA 2K4JA 2J8QA 2DK5A 3V4GA 2L54A 1Z9CA 2IRFG 3SQNA 3HHGA 1R00A 3M9AA 4G7ZF 2RDPA 5K5RA 1AOYA 1ZYRF 3SHDA 2H6CA 1T6SA 3TOAA 1EV7A 2PEXA 2MD5A 2YVMA 4IXAA 3QAHA 3FFUA 1WKMA 3RIRA 3V8JA 4ZYEA 3GZ5A 4HLYA 4KICA 3J7Ye 1B59A 3I5UA 2CL3A 1HXDA 4KT5C 4UVAA 3SZPA 4CO8A 1HQCA 2X0LA 4I7HA 1XGOA 2STTA 3OV8A 3CO6C 3JW4A 1K78A 1T39A 4XSZF 3L7WA 1QO0D 5HS9A 4HF1A 4B8XA 1ZN2A 2ZCWA 2PLYA 2M1BA 3GUDA 3HHHA 2FE3A 2OZUA 1Q27A 3HRTA 1X84A 3I7UA 5E20A 1JRKA 3X0KA 5DPKA 4XLNF 3QSJA 4GGGA 4JZUA 5D5WB 4UV8A 5AIQA 3E6MA 2QM3A 4O6JA 2Q0OA 5ILSA 2HQRA 4I0BA 3HSEA 1RIOH 3C3WA 2HZTA 3FZVA 3HSRA 2XVCA 1YW8A 1MD0A 3MDGA 3G3ZA 5KVRA 1QPMA 3QU6A 1K78B 2R7FA 4DQ2A 2FMYA 1V8UA 3KCCA 3DPLC 5JVTA 2YX4A 1RUOA 3GO5A 4L9VA 2CW0F 1ZG5A 2XIGA 2XHKA 1XCVA 2TDXA 4HVYA 2KJCA 1VIQA 3X0SA 5K5QA 3WGIA 5LEJA 1SZ3A 3LA2A 3BPVA 4WK8F 1ZREA 1X83A 3ID9A 2Y48A 5ANVA 1TW2A 2BYVE 2VBYA 2ZO4A 2FNPA 1RRQA 4A2UA 5GHOA 1D8KA 3KEQA 3LAJA 3DEUA 5HVQC 2EV6A 2KJBA 2QLZA 4WXCA 3SHFA 2KIMA 5D4RA 3RKXA 1MR2A 1OR7A 4FX0A 2G7UA 1V8MA 4LLNA 5L3DA 1SD4A 3MEXA 3M8FA 4G7HF 5BPIA 2GT2A 3BP8A 2XASA 5LPGA 1SD6A 1FBUA 4M9SA 5ANTA 2GA1A 3ZR0A 4RAZA 2O8XA 1S8NA 1FSHA 1KU2A 3WTUC 4LMYA 3E5QA 5D8KB 1E17A 2O6GE 4PZJA 2JTVA 3MZHA 3GVAA 3HOSA 5FSKA 1Z6TA 4BHCA 3W6KB 2VC1A 3Q2SA 1P6RA 2C6YA 3FWEA 5ICEA 3QPHA 2DI3A 2RRKA 5BONA 3HYQA 2FBKA 1UCRA 2Z33A 4HLXA 3BM4A 2IW5A 3COUA 2D1VA 3MZYA 4IRHA 4OIOF 4I01A 4KFCA 2G73A 2M5WA 3C7JA 3Q2TA 5DV5A 3I0TA 2L01A 1PDNC 4BAYA 4HV6A 5D5XB 3ACAA 2EA2A 2EFNA 3GWZA 1YW7A 4BYYA 2CGPA 5H20A 3F21A 4QLCU 2HKXA 4A0XA 5GHPA 1V8NA 1I6XA 2Z5UA 1H0MA 1Q1HA 3T5XA 3MGMA 4ESJA 3WTTC 1XDSA 2KRFA 5LRRA 4R79A 4Q4ZF 2XRNA 1FP2A 1RRSA 2ZNYA 3X0RA 5BQTA 2ACJA 1BI0A 2P6SA 1SFUA 3ECHA 3FMRA 3F6VA 1K7AA 5J6XA 3HUGA 3BWGA 2JSCA 5D8LB 1IXSB 1EH7A 3R03A 2VBXA 3KVHA 2DLLA 1UFMA 3ELKA 3F8NA 5IT9K 2VNQA 1HW5A 1STZA 2KKOA 2NRAC 3DV8A 3J80K 2I8TA 3I9XA 3M7GA 4S2XA 3OOPA 1P92A 3HRMA 4EJWA 4RGSA 3PQKA 2ZFWA 1JE8A 3KFWX 4I02A 4LB5A 4CGZA 3EUHA 2XGXA 4K2EA 1USSA 1OMIA 3DUPA 4BH9A 2A68F 3I59A 1J0RA 3G0QA 3H92A 1H9TA 4E70A 1KU9A 4HDUA 1ZH5A 4GXOA 3FXRA 1B6AA 5IW5A 3GXOA 3TKYA 1ZRCA 1OYYA 3IL2A 4HX8A 2VNPA 1WWXA 5EEGA 2RN7A 2FKBA 1R1UA 4ZG0A 2M30A 3HIFA 3E3VA 1BJAA 3O6BB 5GHJA 1X51A 1J59A 4U0VA 1RNLA 5LHHA 4AIKA 2K4BA 1K2EA 4M73A 1LJ9A 4EM2A 3WHWA 2MH9A 2G7HA 4UVCA 4ESFA 4MEXF 3X0IA 2A5YB 2HOEA 1O7LA 2F5EA 1GXPA 3FM3A 3TO9A 2HYFA 4KMUX 1PUQA 3KZYA 4JBAA 2QBYB 3GG6A 2IA1A 2DFIA 4UVBA 4MPOA 1RUNA 4L0ZB 1R5GA 2F5CA 5DCMA 1LEAA 1UHWA 3GZ6A 1NFSA 4PCQA 4UXNA 4EJUA 3FX3A 2QQBA 1R5HA 3U53A 5ICFA 1C0WA 4C9XA 4HYEA 4MNUA 4G6QA 3BJAA 2ISZA 5FSNA 2ADUA 3IKTA 1VIUA 4RGUA 1BIAA 3GFMA 1YTYA 1GHCA 2GQQA 4RAYA 4JZTA 4IRGA 3GF2A 1W5TA 2NYXA 2A6HF 1B9NA 3U2RA 1SU2A 1FBQA 3FJYA 2ICKA 5HLGA 4MEYF 2LF7A 2FVVA 1R1VA 1O3TA 4OMYA 1XGMA 1Z91A 1TNSA 3KP4A 4V14A 5C7TA 1LDJA 2GB5A 1J9IA 4M9XA 5AIPA 2GXBA 3V7CA 2OAZA 4LGWA 2R5WA 5FFXA 2RGVA 3N4MA 4MHGA 5LGNA 4LJZF 5A2QK 1YS6A 4JZVA 1RZ4A 4ICKA 4S2YA 3V7SA 1TW3A 2NNNA 3CDHA 1O3RA 4EMSA 3ECOA 4P9UA 5BS6A 4LFUA 1VK6A 2EA4A 3JTHA 4GO1A 2MA3A 1YFHA 2RNJA 2XUBA 3KETA 2FOKA 4KG3A 1GXQA 1D8JA 3P9IA 2O3FA 1OYWA 2P5LC 1E2XA 3L2CA 5IW4A 2O1CA 5FSLA 2BEOA 5L3BA 3IWFA 5D6EA 2IPQX 2PI0A 2B0LA 1RYAA 4MTEA 2QQ9A 3RPQA 2PMUA 3NEUA 2QYOA 2ZJ2A 5TRDA 2DSDA 3SFZA 2QQAA 1FWZA 4KMFA 4EJVA 2JPCA 4YPRA 4KYWA 3TO6A 3GLXA 1I1GA 1F5TA 3U1DA 1L0OC 5FD6A 2GAUA 3O61A 1D3YA 1ON1A 4MTDA 4Q48A 2IJLA 3H3UA 3D0SA 1BI1A 3WU0A 3L9FA 2NNYA 4GYIA 2VC0A 1U5TB 4LK1F 1U6GA 4FHTA 2UWMA 2P4WA 3K9TA 1VHZA 5A2QZ 4NFWA 3I64A 1G3TA 1PP8F 3WTVC 5D5VB 4EJOA 2ZKZA 1U8RA 3FMSA 3BOQA 1IF1A 2QWWA 1ODDA 1BC8C 3P6YA 2R7DA 6PAXA 1LDDA 4DYWA 5L3EA 5C8LA 2E1CA 1OKRA 3LA7A 5J8FA 2V9VA 4UNOA 1F1ZA 1B1BA 3ZMTA 3RYRA 1XSBA 4ZH4F 4KIBA 4ILQA 3RKWA 1FLIA 3T0YA 2PBIA 5ICGA 2PFBA 2FBHA 4EM0B 1IRGA 3RPUA 5D6FA 3ZN1A 2ELHA 3CTAA 5L3GA 2O03A 3HSFA 3WE2A 2GT4A 1S7AA 2D2WA 2RQPA 5D4SA 1UHMA 2LNBA 2VE9A 1IRYA 4U7BA 4PGHA 2DW4A 2EFPA 3EXQA 5LBQA 4S04A 3TDUC 3WGGA 3O6ZA 2W57A 1Z7UA 5BPDA 1J2XA 1D5VA 4R1HA 2V6CA 1G0SA 2K86A 2ZXJA 3M1EA 3GEZA 4OIPF 4LG0B 5I8UA 3KLOA 1YLFA 3X0QA 4JQFA 2E7XA 3O3KA 4YPHA 2YX7A 3DKUA 4XSXF 2JVBA 3H95A 1JGSA 4A5NA 3KP2A 1XSVA 3EDPA 2RC4A 3CUQB 2CYYA 3MAJA 4XLPF 1KQ0A 4A0YA 3BJOA 5FSOA 5HOOA 4KDPA 3VOEA 2DPUA 1O57A 3Q4IA 2HQNA 2DK8A 4BQAA 1XSDA 1IUYA 2BBYA 2W4EA 3F22A 1F3YA 2E1NA 4R8HA 2EFQA 2JZYA 1KYZA 3TOBA 3J80Z 4S2WA 4ETSA 1KTGA 2I6KA 3WTZA 2R3SA 1R58A 3JTGA 1IN4A 1B9MA 2Z3YA 4HBLA 3BZ6A 3X0LA 1XD7A 3EQLF 2FU4A 3I4PA 5GHQA 1KYWA 4CHUA 1Z6RA 5HLHA 4YFXF 1U78A 2GWRA 1XSXA 5CYVA 3LWFA 1CF7A 5HDNA 4RS8A 3GZ8A 4C9WA 5ED4A 1IW7F 2VBWA 3X0PA 1SOIA 2Q2EA 2QUFA 4L5JA 5CLSA 3C18A 3KP6A 5JFRA 1I5ZA 3QP5A 4XBFA 1TLHB 3JSOA 5ANWA 2Q9PA 4O5VA 1U5TC 2UZKA 3ZMZA 3JAMK 2HYGD 4AWXB 3BDDA 4KTBA 1KGSA 2MLKA 2XSQA 1SMYF 5DEQA 4EQQA 1ON2A 4B09A 2Y0MA 4K6EA 3CUQC 3R6SA 2KDVA 