3GZ5A

Crystal structure of shewanella oneidensis nrtr
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
218
structure length
214
Chain Sequence
QLLTVDAVLFTYHDQQLKVLLVQRSNHPFLGLWGLPGGFIDETCDESLEQTVLRKLAEKTAVVPPYIEQLCTVGNNSRDARGWSVTVCYTALMSYQACQIQIASVSDVKWWPLADVLQMPLAFDHLQLIEQARERLTQKALYSLVPGFALSEPFTLPELQHVHEVLLGKPIQGKSFRRRVEQADLLIDTGLKRTPANLYCLKPDTASYRFLRNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MutT/nudix family protein
publication title Structure and function of an ADP-ribose-dependent transcriptional regulator of NAD metabolism
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Dna binding protein
total genus 60
structure length 214
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gz5A02
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3gz5A01
3E5QA 4G8XA 2O03A 1W4MA 2RNJA 1PUQA 4ETSA 3MZHA 1FSHA 1DPUA 4EJOA 1MQWA 2YVMA 1JGSA 2XUBA 4L9TA 3TO9A 3I4PA 3RI4A 1HKQA 5HLIA 4U88A 1IN6A 1KU9A 1XDUA 1JE8A 1IAWA 5K5RA 5ISYA 1QPMA 1SD6A 2HKXA 3M1EA 2FA5A 3CNGA 1K6OA 3SZPA 4CYDA 1G3TA 3WU0A 1O3TA 4L0ZB 1TQIA 3KFWX 5D5XB 4IHSA 3MZYA 1VIUA 2DSCA 3HIFA 1U5TC 5F1RA 5C8LA 1YW7A 1LEAA 1YW8A 3MWMA 1QZYA 2GXGA 3CTAA 1I27A 2A8TA 4I0BA 4Q48A 3WTZA 2W85A 2VT3A 4HX8A 4Y17A 5E1ZB 1ZGJA 3FXRA 5HLHA 3KP2A 3Q9VA 3FXUA 4G9YA 1GXPA 3SZTA 4EQQA 4K6EA 1FLIA 5FSKA 1MDMA 3U1DA 4HLYA 3P9KA 1P92A 3CDHA 3BWGA 4CO8A 5BPDA 3F8MA 4MPOA 5ANWA 3GG6A 1YG2A 1TTYA 3TDZC 1J9IA 1OYWA 2ICJA 1IXCA 4HFQA 3FF5A 1MR2A 4PCQA 1XSDA 5ERIA 1HW2A 2F5FA 3HRMA 4M74A 3H3UA 2FNPA 5CJ9A 1V8IA 3F13A 1I5ZA 1SMYF 1XGNA 3WODF 1EH8A 2P7CB 1PP8F 2NRAC 4M9SA 4UUVA 4D0PA 2GQQA 4MEYF 1FP1D 5IT9K 2P4WA 2QM3A 1OKRA 3W6JB 2QBYB 3MCFA 4WXDA 4KA4A 1JKNA 2P5VA 1V8SA 5HVQC 6PAXA 1IRGA 1W5SA 1GHCA 1YYVA 1Z6TA 4I01A 1MJ9A 2WV0A 3M7GA 3K1MA 2DQLA 4NB5A 2COMA 5BMZA 1D8KA 5DUIA 1RUNA 4MEXF 1CGPA 2ZXJA 1ZRCA 5LHIA 4YPRA 4EJWA 3HHHA 3TO6A 5GHIA 3WTXC 5L3FA 4ENJA 2GWRA 2KIFA 2PG4A 4FX0A 3C7JA 4KYXA 2MLKA 2C6YA 4E70A 3L85A 4IHTA 3COUA 2XRNA 3IWZA 2O5WA 4ENNA 5HZXA 3C18A 2YX7A 4KTBA 3F6VA 2W57A 1OW2A 3OV8A 3V8LA 5LGUA 4HV6A 5E18F 2HR3A 