3IRQA 1PUSA 4BHBA 3T8TA 1K26A 1HKTA 1MKMA 4GYGA 3ZMDA 1O7FA 2OQGA 3TDZC 3SMDA 5ILUA 5H6QA 2H27A 3K2ZA 4G7OF 3X0NA 3EESA 5JI6A 1RI7A 3WTYC 1JXSA 2LF8A 3HYIA 1OYIA 3Q9SA 4CDGA 1WRJA 2LKPA 2P5VA 2UXXA 3I54A 1V8WA 1FZPB 1KQ8A 4L18B 2UXNA 1HKSA 1LQ1A 2EV5A 4G9YA 2VONA 1ZLJA 4CXFA 5LLQA 1T38A 3QU3A 3DQVC 1MGTA 2DQLA 5E8GA 2YVOA 2Z99A 1SD7A 3GRNA 1HX3A 1WSUA 2YVNA 3R4KA 3EF5A 2HS5A 3MFKA 2ETHA 4L9TA 4M6XA 2QJTA 2OU2A 1Z1DA 2O5FA 4HA8A 1O3SA 3ABTA 2HDCA 2RKHA 3J81K 2DSCA 5FO5A 2A6TA 3BY6A 4ZYGA 3ZMSA 3E6DA 3KEOA 5JHUA 2HEOA 2A8RA 2A8SA 3QOPA 1KT9A 1PVFA 3A6TA 2QVOA 4NFXA 3ML6A 4BXUA 1DPUA 3DF8A 3B02A 3MQ0A 1V8SA 4GCVA 2OQRA 3MCFA 3LFKA 3L09A 5HZXA 1XCBA 1HKQA 3GFJA 1J75A 1TTYA 2ISYA 3CO7C 1Q54A 2O0YA 3Q9VA 1IN5A 3JSPA 1MJBA 2RV8A 1NQYA 4IHTA 2QKMB 2XKPA 4LD5A 3AAFA 3VODA 2A69F 3HTUA 1W7PB 3IC7A 1H9GA 1F4KA 4IHSA 1PUEE 4EM1A 3C1DA 4I09A 2V79A 1KU3A 4MQ9F 5L3CA 1G4DA 1LVAA 1HZTA 1VHGA 5FLXK 5ANSA 3KZZA 4NB5A 4I0AA 1BOAA 3GWYA 2QZ8A 1V8YA 1V8VA 1XN7A 4YIFA 4KN4X 3G73A 2ZMEB 3TGNA 4M9ZA 2CFXA 4N9HA 1P4WA 5CFJA 1PP7U 3RH7A 4ENNA 1USTA 4EVIA 3NQOA 3FSPA 3D5LA 3N9UA 2A8TA 3V8LA 3ZMVA 4ZZDA 4EJTA 4LK0F 1FC3A 2HKOA 5GHMA 1I9AA 5LGTA 1W4MA 3F23A 1Q33A 3R60A 5H6RA 3P9CA 1REPC 5E1XA 3K69A 3OGAA 4N1TA 3KLNA 2IP2A 3WGHA 5ICCA 3K0LA 4AIHA 2PMHA 2WC2A 3FF5A 4HQMA 1BI3A 4ZYDA 4YFKF 3SXYA 3ZPLA 2V1DA 3PFIA 4ZYHA 5DUKA 4BHPA 1X3UA 4UHTA 5F6FA 1BBYA 1MUTA 3O52A 1FYMA 2H94A 2L02A 1FY7A 1DP7P 3O69A 2E7WA 1G9QA 4A12A 3J81Z 2PG4A 4A0ZA 5HS8A 3MWMA 1CF7B 3L00A 5DD8A 1YYVA 4HX4A 2BGCA 5F64A 2YR2A 3E5XA 3DFGA 2XAQA 1LB2A 5J8CA 2YYHA 2AZWA 1CGPA 3RKYA 4HX7A 1I27A 5K5OA 2P5KA 4M72A 1BM9A 3Q93A 1HSJA 1S29A 2PQ8A 3F8CA 3W6JB 1ZGAA 5FLXZ 1HW2A 2MC3A 1WQ2A 5KK1A 3DKWA 4P9FA 2FA5A 3EYYA 4CZZA 1G3YA 4HV5A 2QENA 2K02A 2K7LA 2Q8KA 1ZHFA 2DQRA 1BN5A 5LHIA 3F72A 1MQEA 2OA4A 1V3FA 1OW2A 1FYLA 2D45A 2WTEA 1S3JA 5ERIA 2FMLA 1DDNA 4RGRA 3HRSA 2P7CB 2IA0A 1AWCA 5E17F 3I7VA 2K27A 1B4AA 2KDWA 2CO5A 3MCZA 2DPDA 1VC9A 1QZZA 3GFLA 1ZRFA 1JKNA 5FFZA 4A6EA 2STWA 5ILVA 2FNAA 3F6OA 4P5OA 3R61A 2ZBKA 2EFOA 2ESNA 4N0BA 2B2KA 3GW2A 2BV6A 1R36A 4OINF 1FT9A 2FBIA 4L9JA 3NRVA 2G74A 1K79A 3A6UA 2PNYA 1TQMA 4KYXA 4G8XA 5E8IA 2YSRA 3X0JA 2A3SA 2P6TA 4TV7A 4U7DA 5CVRA 3AC9A 3E6CC 2ZNZA 2MLGA 4HAMA 2VE8A 3I59B 3Q1PA 4ON0A 4U0YA 4HZFA 2H09A 5DCMB 2A8QA 3BPXA 1T98A 3CUOA 3ISPA 5FB2A 4BNCA 1DUXC 5LHGA 3WODF 4HF2A 1I1SA 1XDUA 4PDKA 5EEHA 2EJRA 1OPCA 3E6BA 1KA8A 2XAHA 4LG0A 4RB3C 2EFWA 3R0JA 3KP5A 1YIOA 1FSEA 1W7PA 4LB6B 2PJPA 4WX9A 2W24A 1W5SA 1YQAA 1W7PD 3DXJF 2IA2A 3E5UA 3PQJA 1U20A 5FGMA 1XGNA 2JRTA 1V8IA 3QPTA 2KIUA 3RYPA 1S7OA 1ULYA 1FNNA 3TO7A 4ESBA 3IWZA 1QQIA 3ZP5A 1G3SA 1XMAA 1ZRDA 1BI2A 4G94A 1QVJA 1TQIA 2VT2A 2HWVA 3LA3A 3ROUA 2H6BA 5GHIA 2HTSA 2JPBA 2WWYA 3N97A 1P2FA 3JAMZ 3VEPA 1V4RA 4WWCA 3KE2A 2GXGA 1TUMA 1QNTA 3FXUA 4MGRA 4I98B 3VB2A 4EV0A 1MDMB 2OZ6A 1Z05A 4ZZLA 4UV9A 2V1XA 1PUNA 1IXRC 1FBSA 1FX7A 2XAGA 4KA4A 2A8PA 2QBYA 5DDGA 1YO5C 1LEBA 2HR3A 3CLOA 4YOQA 1TNTA 2V1UA 2QJOA 3IKVA 2F5FA 1XMKA 2J5PA 2Y75A 4IF4A 3WE3A 1TBXA 1YS7A 3QRFF 3FM5A 2VOPA 1SFEA 2M8EA 1NQZA 1QBJA 4N9IA 4YG2F 4ENMA 1P4AA 3EEUA 3CJNA 2D1HA 4P96A 1NFZA 3DPTA 2I8UA 2HGCA 3RI4A 4KG4A 5DCFA 2VXZA 4KUMA 3CUQA 5JR3A 4H0EA 1VCDA 3P7NA 1QZYA 4M6YA 3LQQA 1R22A 1IAWA 1VTNC 3BAPA 1P4XA 1SAXA 1MQWA 2G9WA 5L3FA 3TQNA 5HDKA 4UUVA 2DU9A 4JK1X 2FXAA 1MDMA 4PGGA 3ERED 4KNYA 4HOBA 3ULQB 1EH8A 2RVCA 1F9NA 1GVJA 1XSAA 3A6VA 2L4MA 4LLGF 5CVVA 3V8KA 4A5MA 4HDVA 4FT8A 5CJ9A 1EH6A 1ZARA 4HQEA 4L5IA 4S2VA 4QWQA 4ENJA 4O3MA 4KN7X 4WXHA 4CYDA 2O5WA 1BIBA 5FSIA 4IRIA 3I58A 4IJXA 1V8TA 3WTSC 1FYKA 1SMTA 4ENKA 3B73A 4EGZA 2OBPA 4L0YB 4RB1A 3L85A 1XSCA 1MZBA 3ZQ7A 2DUKA 3BJ6A 2EV0A 1PPWA 3ZR1A 3HTSB 3SONA 1MJAA 2EK5A 5DUIA 1R7JA 3GX4X 4Q5SF 3T1BA 3REOA 2GA2A 1PPXA 1Y0UA 4IJAA 2B06A 2PQVA 1FP1D 4WF2A 3M8EA 2X4HA 4YIIA 5LRSA 5DYMA 4OIQF 3FXQA 2FF4A 3E97A 2M45A 4OIRF 1DPRA 1ZG1A 5GHNA 4IVNA 5C7QA 2GZWA 3H3ZA 3Q91A 1LDKB 4DNCA 1SJYA 2W85A 1A04A 2W25A 2YVPA 4I2OA 5CVUA 1FPQA 5HLIA 4Y13A 1R67A 4Y17A 3R0AA 2YPRA 2NS0A 3EETA 2L3DA 1R23A 2CWEA 3K1MA 4OU0A 5BOXA 2GIVA 5ANUA 1IXCA 3F8FA 4NQWA 4U88A 3LQRA 2HTJA 4LLLA 3ABUA 5CFIA 2WV0A 2A6EF 4IPAA 4OMZA 4F7ZA 4ASNA 3HRUA 3K1NA 3F3XA 4A6DA 1XGSA 2AXLA 4XRFA 1SFXA 2ZMEA 2J5OA 1L3LA 2BE5F 2DT5A 2PN6A 3FMQA 1G3WA 2A07F 1KHZA 2VT3A 1SD5A 2HFHA 3COAC 5E18F 5ISYA 2FQ3A 2F2EA 4HFQA 3E57A 4Z2YA 2W84A 1IZ1A 1HW1A 4M74A 4HW0A 3U9GA 1IN6A 1KU7A 3P5TA 4G6DA 1HSTA 3BROA 4RB2C 1FOKA 3RJPA 3O2PE 2MBFA 1J5YA 4YFNF 2IT0A 5FSMA 2FRHA 2Z9OA 4WXDA 3GFIA 5K1YA 4RGXA 3X0MA 2DSBA 5LGUA 3EYIA 1NHAA 2XKOA
chains in the Genus database with same CATH superfamily
3OMYA 1MK1A 2ELKA 3LMMA 3OL3A 4KJZA 3ZN0A 2EWNA 3FHZA 1ETQA 1YW9A 5TJJA 2VN2A 4WCGA 5KCMA 1PPVA 2XROA 1JHHA 3DP7A 3WU1B 2ZB9A 4D0PA 2NVYJ 1HBXG 3ZMUA 1ZG3A 1MMGA 2EIMH 4BU2A 1JJ6C 2DTRA 5IT3A 5DD4A 1QVTA 1ZLKA 4Q47A 2CFOA 5IT9Z 2P8TA 2LREA 3K10A 2EINH 1D1AA 4XICA 3J7AO 4Y15A 4CCLA 1JTXA 3OY9A 2MD0A 3BHOA 2OC6A 3OIQA 2PX9A 3LSTA 1U5TA 5E1ZB 3V7RA 1IN8A 3B6AA 5F1RA 1ZAOA 3KP7A 3VFZA 3CCUI 2F5DA 3GYHX 2OD5A 2QSFX 1U9NA 3JR9A 3CJRB 2EBIA 1T2KA 2HDWA 1R1TA 2DA3A 1QGPA 3W2VA 1FMWA 3Q0UA 3KP3A 4AYBA 5M5WJ 4E7SA 2DDBA 2KIFA 3KZIC 1IRFA 3A6SA 3DEWA 5E1WA 5CVJA 3F8BA 3PM1A 4AIJA 1XB4A 3I71A 1WVRA 1R49A 3CCLI 2DAOA 1FOXA 1LNWA 3RDIA 2LDUA 2CG4A 2CQKA 5HNHA 1HDPA 2BVLA 2L4AA 2OJED 5FD5A 2JK3A 2VODA 3S15J 3HOTA 2DBBA 2WB1N 3P5JA 2DHOA 2CSOA 3MKWB 4HF0A 3KYCB 3P9KA 3PUBA 1QVUA 1UMQA 5B1AH 3BTJA 2EB7A 4S05A 2QQ8A 2HOSA 5D5UB 2CV2A 4RBOA 5F08A 5AONA 1GA7A 1LE8A 3A4CA 2A61A 4MQVA 1ONVA 2I5UA 5CVIA 4CICA 3OIPA 1MJ9A 2VBZA 5LEKA 1BR4A 3WTXC 1MSFC 1Z3YA 1WI9A 4AD9A 1VQLI 2JT1A 2COMA 3CMAI 3GTGJ 2P7VB 4UY8I 4JZSA 3QP6A 2VPLA 2XAJA 4II3A 5GAHJ 4EGYA 5J47A 1VC8A 1RETA 2XV4S 1UB9A 1WHUA 4N1UA 2ESHA 3F6AA 1AKHB 2O61A 3CNGA 5EG0A 3T8RA 1JKQC 2K9LA 1ITYA 3Q5FA 1GLNA 3F8MA 2VOOA 2KIQA 3IRRA 5BMZA 3K4MA 2IVMA 2X6OA 3ASNH 2LLKA 3S3MA 3RQIA 3IHUA 2NAZA 1E0EA 2GOXB 2DO7A 3QQAA 2ICJA 3FK9A 3X0OA 1YG2A 4AU7A 1TWGJ 5J1UA 3I53A 3LAPA 3MN2A 1K6OA 1ZGJA 4G12A 1JJ8C 3WTWC 3MDIA 1KQ9A 3HHJA 5JLWA 1JHFA 2XAFA 3J7AY 1G6NA 2DODA 2LSOA 3HUGB 2WADA 3OYNA 1S6LA 3RZDJ 1BC7C 2B0VA 4KIFA 1MP2A 3IH2A 1TQPA 2F4IA 4NBQA 3SYTA 4OOIA 3H9GA 2LH9A 4U0WA 2Y30A 1T0FA 1Q1VA 2AS5F 3ZRGA 4RA2A 4NHJA 3GTLJ 3K1PA 3N77A 2MYSA 3FIWA 4L9NA 5HS7A 3WHBA 4BQOA 1O3QA 1IN7A 1FOWA 5GTHC 4E7JA 4RB0A 5BNGA 1YJ9I 2B63J 3O8SA 4JX5A 4P55A 2FSWA 3F13A 4B3AA 1MBJA 3SZTA 4A3MJ 2NVUB 3S2WA 3RTRA 3WG9A 1TP4A 3DKYA 2FEZA 4J01A 3SJMA 2M87A 3IV5A 1V8LA 1J7KA 1WH5A 2MH2A 4M71A 2YU3A 4P1WA 4AVPA 4FX4A 1U3EM 2OTJI 3HC7A 3H9JA 1U2WA 4BL0B 2DA6A 4KIGA 1V8RA 3FCMA 1VRLA 5HDGA 3CMYA 2XDVA 2K4JA 2J8QA 2OCEA 2CQQA 2DYRH 3DBHB 4DYCA 4HNVA 2DK5A 3DLLF 2K9SA 3V4GA 1E3HA 2L54A 2WA0A 1ZQ3P 1Z9CA 2IRFG 3SQNA 3HHGA 1TC3C 1R00A 3M9AA 3AG4H 4G7ZF 2RDPA 1M1EB 5K5RA 4A3CJ 1AOYA 1ZYRF 3SHDA 2H6CA 1T6SA 2NOJB 3S16J 4ZDPA 3TOAA 3V42A 3HXLA 2LKSA 1EV7A 2PEXA 2MD5A 1MW7A 4IXAA 3QAHA 2YVMA 1WKMA 3RIRA 3HGGA 3V8JA 1Y6IA 3FFUA 3LNQA 4ZYEA 4BKXA 1JKPC 3GZ5A 3EUHC 2HOTA 2DJNA 4KICA 4HLYA 3J7Ye 1B59A 1NK3P 1UAAA 3I5UA 3BR2A 2DT7B 2CL3A 1HXDA 1MBGA 4KT5C 4UVAA 3SZPA 4CO8A 2VQCA 2M4GA 1HQCA 2X0LA 5EZGA 2KDZA 3F0CA 3OSFA 3VYSB 4I7HA 1XGOA 4EEFG 4YRVA 2ZSHB 5F0FA 2STTA 4M3DA 5J40A 3OV8A 3CO6C 2DA2A 5IY5H 3HDDA 2Z16A 3JW4A 4B4CA 3MKZA 1T39A 4XSZF 1K78A 3FXOA 1BL0A 2ID3A 1MIJA 1QO0D 3L7WA 5HS9A 4HF1A 2CUJA 4B8XA 3BCAA 1ZN2A 1X1CA 2TRTA 2ZCWA 2PLYA 2M1BA 3GUDA 4J00A 1GUUA 3HHHA 2FE3A 1I39A 4DZJA 2VASA 2OZUA 2Y69H 1Q27A 1RPWA 3BC8A 3HRTA 4XKVA 1X84A 2W7NA 3I7UA 5E20A 1JRKA 4IEJA 3X0KA 5DPKA 4XLNF 3QSJA 3N05A 4GGGA 4PJNA 4JZUA 5D5WB 4UV8A 1EF4A 1J09A 3O8GA 3E6MA 2QM3A 2ICWG 4HSRA 2Q0OA 4O6JA 5AIQA 5F04A 2CV0A 1UJ8A 1WJEA 4E7ZA 5ILSA 2HQRA 4I0BA 3HSEA 3CF5F 1RIOH 3C2BA 1TWHJ 3C3WA 2HZTA 2VB6A 3FZVA 2XB0X 3HSRA 2CV1A 1I3AA 1R4MB 2XVCA 1N25A 3G1OA 1YW8A 1MD0A 4RLFA 3MDGA 3G3ZA 1VQ6I 5KVRA 5LFAA 1QPMA 3QU6A 1E3PA 3CC2I 3K70C 2F4OB 1K78B 2R7FA 4DQ2A 2FMYA 4RDUA 1V8UA 3KCCA 3DPLC 3BR0A 5JVTA 2YX4A 4FTHA 1RUOA 3GO5A 3LSIA 2JQ7A 1BJZA 4L9VA 1P7IA 2CW0F 3OYMA 4A3KJ 1ZG5A 4D7NA 2XIGA 2XHKA 1XCVA 2ID6A 1DU0A 4RAFA 2TDXA 4HVYA 3JREA 3SEQA 3SFIA 4BBSJ 3GTMJ 2Y0SA 2HVSA 2KJCA 4ABZA 1VIQA 3HBLA 4IKFA 3X0SA 1MBEA 3CLQA 5K5QA 4MIMA 2KPMA 3WGIA 2LOOA 5EYRA 1VQ7I 5LEJA 1MNDA 4DJAA 2KL4A 1SZ3A 2CRGA 2K40A 5EJCA 4LG3A 1X2MA 4DBQA 3LA2A 3BPVA 2OUMA 4WK8F 4IHYA 1ZREA 1X83A 3ID9A 2Y48A 5ANVA 1TW2A 2BYVE 2LVSA 2VBYA 2FNPA 2ZO4A 3ABMH 4A2UA 3I4MJ 3DPUA 1RRQA 5GHOA 2CW7A 1D8KA 3K4CA 3CF2A 3KEQA 3LAJA 3DEUA 5HVQC 2EV6A 3VSKA 2KJBA 2QLZA 4WXCA 1MBKA 3SHFA 2KIMA 5D4RA 3GTPJ 3RKXA 1MR2A 1OR7A 2F5VA 4FX0A 2G7UA 1V8MA 4LLNA 5L3DA 1SD4A 4B43A 3VPRA 3MEXA 2DXIA 4BJ5C 1ETWA 3M8FA 4G7HF 3GTJJ 3JRAA 3BP8A 5BPIA 2GT2A 2DOFA 2WV1A 4Y33A 2XASA 5LPGA 2VJ5A 1SD6A 3CCQI 1YRNA 4A3JJ 3A03A 1FBUA 2RREA 4M9SA 1VQ8I 5ANTA 2GA1A 1RESA 3ZR0A 4RAZA 2O8XA 3DCFA 3CC4I 1S8NA 1FSHA 3ASOH 1HDDC 1KU2A 3WTUC 4LMYA 3E5QA 5B3SH 5D8KB 2L7FP 1E17A 2O6GE 2LC2A 4PZJA 2GLOA 2JTVA 2HPIA 3GVAA 2B7EA 3MZHA 4XKWA 2I8DA 3HOSA 5FSKA 1D5YA 1LFPA 1Z6TA 4BHCA 3W6KB 2VC1A 3Q2SA 1P6RA 2L7ZA 3ZQGA 5F1JA 2C6YA 3FWEA 2JVHA 1W36D 5ICEA 3QPHA 2DI3A 2RRKA 5BONA 3SEZA 5DTDA 3HYQA 2JRMA 3HOZJ 3E7LA 2FBKA 2K9NA 1UCRA 4NQWB 5CQEA 4AIDA 4HLXA 3HOXJ 2Z33A 3BM4A 4XL9A 2IW5A 3HL2A 3COUA 3PO2J 2D1VA 3AFHA 2IS2A 3MZYA 4IRHA 3HKZA 4OIOF 4XRSA 1NG7A 4I01A 4KFCA 2Q1ZB 1BA5A 2JWTA 2WAFA 2M5WA 1N78A 1SEUA 3BZKA 2G73A 3C7JA 1TT5B 2M0CA 3QYEA 3TP0A 3Q2TA 1MBHA 1B8IA 1BOBA 5DV5A 4EATA 3I0TA 2L01A 2EZIA 1PDNC 4BAYA 4HV6A 5D5XB 4JX6A 3QPSA 4QIWN 5K7HA 3ACAA 2EA2A 2EFNA 4CCKA 4XQFA 3GWZA 1YW7A 2RNGA 3BG9A 1LUJB 4BYYA 2IAIA 2EH3A 2CGPA 5H20A 3F21A 4QLCU 1IGNA 