4OOIA 3T8RA 2HYGD 3RKYA 2FEZA 4MTEA 3H3ZA 1USSA 1QBJA 5BONA 4UVBA 4F7ZA 2VODA 3V8KA 2QQ9A 3ZMZA 4KDPA 3ZMUA 1MK1A 4AIHA 4MQVA 3T8TA 4KMUX 1T2KA 2A8RA 4WWCA 1FP2A 1FY7A 5CLSA 3WE2A 3JSPA 1IZ1A 4HF1A 4OMZA 2A8QA 3K9TA 3ID9A 4RB0A 5E20A 2QQAA 5D8LB 2DPUA 2RRKA 3U2RA 1XSAA 2ZKZA 3MGMA 4MHGA 4HLXA 2Q0OA 4NHJA 5DYMA 2O6GE 1ZAOA 1Z7UA 2DAOA 3A6SA 1F5TA 2BGCA 2FBIA 2E7WA 4P55A 3EYIA 2W4EA 2YPRA 3ZR0A 2A68F 3EF5A 2EFNA 3BDDA 1Z05A 2Z3YA 2JRTA 3RYRA 1BI1A 1HQCA 3HRUA 4G6DA 1T39A 3HTSB 2P6TA 2RC4A 4ZYEA 4PDKA 5IW4A 1G9QA 3K69A 2AXLA 4QLCU 5K5OA 4OIQF 1VC9A 4JZSA 1ZLJA 5D5VB 4UVCA 3W6KB 2G9WA 2IRFG 3ZQ7A 4KG4A 5FSNA 1J75A 2XAFA 3D5LA 2Y75A 1QGPA 5D5UB 3JAMZ 3GUDA 2HTJA 2YVPA 4YIIA 3GRNA 2V1DA 4HF2A 3F8BA 5HOOA 1MD0A 4M9XA 2I8TA 3A6TA 4HAMA 4A5NA 2H27A 5DD4A 5CVVA 3HSEA 1AOYA 3C1DA 4UXNA 1MDMB 5L3GA 2VONA 1NFZA 2XVCA 2EA4A 1U2WA 3EUHA 2ELHA 1AWCA 3ZPLA 2PNYA 3SQNA 3RPQA 3R60A 4OIPF 3GX4X 3HOSA 3EDPA 4Z2YA 2STWA 4IXAA 5ICEA 2B06A 5L3EA 3SXYA 4L5IA 3K1PA 3VOEA 2LSOA 4Q5SF 3L00A 2J5OA 2Z5UA 1PDNC 1RYAA 1KQ8A 1B1BA 5LGTA 4LLGF 4KNYA 2A6TA 1USTA 5IW5A 4P9FA 5A2QZ 2P5LC 1LJ9A 1MZBA 1IXRC 1GVJA 4G6QA 1DPRA 4P5OA 3BJOA 1I6XA 4MQ9F 5L3DA 1ZN2A 1EH7A 3KP3A 3BJAA 5IT9Z 4KMFA 1DP7P 4HZFA 3RTRA 2NNNA 2L3DA 3QPTA 3AAFA 5HDNA 3BPVA 2J8QA 4NQWA 2M30A 4UHTA 3QRFF 1ZG1A 2M87A 3ZMTA 4LB5A 5CVIA 3T0YA 3EEUA 3I9XA 1C0WA 2YR2A 2DSDA 2R7FA 1OPCA 1IN5A 2V1UA 2DW4A 1YQAA 3WTYC 5JI6A 4WK8F 3GXOA 2A6HF 4XSXF 3BAPA 3GF2A 3F8NA 2J5PA 3HRTA 3A6VA 4GYIA 1U5TA 2EFWA 4EJUA 3MCZA 1D5VA 2XKOA 5E8IA 5ED4A 1U3EM 2GZWA 1ONVA 3F6OA 3L9FA 2QQBA 4G7HF 3P9CA 3CUQB 3WGGA 2HQRA 2KDVA 1XGOA 1X83A 3ISPA 1V8MA 4GYGA 4IJXA 1V8VA 1LNWA 1RNLA 1ULYA 3IC7A 1V3FA 3LQRA 1FC3A 1PPWA 1VCDA 3TGNA 1RUOA 1KGSA 1P2FA 3I5UA 3N77A 5DCMB 1LVAA 4HVYA 2JPCA 3EYYA 5J6XA 2K27A 2CWEA 2F2EA 2P5KA 4DYWA 4MNUA 5H20A 4L5JA 4IVNA 3VFZA 3HRSA 2V79A 1Z91A 4RS8A 5E8GA 3GFMA 2O0YA 4EGYA 2QKMB 3GO5A 3DV8A 4Q4ZF 2HZTA 3DP7A 1V4RA 2PI0A 3CLOA 5D4SA 2ZBKA 4BXUA 3IKTA 4IPAA 3Q93A 1ZHFA 1FSEA 2A69F 2QUFA 2Y0MA 2HYFA 1XMKA 3Q4IA 2H6CA 5ANUA 3IRRA 2EV0A 1FYLA 4JZVA 3RYPA 4HA8A 