2HKXA 4A0XA 1X3ZB 5GHPA 1V8NA 1I6XA 2Z5UA 1H0MA 3DWLE 1Q1HA 3BQYA 4A3IJ 1ZR4A 2HDDA 3T5XA 3MGMA 2KLOA 4ESJA 2VI6A 3WTTC 4IL6C 1XDSA 2KRFA 5LRRA 4R79A 1S9HA 4YEJA 1XTAA 4Q4ZF 2XRNA 1FP2A 1RRSA 3LOCA 4CH7A 2ZNYA 3OOUA 3X0RA 3MKLA 5BQTA 2ACJA 1BI0A 1WH7A 2ZFUA 2P6SA 1SFUA 3ECHA 2HPMA 3FMRA 2M2EA 3KPHA 1YIJI 1NH3A 3F6VA 1K7AA 2KDOA 5J6XA 3HUGA 3BWGA 4NC6A 4CYCA 2LY2A 2JSCA 3L2VA 1APLC 5D8LB 4XKBA 2CJJA 1U0JA 1IXSB 1EH7A 4HNTA 4FCYA 3R03A 2VBXA 1OCOH 3KVHA 1R4NB 1UFMA 2DLLA 3JRHA 2DA4A 3ELKA 1A31A 2JJ7A 3F8NA 4E4HA 5IT9K 3TMOA 2VNQA 1HW5A 1STZA 2KKOA 5F0CA 4IO9F 1QHGA 1ZGWA 2E2HJ 2DN0A 2NRAC 2Y0SN 2RQQA 3DV8A 4PJJA 3J80K 4IHVA 2I8TA 3I9XA 3M7GA 4S2XA 3OOPA 3VYUB 2V9PA 1P92A 3HRMA 4EJWA 4RGSA 3PQKA 4DYQA 2QSHX 2ZFWA 1JE8A 3KFWX 2LMDA 4I02A 3WG7H 4LB5A 4CGZA 3EUHA 1IO2A 4DBRA 2XGXA 4K2EA 1USSA 1OMIA 5F27A 3DUPA 3FK6A 4BH9A 2A68F 1Z21A 1J0RA 3I59A 5KAIC 3G0QA 5FRMA 3KIOA 1IDYA 3H92A 1H9TA 4W1UA 5FKMA 1X2NA 4E70A 1KU9A 4HDUA 1ZH5A 2CZRA 4GXOA 3FXRA 1B6AA 4IQ4A 5IW5A 3OYDA 3GXOA 3TKYA 3S2HJ 1ZRCA 1OYYA 3IL2A 1S7EA 3NWTA 4HX8A 2VNPA 1WWXA 1VQPI 5EEGA 2RN7A 1AHDP 2FKBA 2WY8Q 1R1UA 3UKGA 4ZG0A 2DA1A 2M30A 2VIXA 2KT0A 3HIFA 3BLYA 1ZTRA 3E3VA 2L9NA 1BJAA 1BW6A 2MGQA 3O6BB 9ANTA 1X51A 5GHJA 1UHSA 1SVMA 1J59A 4U0VA 1RNLA 1N75A 5LHHA 4AIKA 2L9RA 2KHMA 5C3EJ 2K4BA 5E3LA 3RKQA 4M73A 1K2EA 2JA7J 1LJ9A 4EM2A 3WHWA 2MH9A 2G7HA 4UVCA 1BR1A 3TW7A 4ESFA 4MEXF 1IJWC 4QPQA 3X0IA 5DM6F 1FMVA 2A5YB 3RZOJ 2HOEA 4XK4A 1O7LA 3C2HA 2F5EA 1GXPA 4J7HA 3FM3A 3TO9A 1RR7A 1QPIA 5C4XJ 4D1QA 2P0WA 1Z7LA 2ZXHA 2X85A 3IH4A 2HYFA 5J1YA 4KMUX 1PUQA 3KZYA 4JBAA 2QBYB 3GG6A 2IA1A 3S17J 2DFIA 4UVBA 2VKEA 4MPOA 1RUNA 1G59A 4L0ZB 1R5GA 2R0QC 2F5CA 5DCMA 1AA7A 1LEAA 5EF6A 2HXOA 1UHWA 5H2FC 4A3DJ 4MFDA 1D0ZA 1PUFB 3GZ6A 2ZXIA 1X3WB 1NFSA 4BUPA 4PCQA 3TEDA 4UXNA 4EJUA 3FX3A 1ETKA 3S2DJ 2QQBA 1R5HA 1XX5A 3MZ8A 3U53A 5ICFA 2VQHA 3BTLA 4XMYA 2XB5A 1C0WA 4C9XA 2AQEA 4HYEA 4MNUA 4G6QA 3BJAA 2ISZA 5FSNA 3FISA 2ADUA 3IKTA 4FISA 1YE9A 3I3LA 4NC8A 1VIUA 4RGUA 4OAZA 1BIAA 3GFMA 4FE7A 2IGNA 1YTYA 1GHCA 5IPAA 2GQQA 2BY3A 2O7OA 4RAYA 4JZTA 4IRGA 4M3BA 1W36C 3GF2A 1W5TA 2NYXA 2A6HF 1B9NA 2R4GA 1VQMI 3U2RA 1SU2A 1FBQA 3FJYA 2ICKA 3GTQJ 5HLGA 2A5WA 4MEYF 1QZEA 2LF7A 2FVVA 3W3CA 5J1RA 1R1VA 4V2GA 1O3TA 2PJRA 4OMYA 2O9LA 1XGMA 1Z91A 2I10A 4AC0A 1VQKI 3M07A 1TNSA 3E1SA 3KP4A 3W6VA 4V14A 3FXMA 5C7TA 3BTIA 1VF9A 1LDJA 5EGOB 2GB5A 1J9IA 2V7FA 4M9XA 4I76A 5AIPA 2GXBA 3MD2A 1JGGA 3V7CA 2FX0A 2OAZA 2PJRB 4LGWA 2R5WA 1RKWA 3DU6A 1N77A 5FFXA 2HYJA 2AHQA 1X4OA 2VXDA 2RGVA 3N4MA 2IS4A 4MHGA 1OCCH 1ZELA 5LGNA 4LJZF 2QF7A 3PIOF 4CCOA 1YS6A 5A2QK 4JZVA 5GPCA 1R6RA 1RZ4A 4ICKA 2NXNB 2WB1A 3DLAA 5KAFC 4S2YA 3V7SA 1TW3A 2VKVA 2NNNA 3CDHA 2JVGA 3ZQIA 4U87A 2VJJA 4NUBA 2M0MA 1O3RA 4EMSA 2OPTA 3ECOA 4RLQA 1D0XA 4P9UA 5IP6A 5BS6A 4JOMA 1TWCJ 4LFUA 3G2BA 1VK6A 2EA4A 3JTHA 4GO1A 4I6ZA 2MA3A 4PSWA 1Z67A 3VYTB 1PUFA 1W1WE 1YFHA 1SC7A 2RNJA 2JA8J 2XUBA 4BE1A 1TWFJ 3KETA 2CU7A 4HPQA 4IZZA 4C3IJ 2FOKA 1YJWI 4KG3A 1GXQA 3HPHA 1D8JA 3P9IA 2JA2A 2O3FA 5M5XJ 1OYWA 3NARA 2P5LC 1E2XA 3L2CA 2VJ4A 1HC8A 2O1CA 5FSLA 2BEOA 5IW4A 3KYLA 5L3BA 3IWFA 5D6EA 2XGDA 2IPQX 3IUOA 2PI0A 2B0LA 1RYAA 4MTEA 2ZJRF 2QQ9A 1OFCX 3RPQA 3GTOJ 2PMUA 3NEUA 2QYOA 2ZJ2A 5TRDA 3ZQCA 2DSDA 3SFZA 3K70D 2QQAA 3FKJA 5IOYA 3ZOBA 3PSFA 1FWZA 2BHZA 1W0UA 3FKIJ 1MMNA 5GTIC 4EJVA 4KMFA 2JPCA 3HOYJ 4YPRA 2IEKA 4KYWA 3TO6A 3GCMA 3BR5A 2QKLB 3K4LA 1OLTA 4XORA 3LSJA 4M3GA 3GLXA 1I1GA 3OSGA 3K2AA 1F5TA 3U1DA 1L0OC 1OISA 5FD6A 2GAUA 3O61A 3A01A 2XPVA 3DBLB 3S1NJ 1D3YA 1ON1A 4MTDA 1GDTA 2V26A 4Q48A 2IJLA 1A6IA 3ONQA 5M3FJ 3H3UA 3D0SA 1BI1A 3WU0A 1FTTA 1WJAA 2V1NA 3L9FA 2NNYA 2R5YB 4GYIA 4DGWB 2VC0A 1U5TB 3FHNA 1WZ2A 3DU5A 1U6GA 4LK1F 3DTEA 4CCJA 2V4JC 4FHTA 5M5YJ 2UWMA 2P4WA 3K9TA 4F52A 2W82A 3H36A 1VHZA 5A2QZ 4NFWA 3I64A 1G3TA 1POGA 3K6GA 3U21A 1PP8F 3EUAA 3WTVC 1EA3A 5D5VB 2Z2SB 2ZKZA 4EJOA 3FMSA 2UV1A 5M3MJ 1U8RA 3JRBA 3BOQA 3ABKH 3OIOA 1IF1A 4C2MJ 2QWWA 1ODDA 4HG2A 1BC8C 3P6YA 2R7DA 1K4TA 2CS3A 6PAXA 1LDDA 4DYWA 3QYBA 4J7GA 5L3EA 3CCSI 5C8LA 2E1CA 1OKRA 3LA7A 1PYVA 3CCYA 1KZHA 1WGXA 1WCMJ 1F1ZA 2V9VA 4PJMA 5J8FA 4UNOA 2W00A 1B1BA 3ZMTA 3RYRA 1XSBA 2XF5A 3BG6A 4ZH4F 4KIBA 4ILQA 3RKWA 1FLIA 3T0YA 2PBIA 5ICGA 1YI2I 3OYEA 4ZDOA 1X1DA 2PFBA 2FBHA 1MMAA 1WFXA 5GADJ 4EM0B 1IRGA 3RPUA 2KRCA 5D6FA 4BY7J 3ZN1A 2ELHA 3CTAA 5L3GA 2O03A 3HSFA 1W0TA 3LL7A 4UUTA 1X4PA 3QWLA 3RPUD 1HCRA 1QHHD 3FXLA 3FXKA 5GAEJ 3JRIA 3WE2A 2GT4A 1S7AA 3S32A 5FKNA 4X1EA 2D2WA 2RQPA 4C30A 5D4SA 1G2HA 1UHMA 2DFHA 1YITI 3IAM2 1UG2A 4PSXA 2LNBA 2R92J 2VE9A 3PUFA 4D5FA 2DDAA 1IRYA 4U7BA 4PGHA 2DW4A 2EFPA 3EXQA 2H8WA 2H1KA 5LBQA 4S04A 3TDUC 2VPRA 3WGGA 3O6ZA 2M8GX 1VZ0A 2PMZN 2W57A 1Z7UA 3CP8A 5BPDA 1J2XA 3ZQQA 2ECBA 1D5VA 4R1HA 3BG7A 2JUGA 2V6CA 1G0SA 2K86A 2ZXJA 3M1EA 3LSGA 2MABA 1MNEA 3GEZA 2D5VA 4LG0B 4OIPF 2NVQJ 5I8UA 