5H6RA 3BJ6A 1G3SA 4N1UA 1VTNC 1W7PA 3O52A 2IA0A 1TNTA 3GFLA 4HQMA 1VHGA 3G3ZA 3ML6A 4M72A 2OBPA 3ERED 1T38A 2DTRA 1PVFA 1OMIA 2P8TA 2RDPA 2L01A 3WU1B 3J80Z 2MH9A 1J7KA 4B09A 4EM2A 3QPHA 1BIAA 1V8NA 4A2UA 3OOPA 4DQ2A 4WX9A 1YS6A 3VEPA 2DBBA 3JSOA 2LF7A 2O3FA 4CDGA 2ZNZA 1YW9A 5ICGA 3O61A 3FFUA 2OZ6A 2CQKA 3MEXA 5DD8A 1RZ4A 3ZR1A 1IRYA 4RAZA 1IF1A 3FZVA 4L0YB 3Q91A 2BE5F 3Q1PA 1T0FA 3NQOA 4KFCA 1SFEA 4KIBA 1RRQA 1SFXA 2HS5A 2ISZA 2AZWA 2F5DA 1XCBA 4HDVA 1XCVA 3KP7A 1WSUA 1PP7U 3T1BA 3U9GA 3JAMK 2STTA 4FX4A 1KTGA 3TDUC 1D8JA 1VC8A 2DI3A 4ESBA 2GB5A 4OIOF 2O61A 2FMLA 5LRSA 3SONA 2FSWA 4TV7A 1V8WA 4JZTA 1BI2A 1MJBA 4U7DA 1TBXA 3X0PA 2CGPA 2I6KA 1OYYA 4BH9A 3J7Ye 3LA7A 3I64A 3FMRA 3COAC 2UWMA 4MGRA 1XSCA 4U0WA 1Y0UA 2DU9A 2VT2A 3PFIA 3V7RA 5HDKA 3X0MA 4EJTA 2FOKA 5TJJA 2H94A 1G6NA 4RGRA 1G3WA 2IW5A 3HYQA 3RH7A 2R7DA 5A2QK 4ILQA 3X0KA 3HUGA 1HZTA 4V14A 2A07F 2LKPA 1ZLKA 3J7AO 3KE2A 3RIRA 4M6XA 2FBKA 4N9IA 3E6MA 1UHWA 2W84A 4A6EA 2M45A 2FQ3A 4GO1A 3ZP5A 3IHUA 2V1XA 4RGUA 3ROUA 1BM9A 2ESNA 1LB2A 5HS8A 2V6CA 1PUEE 5TRDA 1R1UA 3O8SA 3R0AA 2ZJ2A 2VC1A 3WHWA 1HSTA 1W7PD 5FLXK 1J5YA 3FCMA 1IW7F 4UV9A 3SHFA 1K78A 2OAZA 3DFGA 3U53A 4KN7X 5LLQA 3X0RA 3SMDA 2KKOA 3H95A 3LA2A 5ILVA 1XSBA 3M8FA 2VN2A 2D1HA 3DPLC 3LFKA 2L02A 2PMHA 5E17F 5FSMA 2ZCWA 2O5FA 3BROA 3KLNA 4DNCA 2PBIA 1IXSB 5AIPA 1TUMA 1V8LA 2FRHA 1E2XA 4LG0A 3ZMSA 3IL2A 1KU3A 3ABUA 3L2CA 5FGMA 4U7BA 5BS6A 3KP4A 3G0QA 4LB6B 3J81K 1F3YA 2YSRA 4S2YA 1KU2A 3OGAA 1ZGAA 2NNYA 4HF0A 3JTGA 2M1BA 5ANSA 3TOBA 4KYWA 4UVAA 3RDIA 2OZUA 2XKPA 4FT8A 3KEOA 1IRFA 4LK0F 3GZ5A 4LFUA 2YX4A 1WQ2A 1QO0D 3V8JA 3WTSC 1NQYA 1B9MA 3X0LA 4IF4A 3REOA 1BOAA 1R5GA 2EV6A 4N0BA 5LEJA 1W7PB 2L4AA 4O3MA 1YO5C 2LF8A 2Z99A 2QYOA 2KIMA 1XGSA 2EFOA 3E6BA 1TW2A 4KN4X 1SU2A 1SMTA 3QP5A 1O3QA 3K1NA 2L54A 2W24A 2DLLA 3E6DA 4LGWA 1PUNA 3EETA 4A0YA 1NQZA 3EQLF 2VBWA 4IRHA 3ZMVA 2EV5A 1R67A 1R58A 3GVAA 1VK6A 1O3RA 2GXBA 2OD5A 1FOKA 2G74A 3CO7C 3FM3A 3O2PE 4M6YA 5L3CA 5D6EA 4EM1A 4O6JA 1KQ0A 4R79A 2IJLA 5KK1A 3TO7A 1Q54A 2YU3A 4ZYDA 3N97A 3J80K 3H92A 1FBUA 4CZZA 1FX7A 3QU6A 4HYEA 3CO6C 2A8PA 2GT4A 3PQJA 1PPVA 2KJBA 4LLLA 4LJZF 2XASA 3RKXA 1K26A 1L3LA 2UXNA 2Z9OA 4JQFA 4RB1A 5LHGA 3FXQA 2I8UA 3I7VA 3ZN1A 5LBQA 4BHPA 1I1SA 3FHZA 1S29A 4I09A 5LEKA 1MP2A 2DUKA 1G0SA 2CL3A 1BJAA 5GHPA 2A5YB 3QAHA 5ILSA 2GT2A 1G4DA 4GXOA 3KEQA 3E97A 3I54A 2JSCA 3ECHA 2MLGA 3NRVA 5DPKA 3A6UA 1SD4A 4KIFA 4A5MA 2ZMEA 1TQPA 1XSVA 2OA4A 2D2WA 1EH6A 2UZKA 5FD5A 1S7AA 1S3JA 3RJPA 1FT9A 1DDNA 3GWYA 3DPTA 1BC7C 1MKMA 5K1YA 1G3YA 4BHCA 1T98A 2HKOA 1YS7A 3MDGA 2XSQA 5CVUA 3CUQC 5CFIA 2YYHA 1KYZA 1TW3A 4OU0A 5GHMA 2ESHA 3HSRA 1KA8A 3O6BB 2ICKA 4L9VA 3WTVC 2DPDA 1R1TA 4BNCA 1VHZA 1V8UA 5LHHA 3I71A 4N1TA 3GFIA 4NFXA 4ZYGA 1NFSA 3DQVC 1H9GA 1TQMA 3JW4A 4I7HA 2IA1A 1P4WA 5JHUA 5FLXZ 2QZ8A 1ZRFA 2RGVA 1K78B 3LA3A 3MQ0A 5ILUA 2VOOA 3F72A 3L09A 3TKYA 1B4AA 1YTYA 1XGMA 1HSJA 1MJAA 3GW2A 5HDGA 4CGZA 3BHOA 4H0EA 2ADUA 1XMAA 3GFJA 2XAHA 5FSLA 1B9NA 2FBHA 4M71A 1XN7A 2JZYA 2ETHA 1IN7A 3I7UA 4S05A 3J81Z 1FBSA 5H6QA 4UNOA 1SZ3A 2M8EA 4ON0A 3E5XA 4ZYHA 3FM5A 1SFUA 3I53A 1BI3A 4YIFA 2K4BA 3X0JA 2HOEA 2QENA 3O3KA 1R5HA 2HGCA 4HV5A 4QWQA 1E17A 2CW0F 3M9AA 4HX7A 4CHUA 2X4HA 4PZJA 4WF2A 4KG3A 5FD6A 2E1CA 3K2ZA 4EM0B 5GHOA 3N9UA 2MBFA 1S8NA 2CYYA 2PEXA 1A04A 5AIQA 3MAJA 4I02A 2PFBA 1YIOA 1FYKA 3EESA 4RAYA 1JHFA 2TDXA 4YPHA 3V4GA 2EFPA 2G7UA 4GGGA 3MDIA 1JRKA 1UCRA 5EEHA 5I8UA 4AD9A 1RIOH 4RB2C 2HDCA 1MGTA 3QSJA 3DXJF 1LDJA 2EA2A 2WTEA 1P6RA 2O8XA 2FKBA 1UFMA 3KVHA 2VC0A 1IN4A 2JVBA 1XDSA 4AWXB 1CF7A 4IRIA 3GZ8A 1WWXA 5C7QA 1HBXG 3O69A 4FHTA 4MTDA 1Z9CA 4EMSA 1ODDA 2MH2A 4M9ZA 1H0MA 3X0IA 4BAYA 1O3SA 3GEZA 1ZYRF 4RB3C 2CSOA 3LWFA 1J59A 1U6GA 3DKUA 3X0NA 2QLZA 2R5WA 4IJAA 1QVJA 2VE9A 1MUTA 3BZ6A 2XHKA 2ZFWA 3SHDA 4UV8A 2XROA 4M73A 3BPXA 3LQQA 3KETA 1ZG5A 5DCFA 4S2WA 3FWEA 2XAJA 4LD5A 3BM4A 2XGXA 4C9WA 5ICCA 2ISYA 1HW1A 5LGNA 2A3SA 1U8RA 4AIKA 1MQEA 2IA2A 3KP6A 3WE3A 3RKWA 2DT5A 3FK9A 4R1HA 3VODA 3V7CA 3F8CA 2IVMA 1BI0A 1FYMA 5FFXA 3L7WA 2ZMEB 3ZN0A 2PN6A 2O1CA 4L18B 3R0JA 1UHMA 2VXZA 4AVPA 4R8HA 4ENKA 4O5VA 2VNQA 1Q33A 5JVTA 4YFKF 4HOBA 1BN5A 5D6FA 4WXCA 2BEOA 5GHQA 2OU2A 1WI9A 5EEGA 4WCGA 4XLPF 1FBQA 2PMUA 1R7JA 