2BVMA 3KLOA 3S93A 2ZJQF 1YLFA 3X0QA 3X2QH 3A0BC 2FOWA 4C2UA 4JQFA 2E71A 4XKCA 2VUMJ 2E7XA 2AQFA 1Y8RB 3O3KA 4AM3A 4YPHA 2YX7A 4B3XA 2IGMA 2OF7A 2Q2EB 3DKUA 3IP4B 1D1BA 4XSXF 2JVBA 3H95A 3L2WA 1JGSA 4A5NA 3KP2A 1XSVA 2QEXI 3EDPA 2GXAA 3I55I 2RC4A 3CUQB 2CYYA 4BQNA 3MAJA 2VKDA 4XLPF 1KQ0A 4A0YA 2BZTA 2MW8A 3BJOA 3VDXA 2FUG2 5FSOA 3BR1A 5HOOA 4KDPA 4UUSA 1R71A 3VOEA 2DPUA 4D9JA 1O57A 3Q4IA 2HQNA 3ABLH 2DK8A 4BQAA 1XSDA 2GOMA 2BBYA 1B8IB 1IUYA 1SVOA 2W4EA 3F22A 2WAQA 3S8PA 5E3MA 1SFKA 1F3YA 2KQRA 2E1NA 4R8HA 2EFQA 2JZYA 2BXZA 1KYZA 3TOBA 4F92B 3J80Z 2ECCA 4Y7NJ 4S2WA 4ETSA 4E7IA 1KTGA 2WAEA 4AUXA 1XG1A 2I6KA 3LSRA 4C2TA 3BG5A 3WTZA 2HVQA 1R58A 2R3SA 1W5CC 3JTGA 2R5ZA 4RAGA 1IN4A 3OYFA 1B9MA 2Z3YA 3CP2A 4J19A 4ZC3A 2AO9A 1VNDA 1IDZA 1K4SA 1LPQA 1UELB 1ZKGA 1HOMA 4HBLA 3BZ6A 3X0LA 3OYCA 1XD7A 2DYSH 3EQLF 3CCVI 2FU4A 3I4PA 2XPWA 1YOVB 2E2JJ 5GHQA 3DEEA 1KYWA 1TWAJ 3G4SI 1Z6RA 5HLHA 4YFXF 1U78A 4CHUA 1LKXA 1CQTA 2GWRA 4BJ6C 3PJRA 1XSXA 3NWSA 5CYVA 2VL8A 3LWFA 1CF7A 5HDNA 4RS8A 3GZ8A 3LFUA 3PL8A 4C9WA 2GIZA 5ED4A 1IW7F 2M9HA 4Z6YA 2VBWA 3X0PA 1YJNI 1SOIA 2Q2EA 1VQ5I 3S1RJ 2QUFA 2H8RA 4L5JA 5CLSA 3C18A 3KP6A 5JFRA 4PK4A 3VSLA 1I5ZA 1NG6A 1ZK8A 3QP5A 4XBFA 2E2IJ 3OS0A 3IAS2 4KT6A 1RRJA 1R9TJ 1TLHB 1WI3A 3JSOA 5ANWA 2Q9PA 4XLFA 3ESWB 3CDIA 1U5TC 4O5VA 3ZMZA 3JAMK 3OYLA 2UZKA 2HYGD 4GDFA 4V19K 2E34A 4AWXB 1MMSA 3BDDA 4KTBA 2CQ7A 1X58A 1KGSA 3PO3J 3AG1H 1ETXA 4ZTJA 3BR6A 1B72A 2MLKA 1V5EA 3BZCA 3AL0C 2XSQA 1SMYF 4F3QA 1NTCA 5DEQA 4EQQA 1ON2A 4B09A 4XNFA 2XSJC 2Y0MA 4K6EA 1KONA 1MH3A 2CQXA 1VFCA 2HI3A 3CUQC 3R6SA 3B6CA 2W48A 4JYKA 3IRQA 2KDVA 3UNGC 1IG7A 2QGUA 1PUSA 4BHBA 3T8TA 4A3LJ 1Y8QB 1K26A 4XOTA 1HKTA 2KZGA 1MKMA 4GYGA 3ZMDA 4E6KG 1O7FA 3J7YJ 2OQGA 3OWTA 3TDZC 3SMDA 2K5CA 5ILUA 3QPLA 5H6QA 5FROA 1ETVA 3J7ZI 2H27A 3K2ZA 4G7OF 3X0NA 3BCBA 4CSWA 3EESA 1TL8A 5JI6A 1WPKA 1RI7A 3A1YA 3WTYC 2IGKA 3H0DA 1JXSA 2LF8A 2BXYA 5CQGA 1V5GA 3HYIA 1T0FC 2LBFA 1FEXA 5C44J 1OYIA 3Q9SA 4CDGA 1WRJA 2LKPA 2P5VA 2UXXA 3I54A 3LSKA 1V8WA 1FZPB 1KQ8A 2KFDA 5EZHA 3G1MA 2DOEA 2E1MC 4L18B 2UXNA 1HKSA 1LQ1A 2EV5A 4G9YA 3ZCOA 2K9MA 3PNVA 2VONA 4HSTA 1ZLJA 1OCPA 2LTPA 2TCTA 4FQGA 5LLQA 4CXFA 4ZTFA 1VQOI 2DT6A 1T38A 2LBFB 2EZHA 2HNHA 2EZKA 3QU3A 3W2AA 2BY0A 3DQVC 1MGTA 2AXTC 2DQLA 5E8GA 3TP3A 4GRIA 4BS9A 2YVOA 2Z99A 1SD7A 1P9QC 3GRNA 1HX3A 1WSUA 2DFFA 2K3PA 2YVNA 3R4KA 1JT6A 3EF5A 1K83J 2E60A 3GBGA 5EG0B 2HS5A 3MFKA 3HB9A 2ETHA 4L9TA 4M6XA 2QJTA 2OU2A 1Z1DA 2O5FA 4HA8A 1O3SA 3ABTA 2HDCA 2RKHA 3J81K 1DU6A 1T95A 2DSCA 5FO5A 2CUEA 2A6TA 3BY6A 4ZYGA 4BEHA 2L5QA 3ZMSA 1ZR2A 3E6DA 2OTLI 4XLEA 1VQ9I 1WJFA 3GLLA 4PJLA 1Y56A 3KEOA 4NNJA 5JHUA 2CMPA 2M7BA 4N4NB 5HLTA 1H8AC 2HEOA 2A8RA 2A8SA 3QOPA 1KT9A 1PVFA 3A6TA 2QVOA 4NFXA 3ML6A 2DMQA 2QA4I 3KYDB 1RKTA 4BXUA 4XN0A 1DPUA 3DF8A 2RAEA 3B02A 1IRXA 2Y31A 3MQ0A 4GCVA 1O4XA 2OQRA 1V8SA 1QA6A 3MCFA 3LFKA 3L09A 1K6YA 5HZXA 1XCBA 3H5NA 4DZPA 5DS9A 1X1AA 2EILH 3G71I 5GPAA 1GV5A 1HKQA 1U8BA 3GFJA 3SDGA 3G6EI 1J75A 1TTYA 4YIRX 2ISYA 3CO7C 1Q54A 3OYKA 2O0YA 1Y0NA 3Q9VA 4N4OB 1IN5A 2NOGA 3JSPA 1MJBA 2FQ4A 2COBA 2M7AA 2RV8A 1NQYA 4PFOA 2ELJA 2EQRA 2LP0A 4IHTA 2QKMB 2XKPA 4LD5A 1WJDA 3I56I 4QSHA 2CUFA 4D7MA 2B9SA 3AAFA 4X0GA 2LR8A 3VODA 1S72I 2A69F 3HTUA 1MNMC 1A35A 1W7PB 1FIPA 4GFBA 3W2WA 3IC7A 4BACA 1H9GA 1F4KA 4IHSA 3ZXSA 3OYGA 3K4NA 4XLCA 5FJ8J 1PUEE 4EM1A 3C1DA 5KHDA 2X51A 2R7QA 2XF6A 4I09A 2V79A 1KU3A 4MQ9F 5L3CA 1G4DA 1LVAA 2ZSIB 1HZTA 5FLXK 1VHGA 5ANSA 2DA7A 3KZZA 4I0AA 1BOAA 4NB5A 3UR3C 3GWYA 4LOCA 2QZ8A 1V8YA 1V8VA 1XN7A 3DTIA 4S0HB 3VYRB 4YIFA 3HPGA 4KN4X 3G73A 2ZMEB 2HQAA 3TGNA 4M9ZA 2CFXA 3ERMA 4N9HA 4ANJA 2DA5A 5J4YA 2R7WA 4BE2A 1P4WA 2R5YA 3BQZA 3G1LA 5CFJA 1PP7U 3RH7A 4ENNA 1USTA 4EVIA 2KRHA 3NQOA 3FSPA 4Y4RA 3D5LA 3AG3H 3N9UA 3H5AA 2A8TA 2HQ5A 3V8LA 3ZMVA 4ZZDA 3S3OA 4EJTA 2ME6A 4LK0F 1UG0A 2LY9A 1FC3A 3M4OJ 2HKOA 1YX3A 5GHMA 1I9AA 5LGTA 1UZCA 5IP7J 1W4MA 1JUMA 3F23A 1D0YA 1Q33A 3CJTB 1V55H 2DMNA 5IYDJ 3R60A 5H6RA 3P9CA 4BQQA 1REPC 4IHWA 2VKHA 1BW5A 2IGOA 5E1XA 2EIJH 3FXJA 2O8KA 2X6WA 3K69A 3OGAA 4N1TA 3KLNA 2IP2A 3WGHA 5ICCA 1X1PA 3OYAA 4MO7A 1VQ4I 3K0LA 4AIHA 2MC4A 2E36A 2PMHA 2WC2A 4ITVA 2EZLA 3FF5A 3S3NA 4HQMA 1BI3A 4ZYDA 4YFKF 3SXYA 3ZPLA 2V1DA 3A2KA 2ZMEC 3H1CA 3PFIA 4PJ0C 4ZYHA 4E7KA 5DUKA 2BOLA 4BHPA 1X3UA 4UHTA 5F6FA 1BBYA 1MUTA 3LSHA 2R7VA 3O52A 1FYMA 1YX5A 2H94A 1FY7A 2L02A 3CCMI 2L9VA 2PMZA 1ENHA 4BDZA 1OCZH 1DP7P 3O69A 2E7WA 1IUFA 1G9QA 5CPRB 4A12A 3AG2H 3J81Z 3HZJA 2PG4A 2IS6A 5IYBJ 1ETYA 4A0ZA 5HS8A 3MWMA 1JUSA 2R7SA 1CF7B 4BXFA 3L00A 5DD8A 1YYVA 4HX4A 2BGCA 2HZDA 3E5XA 2YR2A 5F64A 1PVEA 3DFGA 2XAQA 3LSPA 1H88C 1JI8A 1LB2A 5J8CA 5K7FA 2YYHA 2X1CA 2AZWA 2L2OA 1CGPA 3RKYA 4HX7A 1I27A 4XRSG 3ZGKA 3OL4A 2JA5J 3FK7A 2OCCH 3MMYB 5K5OA 2P5KA 4M72A 1BM9A 4BY1J 3Q93A 2K85A 1Y1VJ 1HSJA 1T56A 3H0GJ 5B66C 3HGYA 1S29A 2PQ8A 3F8CA 3W6JB 