3PQKA 4YFNF 3KP5A 3KZZA 5BPIA 5BOXA 2F5CA 1ZARA 3X0QA 3QU3A 3ZMDA 1QZZA 2JT1A 2RN7A 2HQNA 5FFZA 2MA3A 4OMYA 1XD7A 3KCCA 3B02A 2YVOA 4A0XA 3F22A 2FNAA 2KDWA 2XV4S 5HS9A 2GA1A 2NAZA 1GXQA 3MFKA 4HDUA 1PPXA 2DSBA 5JFRA 4G7ZF 5FSIA 4KUMA 1ZH5A 4EVIA 1O7FA 3B73A 3WG9A 1W5TA 3E6CC 3KLOA 4JBAA 3R03A 1V8RA 4ZZLA 2K02A 4RGSA 5D4RA 1JXSA 2LNBA 2QJOA 1U5TB 2EWNA 2OQGA 2BV6A 5D8KB 4CICA 2VBXA 1K79A 1KYWA 3F6AA 1EV7A 3WTTC 2HWVA 1HW5A 1REPC 3F3XA 4S04A 5CVJA 1Q1HA 1R1VA 1F4KA 3V7SA 3CJNA 4L9NA 4LMYA 5F6FA 3VB2A 1U20A 2GIVA 2K86A 3FX3A 1OYIA 3HHGA 1P4AA 2FVVA 3I59A 4EV0A 4B8XA 5L3BA 1RI7A 5DUKA 3HTUA 4P9UA 4JZUA 1B6AA 4EJVA 5E1XA 5HS7A 5BQTA 1UB9A 5GHNA 1KQ9A 3ULQB 2H6BA 2RKHA 3BY6A 1SAXA 2Y48A 3FJYA 2BYVE 3GLXA 4XSZF 1R00A 4Y13A 2A8SA 3BP8A 5FB2A 3G73A 4A0ZA 1J2XA 4ENMA 4HW0A 3DUPA 3F8FA 2PQ8A 5ANTA 1F9NA 5ICFA 3F21A 4JK1X 3I0TA 1S6LA 3LAJA 4LK1F 1PUSA 4OIRF 3CUOA 4EGZA 3O6ZA 2QVOA 3HSFA 5GHJA 2CG4A 2OQRA 1H9TA 3GWZA 1VIQA 2RVCA 3CUQA 3X0SA 1K2EA 2KRFA 3WTWC 1QNTA 2DFIA 1J0RA 2ACJA 2H09A 4ZG0A 2KJCA 4NFWA 1K7AA 1L0OC 1CF7B 2ZO4A 3I58A 3JTHA 1YLFA 2MC3A 1FPQA 3QOPA 4HBLA 1DUXC 1I9AA 1V8TA 1BBYA 5DCMA 3E3VA 1WKMA 4ESFA 2WC2A 3NEUA 2Z33A 1FWZA 1LEBA 2IPQX 5LRRA 2AS5F 3R6SA 3E57A 3LAPA 3M8EA 4L9JA 1D3YA 3LSTA 3S2WA 5E1WA 2HTSA 3IWFA 1NHAA 3ELKA 2WWYA 1O7LA 3DKWA 1P4XA 3RPUA 3WTUC 4WXHA 2YVNA 3F23A 2A61A 2D45A 2IT0A 2VBYA 3R4KA 4BHBA 4ESJA 1Q27A 5K5QA 4HQEA 4PGHA 4XBFA 1BC8C 1TLHB 2CO5A 3Q5FA 4N9HA 3TOAA 2P7VB 5IT3A 3T5XA 2RV8A 1YFHA 1IN8A 2B0VA 4KIGA 3HYIA 4YOQA 2W25A 1JHHA 5HLGA 2Q9PA 4C9XA 1STZA 4HX4A 5D5WB 1R36A 1BIBA 3Q2SA 1TNSA 2XAGA 2B0LA 2GA2A 2DQRA 1HX3A 3X0OA 2D1VA 3DEUA 2XIGA 4KICA 1IUYA 1T6SA 2A6EF 3AC9A 2JTVA 4RGXA 5AONA 2G73A 1X3UA 2V9VA 4AIJA 4ASNA 4IRGA 2FF4A 2JPBA 1FNNA 2DK8A 1OR7A 2R3SA 3ACAA 1LQ1A 5CFJA 2MD5A 5JR3A 2P6SA 2KIUA 3P5TA 1U78A 4I98B 2NS0A 2FXAA 3DF8A 1S7OA 2M5WA 3BOQA 4A6DA 1ON1A 2VBZA 5J8CA 1HKTA 5DV5A 1V8YA 1Z1DA 4S2XA 4I0AA 1KHZA 5CVRA 2K4JA 2DK5A 2DHOA 2HEOA 1XSXA 1O57A 2EK5A 3KZYA 3IRQA 2ZNYA 2K7LA 3C3WA 3R61A 2BBYA 1HXDA 3ECOA 5J8FA 2G7HA 1SD7A 1LDDA 3I59B 1RRSA 2VNPA 1SJYA 4G7OF 4Y15A 4U0YA 2PQVA 3WGHA 2EJRA 4S2VA 5LPGA 4K2EA 3Q2TA 1X51A 2CFXA 2FE3A 2E7XA 1QQIA 1B59A 4LLNA 5FSOA 1LDKB 5C7TA 4LG0B 2XAQA 4A12A 2PLYA 5CYVA 2Q8KA 3IKVA 3HOTA 3P6YA 3WGIA 1F1ZA 3QP6A 3FMQA 2QWWA 4OINF 4GCVA 2F5EA 2RQPA 2VOPA 1R23A 2QBYA 1XB4A 4ZZDA 4CXFA 3GYHX 4KT5C 1ZRDA 2VE8A 3P7NA 4YFXF 4BYYA 1SD5A 1HKSA 5F64A 1GA7A 2GAUA 4PGGA 4ZH4F 1ON2A 4I2OA 1WRJA 2FU4A 3EXQA 3FMSA 5DEQA 3SFZA 1KT9A 4P96A 2IP2A 5ANVA 3D0SA 4YG2F 1ZREA 2DO7A 2B2KA 2EB7A 1X84A 1SOIA 2EFQA 2NYXA 2PJPA 1VRLA 2Q2EA 3Q9SA 3TQNA 4ICKA 2HFHA 3K0LA 2X0LA 5FO5A 1I1GA 4XRFA 2E1NA 3N4MA 3P9IA 3GZ6A 1ZG3A 4Q47A 2FMYA 2QJTA 2L4MA 5KVRA 1Z6RA 1FZPB 4BQAA 3E5UA 1R22A 3ABTA 3HHJA 4XLNF 4G94A 5DDGA 2UXXA 4U0VA 1KU7A 2LDUA 3FSPA
chains in the Genus database with same CATH superfamily
3H0GJ 3BLYA 3E5QA 2VJIA 3S3NA 3S14J 1NTCA 2O03A 1W4MA 2RNJA 4G8XA 1PUQA 4ETSA 2Y9ZA 1ETWA 1MIJA 3MZHA 1FSHA 4V2GA 1DPUA 4EJOA 1MQWA 2YVMA 1G59A 1JGSA 2XUBA 4L9TA 1M1EB 3PSFA 3TO9A 1Y6IA 3I4PA 3RI4A 1HKQA 5HLIA 2QA4I 3CC2I 3VYUB 2ECBA 4U88A 4FTHA 1X1DA 2JA5J 1IN6A 1KU9A 1GV2A 1XDUA 3JR9A 4PJJA 1JE8A 1JJ8C 2XB0X 1IAWA 3A0BC 2W4SA 4KISA 3RQ4A 2DXIA 1XTAA 2PX9A 4NC8A 4CYCA 5K5RA 9ANTA 4XKCA 5ISYA 1RETA 1QPMA 1SD6A 2HKXA 1WJEA 2W00A 4D5FA 2W48A 3M1EA 4B4CA 2XB5A 2Q1ZB 2FA5A 2ZJRF 1UJ8A 5GAHJ 2COBA 3CNGA 1K6OA 1FOXA 3M8JA 4XKWA 3SZPA 3HXLA 4CYDA 1UG2A 2K9MA 4E7ZA 3M4OJ 4C2UA 1G3TA 3WU0A 1O3TA 3FXMA 2X1EA 2GM4A 2JVHA 1OJLA 4L0ZB 5GPAA 1TQIA 3KFWX 5D5XB 4IHSA 2NVUB 1W36D 3MZYA 1VQ7I 1Y1WJ 1VIUA 2ZXHA 1DQUA 1P7IA 4LG3A 2DSCA 3HIFA 1U5TC 4DBRA 5F1RA 5C8LA 1YW7A 1LEAA 2BXYA 1YW8A 3JREA 3L2RA 3H0DA 3MWMA 1QZYA 2GXGA 3CTAA 1I27A 2DOEA 2A8TA 4BJ6C 4I0BA 1K6YA 2JA7J 4C3JJ 4Q48A 3WTZA 2W85A 1WJBA 3OMYA 3S1NJ 3I4NJ 2O8KA 2KZVA 2R93J 3G4SI 2VT3A 4HX8A 4Y17A 4DBQA 5E1ZB 4D1QA 1ZGJA 3FXRA 3CESA 5HLHA 3VSKA 3KP2A 2CFOA 3Q9VA 3FXUA 4G9YA 1R71A 1GXPA 3SZTA 4EQQA 3ZCOA 1FLIA 4K6EA 5FSKA 5EZHA 1MDMA 3U1DA 1HF0A 5JLWA 2DCEA 1RKWA 4BQNA 3F9KA 4KITB 4HLYA 4HNTA 4KT6A 3P9KA 1P92A 3CDHA 4AYBN 4A3MJ 3BWGA 4CO8A 2CUZA 1UZCA 3F8MA 4C9YA 5BPDA 3GG6A 