1X1BA 1ZGAA 3E0JB 3HJEA 1WJBA 5FLXZ 1HW2A 2MC3A 3L2UA 1RR8C 1WQ2A 4CCNA 3JRDA 5KK1A 1I3QJ 3DKWA 4P9FA 2R7OA 2L9SA 2FA5A 3EYYA 4CZZA 1G3YA 1Z77A 2VJIA 4HV5A 5IYCJ 2QENA 2K02A 4ZDLA 2K7LA 2Q8KA 3PIPF 3OYJA 1ZHFA 2DQRA 1BN5A 1HLVA 4V2FA 5E3OA 4DYRA 1QRYA 3OYIA 5LHIA 4UB6C 3F72A 1MQEA 4BGDA 2OA4A 5JVGF 3CESA 3TBIA 4W97A 1V3FA 2LY1A 1OW2A 3BG3A 1FYLA 2D45A 2HXIA 4HNUA 1DGWY 2WTEA 1S3JA 5ERIA 2DCEA 2FMLA 1E3OC 4RGRA 1DDNA 2GM4A 4NC7A 3HRSA 4CA0A 2IA0A 1AWCA 2P7CB 5E17F 2X6YA 3DBRB 4L5EA 3I7VA 2K27A 5FRNA 1B4AA 2KDWA 1EKEA 2CO5A 3MCZA 2DPDA 5EDNA 1VC9A 2XAUA 1QZZA 2DJIA 3GFLA 1ZRFA 3PFYA 1JKNA 3H3VK 5FFZA 4A6EA 2STWA 1LE8B 5ILVA 4UUSB 2FNAA 3F6OA 4P5OA 3R61A 2R7UA 4BE0A 2ZBKA 2EFOA 2ESNA 4N0BA 1MH4A 3PSIA 1IV8A 4KISA 2KMUA 4IX7A 2E1MB 2B2KA 3GW2A 2BV6A 1R36A 1Z0XA 1LVKA 1DP3A 1XS9A 1SVLA 1FT9A 2FBIA 4MLOA 4L9JA 3NRVA 4OINF 2G74A 4QTRA 1K79A 2ZJPF 3A6UA 2PNYA 3IH3A 1TQMA 4KYXA 4G8XA 2DMPA 5E8IA 2YSRA 3X0JA 2A3SA 2P6TA 4LITA 4TV7A 1QU3A 2L0KA 4I99C 4U7DA 5CVRA 3BTCA 3AC9A 2BW3B 3E6CC 2XGEA 2ZNZA 2MLGA 4HAMA 5IOZA 2VE8A 1GT0C 3I59B 3Q1PA 4ON0A 4U0YA 4HZFA 2H09A 3I4NJ 3WU2C 5DCMB 2A8QA 5C4JJ 3BPXA 2EIKH 1D1CA 2DMUA 1T98A 3CUOA 2FD5A 2IXSA 3ISPA 5FB2A 4BNCA 2MG4A 1JTYA 4A93J 1DUXC 5LHGA 1B72B 2WY7Q 2VQGA 3WODF 4CYCB 4HF2A 2Y2ZA 4XOPA 3AL0B 1I1SA 5DM7F 1XDUA 2YUSA 2K9QA 4PDKA 5EEHA 2EJRA 1IC8A 3CDLA 4DOZA 1SFOJ 1OPCA 3E6BA 2EPFA 1KA8A 2XAHA 4LG0A 4HRIA 1OCRH 3CC7I 4RB3C 3L2RA 2EFWA 3K4JA 3R0JA 3KP5A 1YIOA 1FSEA 1W7PA 4LB6B 4MFEA 2PJPA 3K4BA 1OCTC 4WX9A 4B47A 4C9YA 2W24A 1W5SA 4A3EJ 2LYCA 1YQAA 4OWRB 1W7PD 3DXJF 2IA2A 3E5UA 3PQJA 1Y39A 1U20A 5FGMA 1XGNA 2JRTA 4BJTA 1V8IA 3QPTA 2KIUA 3RYPA 5FLMJ 1S7OA 2IS1A 3QODA 2JMWA 1T33A 3OS1A 4II2A 3H9QA 3VWBA 1ULYA 3PNTA 3GZNB 1FNNA 2MFZA 3TO7A 4ESBA 3IWZA 1QQIA 5HODA 3ZP5A 3U1KA 1G3SA 1XMAA 2V9KA 5GP9A 1ZRDA 1BI2A 3FBNB 4FETA 2BW3A 3SZGA 4G94A 1QVJA 1TQIA 2VT2A 2HWVA 3LA3A 3F9KA 5CKTA 2H6BA 3ROUA 5GHIA 2HTSA 5FLVA 1VQNI 2NVTJ 1DQUA 2JPBA 2WWYA 3N97A 1G8XA 2HU9A 3GTKJ 5EGOA 2O5RA 1IV6A 3HOVJ 1P2FA 4OAYA 5TISC 3KEYA 2L7MP 3JAMZ 3VEPA 1V4RA 4Y3OA 4WWCA 3OS2A 2E19A 3KE2A 2GXGA 1TUMA 5J3LA 2P81A 5GAGJ 2BY2A 2M3AA 1QNTA 3FXUA 4KITB 4JX4A 1OR7C 1MBFA 2R93J 3KX2A 4MGRA 4I98B 3VB2A 1ERDA 4EV0A 2FJ1A 5KNLA 1MDMB 2QSGX 4IOAF 2F48A 2OZ6A 5EEAA 1Z05A 4ZZLA 1H89C 3Q3SA 4UV9A 2CW8A 2KP6A 2V1XA 3BR3A 3H5RA 1PUNA 3JCUC 2R5ZB 5JHFA 1MSEC 1IXRC 1FBSA 1FX7A 1RC9A 2XAGA 4KA4A 2A8PA 2QBYA 2CQNA 4PUSA 2XRLA 5DDGA 1YO5C 1LEBA 4E7LA 3OR1C 3RSNA 1FJLA 2HR3A 3CLOA 4CZCA 4YOQA 1TNTA 3HM5A 4BDYA 2V1UA 4FE4A 2QJOA 3IKVA 4HEA2 2F5FA 3QOEA 1XMKA 2J5PA 2Y75A 3AKZA 1F43A 4IF4A 1V54H 3BT9A 2N8GA 3WE3A 5TGTA 4RM2A 1TBXA 1YS7A 4B1RA 3FM5A 2M4KA 3OR2C 4XM3A 3QRFF 2F4MB 5JLXA 2VOPA 1JUPA 2Z1DA 1SFEA 2M8EA 1GV2A 2H1LA 1NQZA 1QBJA 4N9IA 4A3BJ 2XGCA 4RM3A 4YG2F 1P4AA 4ENMA 2VQLA 3WHCA 3CZ6A 3EEUA 3M3YJ 1GVDA 3CJNA 2D1HA 4P96A 4IHXA 1NFZA 2LFBA 3DPTA 3ZQLA 2I8UA 2HGCA 2HOAA 2NS8A 3RI4A 2R7ZJ 4KG4A 3ZR8X 2KZVA 3L2QA 5DCFA 2VXZA 3M1CA 3CUQA 4KUMA 5JR3A 4JP0A 4H0EA 1VCDA 3P7NA 1QZYA 4M6YA 5J4VA 1PJRA 2ME0A 2X48A 3A02A 3LQQA 1XMXA 1R22A 4F91B 1MMDA 1IAWA 1VTNC 3BAPA 3C2GA 4RMNA 2Y9YA 1FTZA 2BHYA 2JUCA 1EJ9A 1P4XA 1X19A 1ORKA 2E5ZA 1SAXA 2R7XA 1A5JA 1MQWA 2G9WA 5L3FA 1LFBA 3TQNA 4B48A 5HDKA 2DU9A 4UUVA 4JK1X 3S14J 3NAUA 1XPXA 2FXAA 1MDMA 1AKHA 4PGGA 3M8JA 3ERED 4KNYA 1P7JA 4QPOA 4HOBA 3ULQB 4ZYAA 4YELA 2DMTA 1SAUA 1EH8A 2RVCA 1F9NA 4G6TB 3JRGA 2LKXA 4CCMA 4NDLA 1GVJA 2JA6J 1XSAA 1XC5A 3A6VA 2L4MA 4LLGF 2W1OA 1SANA 5B1BH 3LSMA 5CVVA 3V8KA 2IBDA 4A5MA 4HDVA 4FT8A 3CD6I 5CJ9A 3HOUJ 4E7HA 4F93B 2CH0A 1EH6A 4ZJZA 3JRFA 1FIAA 1ZARA 4L5IA 4HQEA 4S2VA 3A01B 3K7AJ 4QWQA 4A3FJ 3H35A 4ENJA 5IP9J 4O3MA 4KN7X 4WXHA 4CYDA 3D1NI 2O5WA 5HNFA 3S1MJ 1DGRM 3RCOA 4B44A 3DKXA 1BIBA 2X1DA 3EUKL 5FSIA 4IRIA 3I58A 4IJXA 2QCOA 4XLAA 4UB8C 3WTSC 1V8TA 3JRCA 1FYKA 1SMTA 3HKZN 4ENKA 3B73A 4EGZA 2OBPA 4L0YB 2WBMA 3EPZA 4DW6A 3CMEI 1JKOC 1R5ID 4CUGA 4RB1A 3L85A 2K3FA 1MZBA 3ZQ7A 1XSCA 1A36A 3TW6A 2DUKA 3CMMA 3BJ6A 2EV0A 1PPWA 3ZR1A 3HTSB 3SONA 4AVZA 4FASD 1MJAA 2EK5A 5DUIA 1R7JA 3GX4X 4XRMA 4Q5SF 3T1BA 2VLAA 3REOA 2YS9A 2F6CA 2GA2A 1PPXA 1Y0UA 4IJAA 2GBYA 2B06A 3RQ4A 1AU7A 4AYBN 2PQVA 1FP1D 3CCEI 4H4KC 4WF2A 2UUZA 1WJ5A 3M8EA 3CQZJ 2X4HA 4YIIA 4LIVA 5LRSA 5DYMA 2Y9ZA 4OIQF 3FXQA 2KISA 2FF4A 3E97A 2M45A 4OIRF 4A3GJ 4LIUA 4XONA 1DPRA 1ZG1A 5GHNA 5FKOA 4F55A 5E79C 2LRDA 1YRNB 4M3FA 4IVNA 2CUZA 4BEHB 4M3EA 3OYBA 2R7TA 2DFEA 5C7QA 1F36A 2GZWA 3H3ZA 4C3JJ 2YU9J 3Q91A 1LDKB 4DNCA 1SJYA 1LFUP 1VI0A 5FKKA 3SDBA 4DIQA 3A0HC 3D5RC 2W85A 1A04A 3L1PA 3MKYB 2W25A 2YVPA 4I2OA 5CVUA 1WJCA 1FPQA 5HLIA 2OV7A 4Y13A 1R67A 2WAQN 1ACIA 4Y17A 3CJQB 2JSPA 3CCRI 1T8IA 1IRZA 3OYHA 2HVRA 3MVPA 2G0EA 3R0AA 2LG4A 2YPRA 3DTKA 2NS0A 3EETA 2DTZA 2L3DA 1Z3XA 1R23A 2ZXWH 3O8HA 2CWEA 2MSYA 2X1EA 3K1MA 1T08B 2V6EA 4OU0A 3Q0VA 1I50J 2GIVA 2DOAA 3GMEA 5BOXA 5ANUA 1IXCA 3F8FA 4NQWA 3CCJI 5K7ZA 4U88A 1A6QA 3LQRA 3TL4X 3HOWJ 1NK2P 2HTJA 3ZQFA 4LLLA 4D5CA 2NS7A 3ABUA 5CFIA 2WV0A 2ZC2A 2A6EF 4IPAA 4OMZA 4BBRJ 2E5NA 4F7ZA 4ASNA 3HRUA 4PFPA 3K1NA 2X6XA 5E3NA 1FOYA 1TZLA 2E35A 4XIDA 3FBIB 3F3XA 4A6DA 2E1OA 1XGSA 2AXLA 5F0HA 4XLHA 2XSDC 3FDYA 4XRFA 1OQYA 1SFXA 2ZMEA 2J5OA 1Y1WJ 4XR6A 1L3LA 1HA8A 1ETOA 1JT0A 2BE5F 4IQJA 2DT5A 3QYFA 1YHQI 2PN6A 2XPUA 2L7KA 3FMQA 1S5LC 4M6VA 1G3WA 1HF0A 2A07F 1OJLA 2W4SA 1KHZA 2XF7A 2VT3A 1SD5A 2HFHA 2R7RA 3COAC 4C3HJ 5E18F 5ISYA 2FQ3A 1I6HJ 2F2EA 3PNYA 2LD5A 3HG9A 4HFQA 2X9DA 3E57A 1TT0A 4Z2YA 5LD2C 2W84A 4IOCF 1IZ1A 1HW1A 4M74A 4HW0A 3U9GA 1IN6A 3HEFA 4XN3A 1KU7A 3P5TA 3D5SC 4G6DA 2JN6A 1HSTA 3BROA 4RB2C 1FOKA 3RJPA 3O2PE 2MBFA 2NVXJ 1J5YA 2BY1A 4YFNF 2IT0A 5FSMA 2FRHA 4A69C 5FKLA 4Y52J 1U9OA 3K4KA 2XC7A 3I9V2 2Z9OA 4WXDA 5B5EC 3GFIA 1K61A 2M34A 5K1YA 1V5FA 1JKRC 4RGXA 4X6AJ 3X0MA 2LK2A 2A05A 2DSBA 4BXXJ 1BR2A 5LGUA 3EYIA 3S1QJ 3ZQHA 3Q0WA 1NHAA 2XKOA
chains in the Genus database with same CATH topology
1MK1A 3ZN0A 2EWNA 3FHZA 1YW9A 5TJJA 2VN2A 4WCGA 1PPVA 2XROA 1JHHA 3DP7A 3WU1B 4D0PA 1HBXG 3ZMUA 1ZG3A 2DTRA 5IT3A 5DD4A 1ZLKA 4Q47A 5IT9Z 2P8TA 3J7AO 4Y15A 3BHOA 5E1ZB 3LSTA 1U5TA 3V7RA 1IN8A 5F1RA 1ZAOA 3KP7A 3VFZA 2F5DA 3GYHX 2OD5A 1T2KA 1R1TA 1QGPA 3KP3A 2KIFA 1IRFA 3A6SA 5E1WA 5CVJA 3F8BA 4AIJA 1XB4A 3I71A 2DAOA 1LNWA 3RDIA 2LDUA 2CG4A 2CQKA 2L4AA 5FD5A 2VODA 3HOTA 2DBBA 2DHOA 2CSOA 4HF0A 3P9KA 4S05A 2EB7A 5D5UB 5AONA 1GA7A 2A61A 4MQVA 1ONVA 5CVIA 4CICA 1MJ9A 2VBZA 5LEKA 3WTXC 1WI9A 4AD9A 2JT1A 2COMA 2P7VB 4JZSA 3QP6A 2XAJA 4EGYA 1VC8A 2XV4S 1UB9A 4N1UA 2ESHA 3F6AA 2O61A 3CNGA 3T8RA 3Q5FA 3F8MA 2VOOA 3IRRA 5BMZA 2IVMA 3IHUA 2NAZA 2DO7A 2ICJA 3FK9A 3X0OA 1YG2A 3I53A 3LAPA 1K6OA 1ZGJA 3MDIA 3WTWC 1KQ9A 3HHJA 1JHFA 2XAFA 1G6NA 2LSOA 1S6LA 1BC7C 2B0VA 4KIFA 1MP2A 1TQPA 4OOIA 4U0WA 1T0FA 2AS5F 3N77A 4NHJA 3K1PA 4L9NA 5HS7A 1O3QA 1IN7A 4RB0A 3O8SA 4P55A 2FSWA 3F13A 3SZTA 3S2WA 3RTRA 3WG9A 2FEZA 2M87A 1V8LA 1J7KA 2MH2A 4M71A 2YU3A 4AVPA 4FX4A 1U3EM 1U2WA 4KIGA 1V8RA 3FCMA 1VRLA 5HDGA 2K4JA 2J8QA 2DK5A 3V4GA 2L54A 1Z9CA 2IRFG 3SQNA 3HHGA 1R00A 3M9AA 4G7ZF 2RDPA 5K5RA 1AOYA 1ZYRF 3SHDA 2H6CA 1T6SA 3TOAA 1EV7A 2PEXA 2MD5A 2YVMA 4IXAA 3QAHA 3FFUA 1WKMA 3RIRA 3V8JA 4ZYEA 3GZ5A 4HLYA 4KICA 3J7Ye 1B59A 3I5UA 2CL3A 1HXDA 4KT5C 4UVAA 3SZPA 4CO8A 1HQCA 2X0LA 4I7HA 1XGOA 2STTA 3OV8A 3CO6C 3JW4A 1K78A 1T39A 4XSZF 3L7WA 1QO0D 5HS9A 4HF1A 4B8XA 1ZN2A 2ZCWA 2PLYA 2M1BA 3GUDA 3HHHA 2FE3A 2OZUA 1Q27A 3HRTA 1X84A 3I7UA 5E20A 1JRKA 3X0KA 5DPKA 4XLNF 3QSJA 4GGGA 4JZUA 5D5WB 4UV8A 5AIQA 3E6MA 2QM3A 4O6JA 2Q0OA 5ILSA 2HQRA 4I0BA 3HSEA 1RIOH 3C3WA 2HZTA 3FZVA 3HSRA 2XVCA 1YW8A 1MD0A 3MDGA 3G3ZA 5KVRA 1QPMA 3QU6A 1K78B 2R7FA 4DQ2A 2FMYA 1V8UA 3KCCA 3DPLC 5JVTA 2YX4A 1RUOA 3GO5A 4L9VA 2CW0F 1ZG5A 2XIGA 2XHKA 1XCVA 2TDXA 4HVYA 2KJCA 1VIQA 3X0SA 5K5QA 3WGIA 5LEJA 1SZ3A 3LA2A 3BPVA 4WK8F 1ZREA 1X83A 3ID9A 2Y48A 5ANVA 1TW2A 2BYVE 2VBYA 2ZO4A 2FNPA 1RRQA 4A2UA 5GHOA 1D8KA 3KEQA 3LAJA 3DEUA 5HVQC 2EV6A 2KJBA 2QLZA 4WXCA 3SHFA 2KIMA 5D4RA 3RKXA 1MR2A 1OR7A 4FX0A 2G7UA 1V8MA 4LLNA 5L3DA 1SD4A 3MEXA 3M8FA 4G7HF 5BPIA 2GT2A 3BP8A 2XASA 5LPGA 1SD6A 1FBUA 4M9SA 5ANTA 2GA1A 3ZR0A 4RAZA 2O8XA 1S8NA 1FSHA 1KU2A 3WTUC 4LMYA 3E5QA 5D8KB 1E17A 2O6GE 4PZJA 2JTVA 3MZHA 3GVAA 3HOSA 5FSKA 1Z6TA 4BHCA 3W6KB 2VC1A 3Q2SA 1P6RA 2C6YA 3FWEA 5ICEA 3QPHA 2DI3A 2RRKA 5BONA 3HYQA 2FBKA 1UCRA 2Z33A 4HLXA 3BM4A 2IW5A 3COUA 2D1VA 3MZYA 4IRHA 4OIOF 4I01A 4KFCA 2G73A 2M5WA 3C7JA 3Q2TA 5DV5A 3I0TA 2L01A 1PDNC 4BAYA 4HV6A 5D5XB 3ACAA 2EA2A 2EFNA 3GWZA 1YW7A 4BYYA 2CGPA 5H20A 3F21A 4QLCU 2HKXA 4A0XA 5GHPA 1V8NA 1I6XA 2Z5UA 1H0MA 1Q1HA 3T5XA 3MGMA 4ESJA 3WTTC 1XDSA 2KRFA 5LRRA 4R79A 4Q4ZF 2XRNA 1FP2A 1RRSA 2ZNYA 3X0RA 5BQTA 2ACJA 1BI0A 2P6SA 1SFUA 3ECHA 3FMRA 3F6VA 1K7AA 5J6XA 3HUGA 3BWGA 2JSCA 5D8LB 1IXSB 1EH7A 3R03A 2VBXA 3KVHA 2DLLA 1UFMA 3ELKA 3F8NA 5IT9K 2VNQA 1HW5A 1STZA 2KKOA 2NRAC 3DV8A 3J80K 2I8TA 3I9XA 3M7GA 4S2XA 3OOPA 1P92A 3HRMA 4EJWA 4RGSA 3PQKA 2ZFWA 1JE8A 3KFWX 4I02A 4LB5A 4CGZA 3EUHA 2XGXA 4K2EA 1USSA 1OMIA 3DUPA 4BH9A 2A68F 3I59A 1J0RA 3G0QA 3H92A 1H9TA 4E70A 1KU9A 4HDUA 1ZH5A 2CZRA 4GXOA 3FXRA 1B6AA 5IW5A 3GXOA 3TKYA 1ZRCA 1OYYA 3IL2A 4HX8A 2VNPA 1WWXA 5EEGA 2RN7A 2FKBA 1R1UA 4ZG0A 2M30A 3HIFA 3E3VA 1BJAA 3O6BB 5GHJA 1X51A 1J59A 4U0VA 1RNLA 5LHHA 4AIKA 2K4BA 1K2EA 4M73A 1LJ9A 4EM2A 3WHWA 2MH9A 2G7HA 4UVCA 4ESFA 4MEXF 3X0IA 2A5YB 2HOEA 1O7LA 2F5EA 1GXPA 4J7HA 3FM3A 3TO9A 2HYFA 4KMUX 1PUQA 3KZYA 4JBAA 2QBYB 3GG6A 2IA1A 2DFIA 4UVBA 4MPOA 1RUNA 4L0ZB 1R5GA 2F5CA 5DCMA 1LEAA 1UHWA 3GZ6A 1NFSA 4PCQA 4UXNA 4EJUA 3FX3A 2QQBA 1R5HA 3U53A 5ICFA 1C0WA 4C9XA 4HYEA 4MNUA 4G6QA 3BJAA 2ISZA 5FSNA 2ADUA 3IKTA 1VIUA 4RGUA 1BIAA 3GFMA 1YTYA 1GHCA 2GQQA 4RAYA 4JZTA 4IRGA 3GF2A 1W5TA 2NYXA 2A6HF 1B9NA 3U2RA 1SU2A 