4MPOA 1YG2A 3GTOJ 5ANWA 2XSDC 3CF2A 2AHQA 1TTYA 3TDZC 4XLHA 4CA0A 4XKBA 1J9IA 1OYWA 2ICJA 5E3NA 3G1MA 2JA6J 1IXCA 3CQZJ 4HFQA 3OYAA 3FF5A 4A69C 1MR2A 4PCQA 1XSDA 5ERIA 1HW2A 2F5FA 3HRMA 4M74A 3H3UA 2FNPA 5CJ9A 4QIWN 2DA5A 4BS9A 1V8IA 3F13A 3OR1C 1I5ZA 1SMYF 1XGNA 2KIQA 3WODF 1VQNI 3M1CA 3TEDA 4ZTFA 1EH8A 2CUJA 2JN6A 2P7CB 1PP8F 1FOYA 4M9SA 2NRAC 4UUVA 2DDAA 1JUSA 2I8DA 2P0WA 4D0PA 1N75A 2GQQA 2JQ7A 4MEYF 1FP1D 5IT9K 3QODA 2EZHA 2H8RA 2P4WA 3Q0VA 1NK3P 1D1BA 1D0XA 2BY1A 2NS7A 1OKRA 2QM3A 3CJQB 3DWLE 3W6JB 2QBYB 4C3HJ 3MCFA 4WXDA 4KA4A 1JKNA 2K9QA 2P5VA 1V8SA 3E7LA 5HVQC 4M3FA 6PAXA 1X1PA 2R5ZA 2EILH 1MH3A 1IRGA 1W5SA 1GHCA 3IH2A 1YYVA 1Z6TA 4I01A 3SJMA 1VQMI 4NC6A 1MJ9A 2WV0A 3SEZA 3M7GA 1I3QJ 3K1MA 2DQLA 4IQ4A 1QA6A 1TP4A 1YJWI 3QPLA 4NB5A 2DT7B 2COMA 5BMZA 1D8KA 5DUIA 1RUNA 3H35A 3A0HC 4MEXF 2E1MC 1CGPA 2ZXJA 1ZRCA 5LHIA 3K4KA 4FQGA 3OYHA 5JLXA 2M2EA 3IH4A 1CQTA 4YPRA 4EJWA 3HHHA 3PL8A 4IOCF 2DJIA 4Y4RA 3TO6A 2H1LA 5GHIA 2HOTA 3WTXC 3GTGJ 4M3BA 5L3FA 4ENJA 2GWRA 2VJJA 2KIFA 2PG4A 4FX0A 2K5CA 4HPQA 1H8AC 4B3AA 3C7JA 4KYXA 2MLKA 2C6YA 3WU2C 4E70A 3L85A 1OLTA 4IHTA 1ACIA 3COUA 2Z16A 2XRNA 3IWZA 1PJRA 3OS0A 2KQRA 2O5WA 4ENNA 5HZXA 2PMZA 2Q2EB 3C18A 2YX7A 3OS1A 2HPMA 4KTBA 1RR7A 3F6VA 2IS6A 2W57A 2HYJA 3QPSA 1OW2A 2LG4A 4XOTA 3OV8A 3V8LA 3MKYB 5LGUA 4HV6A 5EJCA 5E18F 2HR3A 3OSGA 4OOIA 3T8RA 1TWAJ 2HYGD 1F36A 3RKYA 3JRGA 2FEZA 3B6AA 4MTEA 3ABLH 3J7AY 3H3ZA 1KZHA 3L2WA 1USSA 2A05A 4I76A 1QBJA 5BONA 2ZC2A 4UVBA 4F7ZA 2VODA 3BR5A 1Z77A 3V8KA 2QQ9A 3ZMZA 3ZRGA 1IV6A 2VB6A 3B6CA 3S15J 3PNTA 2PJRB 4KDPA 1LPQA 1JTYA 3ZMUA 5J1YA 2OPTA 5B1BH 1MK1A 4AIHA 4MQVA 3T8TA 4KMUX 4IHYA 1T2KA 3IUOA 2ZFUA 4DIQA 2VJ5A 3HOUJ 3J7YJ 4WWCA 2A8RA 1FP2A 2LTPA 2B63J 2ID6A 1FY7A 5CLSA 2X6YA 5FLVA 3WE2A 3JSPA 1IZ1A 2DMTA 4HF1A 3ZQQA 3IH3A 4OMZA 2A8QA 5F27A 3K9TA 3ID9A 4RB0A 2KPMA 3FXLA 5E20A 2QQAA 5D8LB 2DPUA 2JA2A 3OYLA 2RRKA 3U2RA 4JOMA 1XSAA 2ZKZA 3MGMA 4MHGA 3BR0A 1ITYA 4HLXA 4PUSA 3PIPF 2E2HJ 2Q0OA 4PFPA 2KRHA 4NHJA 2TRTA 5DM6F 3QYBA 5DYMA 1X2NA 2O6GE 3K70D 1ZAOA 4XLFA 1Z7UA 2LKXA 1ETYA 2DAOA 2QQ8A 1N78A 3JRAA 