1FBQA 3FJYA 2ICKA 5HLGA 4MEYF 2LF7A 2FVVA 1R1VA 1O3TA 4OMYA 1XGMA 1Z91A 1TNSA 3KP4A 4V14A 5C7TA 1LDJA 2GB5A 1J9IA 4M9XA 5AIPA 2GXBA 3V7CA 2OAZA 4LGWA 2R5WA 5FFXA 2RGVA 3N4MA 4MHGA 5LGNA 4LJZF 5A2QK 1YS6A 4JZVA 1RZ4A 4ICKA 4S2YA 3V7SA 1TW3A 2NNNA 3CDHA 1O3RA 4EMSA 3ECOA 4P9UA 5BS6A 4LFUA 1VK6A 2EA4A 3JTHA 4GO1A 2MA3A 1YFHA 2RNJA 2XUBA 3KETA 2FOKA 4KG3A 1GXQA 1D8JA 3P9IA 2O3FA 1OYWA 2P5LC 1E2XA 3L2CA 5IW4A 2O1CA 5FSLA 2BEOA 5L3BA 3IWFA 5D6EA 2IPQX 2PI0A 2B0LA 1RYAA 4MTEA 2QQ9A 3RPQA 2PMUA 3NEUA 2QYOA 2ZJ2A 5TRDA 2DSDA 3SFZA 2QQAA 1FWZA 4KMFA 4EJVA 2JPCA 4YPRA 4KYWA 3TO6A 3GLXA 1I1GA 1F5TA 3U1DA 1L0OC 5FD6A 2GAUA 3O61A 1D3YA 1ON1A 4MTDA 4Q48A 2IJLA 3H3UA 3D0SA 1BI1A 3WU0A 3L9FA 2NNYA 4GYIA 2VC0A 1U5TB 4LK1F 1U6GA 4FHTA 2UWMA 2P4WA 3K9TA 1VHZA 5A2QZ 4NFWA 3I64A 1G3TA 1PP8F 3WTVC 5D5VB 4EJOA 2ZKZA 1U8RA 3FMSA 3BOQA 1IF1A 2QWWA 1ODDA 1BC8C 3P6YA 2R7DA 6PAXA 1LDDA 4DYWA 4J7GA 5L3EA 5C8LA 2E1CA 1OKRA 3LA7A 5J8FA 2V9VA 4UNOA 1F1ZA 1B1BA 3ZMTA 3RYRA 1XSBA 4ZH4F 4KIBA 4ILQA 3RKWA 1FLIA 3T0YA 2PBIA 5ICGA 2PFBA 2FBHA 4EM0B 1IRGA 3RPUA 5D6FA 3ZN1A 2ELHA 3CTAA 5L3GA 2O03A 3HSFA 3WE2A 2GT4A 1S7AA 2D2WA 2RQPA 5D4SA 1UHMA 2LNBA 2VE9A 1IRYA 4U7BA 4PGHA 2DW4A 2EFPA 3EXQA 5LBQA 4S04A 3TDUC 3WGGA 3O6ZA 2W57A 1Z7UA 5BPDA 1J2XA 1D5VA 4R1HA 2V6CA 1G0SA 2K86A 2ZXJA 3M1EA 3GEZA 4OIPF 4LG0B 5I8UA 3KLOA 1YLFA 3X0QA 4JQFA 2E7XA 3O3KA 4YPHA 2YX7A 3DKUA 4XSXF 2JVBA 3H95A 1JGSA 4A5NA 3KP2A 1XSVA 3EDPA 2RC4A 3CUQB 2CYYA 3MAJA 4XLPF 1KQ0A 4A0YA 3BJOA 5FSOA 5HOOA 4KDPA 3VOEA 2DPUA 1O57A 3Q4IA 2HQNA 2DK8A 4BQAA 1XSDA 1IUYA 2BBYA 2W4EA 3F22A 1F3YA 2E1NA 4R8HA 2EFQA 2JZYA 1KYZA 3TOBA 3J80Z 4S2WA 4ETSA 1KTGA 2I6KA 3WTZA 2R3SA 1R58A 3JTGA 1IN4A 1B9MA 2Z3YA 4HBLA 3BZ6A 3X0LA 1XD7A 3EQLF 2FU4A 3I4PA 5GHQA 1KYWA 4CHUA 1Z6RA 5HLHA 4YFXF 1U78A 2GWRA 1XSXA 5CYVA 3LWFA 1CF7A 5HDNA 4RS8A 3GZ8A 4C9WA 5ED4A 1IW7F 2VBWA 3X0PA 1SOIA 2Q2EA 2QUFA 4L5JA 5CLSA 3C18A 3KP6A 5JFRA 1I5ZA 3QP5A 4XBFA 1TLHB 3JSOA 5ANWA 2Q9PA 4O5VA 1U5TC 2UZKA 3ZMZA 3JAMK 2HYGD 4AWXB 3BDDA 4KTBA 1KGSA 2MLKA 2XSQA 1SMYF 5DEQA 4EQQA 1ON2A 4B09A 2Y0MA 4K6EA 3CUQC 3R6SA 2KDVA 3IRQA 1PUSA 4BHBA 3T8TA 1K26A 1HKTA 1MKMA 4GYGA 3ZMDA 1O7FA 2OQGA 3TDZC 3SMDA 5ILUA 5H6QA 2H27A 3K2ZA 4G7OF 3X0NA 3EESA 5JI6A 1RI7A 3WTYC 1JXSA 2LF8A 3HYIA 1OYIA 3Q9SA 4CDGA 1WRJA 2LKPA 2P5VA 2UXXA 3I54A 1V8WA 1FZPB 1KQ8A 4L18B 2UXNA 1HKSA 1LQ1A 2EV5A 4G9YA 2VONA 1ZLJA 4CXFA 5LLQA 1T38A 3QU3A 3DQVC 1MGTA 2DQLA 5E8GA 2YVOA 2Z99A 1SD7A 3GRNA 1HX3A 1WSUA 2YVNA 3R4KA 3EF5A 2HS5A 3MFKA 2ETHA 4L9TA 4M6XA 2QJTA 2OU2A 1Z1DA 2O5FA 4HA8A 1O3SA 3ABTA 2HDCA 2RKHA 3J81K 2DSCA 5FO5A 2A6TA 3BY6A 4ZYGA 3ZMSA 3E6DA 3KEOA 5JHUA 2HEOA 2A8RA 2A8SA 3QOPA 1KT9A 1PVFA 3A6TA 2QVOA 4NFXA 3ML6A 4BXUA 1DPUA 3DF8A 3B02A 3MQ0A 1V8SA 4GCVA 2OQRA 3MCFA 3LFKA 3L09A 5HZXA 1XCBA 1HKQA 3GFJA 1J75A 1TTYA 2ISYA 3CO7C 1Q54A 2O0YA 3Q9VA 1IN5A 3JSPA 1MJBA 2RV8A 1NQYA 4IHTA 2QKMB 2XKPA 4LD5A 3AAFA 3VODA 2A69F 3HTUA 1W7PB 3IC7A 1H9GA 1F4KA 4IHSA 1PUEE 4EM1A 3C1DA 4I09A 2V79A 1KU3A 4MQ9F 5L3CA 1G4DA 1LVAA 1HZTA 1VHGA 5FLXK 5ANSA 3KZZA 4NB5A 4I0AA 1BOAA 3GWYA 2QZ8A 1V8YA 1V8VA 1XN7A 4YIFA 4KN4X 3G73A 2ZMEB 3TGNA 4M9ZA 2CFXA 4N9HA 1P4WA 5CFJA 1PP7U 3RH7A 4ENNA 1USTA 4EVIA 3NQOA 3FSPA 3D5LA 3N9UA 2A8TA 3V8LA 3ZMVA 4ZZDA 4EJTA 4LK0F 1FC3A 2HKOA 5GHMA 1I9AA 5LGTA 1W4MA 3F23A 1Q33A 3R60A 5H6RA 3P9CA 1REPC 5E1XA 3K69A 3OGAA 4N1TA 3KLNA 2IP2A 3WGHA 5ICCA 3K0LA 4AIHA 2PMHA 2WC2A 3FF5A 4HQMA 1BI3A 4ZYDA 4YFKF 3SXYA 3ZPLA 2V1DA 3PFIA 4ZYHA 5DUKA 4BHPA 1X3UA 4UHTA 5F6FA 1BBYA 1MUTA 3O52A 1FYMA 2H94A 2L02A 1FY7A 1DP7P 3O69A 2E7WA 1G9QA 4A12A 3J81Z 2PG4A 4A0ZA 5HS8A 3MWMA 1CF7B 3L00A 5DD8A 1YYVA 4HX4A 2BGCA 5F64A 2YR2A 3E5XA 3DFGA 2XAQA 1LB2A 5J8CA 2YYHA 2AZWA 1CGPA 3RKYA 4HX7A 1I27A 5K5OA 2P5KA 4M72A 1BM9A 3Q93A 1HSJA 1S29A 2PQ8A 3F8CA 3W6JB 1ZGAA 5FLXZ 1HW2A 2MC3A 1WQ2A 5KK1A 3DKWA 4P9FA 2FA5A 3EYYA 4CZZA 1G3YA 4HV5A 2QENA 2K02A 2K7LA 2Q8KA 1ZHFA 2DQRA 1BN5A 5LHIA 3F72A 1MQEA 2OA4A 1V3FA 1OW2A 1FYLA 2D45A 2WTEA 1S3JA 5ERIA 2FMLA 1DDNA 4RGRA 3HRSA 2P7CB 2IA0A 1AWCA 5E17F 3I7VA 2K27A 1B4AA 2KDWA 2CO5A 3MCZA 2DPDA 1VC9A 1QZZA 3GFLA 1ZRFA 1JKNA 5FFZA 4A6EA 2STWA 5ILVA 2FNAA 3F6OA 4P5OA 3R61A 2ZBKA 2EFOA 2ESNA 4N0BA 2B2KA 3GW2A 2BV6A 1R36A 4OINF 1FT9A 2FBIA 4L9JA 3NRVA 2G74A 1K79A 3A6UA 2PNYA 1TQMA 4KYXA 4G8XA 5E8IA 2YSRA 3X0JA 2A3SA 2P6TA 4TV7A 4U7DA 5CVRA 3AC9A 3E6CC 2ZNZA 2MLGA 4HAMA 2VE8A 3I59B 3Q1PA 4ON0A 4U0YA 4HZFA 2H09A 5DCMB 2A8QA 3BPXA 1T98A 3CUOA 3ISPA 5FB2A 4BNCA 1DUXC 5LHGA 3WODF 4HF2A 1I1SA 1XDUA 4PDKA 5EEHA 2EJRA 1OPCA 3E6BA 1KA8A 2XAHA 4LG0A 4RB3C 2EFWA 3R0JA 3KP5A 1YIOA 1FSEA 1W7PA 4LB6B 2PJPA 4WX9A 2W24A 1W5SA 1YQAA 1W7PD 3DXJF 2IA2A 3E5UA 3PQJA 1U20A 5FGMA 1XGNA 2JRTA 1V8IA 3QPTA 2KIUA 3RYPA 1S7OA 1ULYA 1FNNA 3TO7A 4ESBA 3IWZA 1QQIA 3ZP5A 1G3SA 1XMAA 1ZRDA 1BI2A 4G94A 1QVJA 1TQIA 2VT2A 2HWVA 3LA3A