5CQGA 4RAFA 3A6SA 1F5TA 5GADJ 2BGCA 2FBIA 2WBMA 1P7JA 2E7WA 1VQ6I 4P55A 5GAEJ 3EYIA 2W4EA 2Y69H 2YPRA 2CV2A 2DA7A 3SDGA 4C2TA 2L9SA 3ZR0A 2A68F 5JHFA 2FUG2 3FXKA 2E5ZA 3EF5A 2M8GX 2EFNA 1K4SA 3BDDA 3SDBA 1Z05A 2Z3YA 1Z3YA 2JRTA 3CDLA 3RYRA 1BI1A 1HQCA 3HRUA 3PIOF 1XPXA 4G6DA 1T39A 3HTSB 2P6TA 2RC4A 4ZYEA 1I50J 4HSTA 4PDKA 5BNGA 4E7SA 1G9QA 5IW4A 3HOVJ 2M0MA 3ZQIA 3OYDA 3K69A 2AXLA 4QLCU 3GTKJ 5K5OA 4OIQF 1VC9A 4JZSA 1ZLJA 3CCQI 4F92B 5D5VB 1F43A 4UVCA 3W6KB 1R49A 3OYCA 2G9WA 2IRFG 3ZQ7A 3FXOA 4KG4A 5FSNA 1EKEA 1J75A 5KAFC 2IGNA 3A02A 4RLQA 2XAFA 1ZTRA 2E5NA 2Y0SN 3D5LA 3LNQA 2Y75A 3AFHA 1QGPA 2XF5A 1R4NB 3ZXSA 5D5UB 2LRDA 3JAMZ 3GUDA 2HTJA 2YVPA 2JMWA 4YIIA 3GRNA 2V1DA 1YI2I 5F0CA 4HF2A 3F8BA 5HOOA 3FBNB 4IHXA 1MD0A 2L9VA 4II3A 4M9XA 2I8TA 3LSPA 3A6TA 1UHSA 2DFEA 4HAMA 4A5NA 1H88C 3GCMA 5DD4A 5CVVA 3HSEA 3AG1H 2H27A 2FQ4A 1AOYA 3C1DA 4UXNA 2OCEA 4DYCA 3OL3A 1MDMB 5L3GA 2VONA 4A3DJ 3FKIJ 1NFZA 2XVCA 2EA4A 1U2WA 2R7OA 2ELHA 3EUHA 1AWCA 3ZPLA 2PNYA 2OF7A 3SQNA 3RPQA 4BE2A 3K10A 3DPUA 3R60A 4OIPF 1LUJB 3GX4X 2WAQN 3HOSA 2GIZA 3EDPA 1UMQA 4FETA 3DBLB 4Z2YA 3OIQA 2STWA 1D0ZA 4IXAA 5J3LA 5ICEA 2B06A 5L3EA 1QHGA 4DYQA 5B3SH 3SXYA 1OCPA 2MG4A 4L5IA 3HDDA 3K1PA 4QSHA 3VOEA 1NK2P 2LSOA 5C4XJ 4Q5SF 3L00A 2J5OA 2FJ1A 5EDNA 2Z5UA 1PDNC 4BL0B 2NVTJ 1RYAA 1KQ8A 1B1BA 3BG6A 3S1MJ 5LGTA 4LLGF 5GAGJ 3VWBA 3HGYA 4KNYA 2A6TA 1USTA 4A3EJ 5IW5A 5EF6A 5KAIC 4P9FA 5A2QZ 2P5LC 1LJ9A 1MZBA 1IXRC 3TP0A 1GVJA 4Y3OA 1EJ9A 4G6QA 1GVDA 5IYBJ 1HC8A 5E3OA 4RA2A 1DPRA 2BVLA 3WHCA 3PNYA 4P5OA 1TWFJ 3BJOA 3BR3A 1I6XA 4MQ9F 3SEQA 1ERDA 1OCZH 5L3DA 4ITVA 2HI3A 1ZN2A 1EH7A 1WJDA 3OS2A 3RCOA 1YHQI 3KP3A 2KISA 3BJAA 2VL8A 5IT9Z 4KMFA 3CCMI 1DP7P 2CW7A 4HZFA 2FD5A 3RTRA 1IO2A 2NNNA 2L3DA 3QPTA 3AAFA 5HDNA 3KPHA 3BPVA 2J8QA 3MN2A 4NQWA 2M30A 4UHTA 3MD2A 3F0CA 4MLOA 3JRHA 3QRFF 1ZG1A 2M87A 3BCAA 3ZMTA 4BKXA 4HRIA 4I99C 4LB5A 5CVIA 3T0YA 3I56I 3EEUA 3I9XA 1C0WA 2VPRA 2YR2A 2M34A 2DSDA 2R7FA 3K4CA 1OPCA 1IN5A 3L2VA 2V1UA 2DW4A 1YIJI 2F4IA 1YQAA 2BY2A 3WTYC 1PUFB 5JI6A 2DA3A 2CUEA 3GXOA 4WK8F 4BY7J 4B47A 2A6HF 4XSXF 3BAPA 3KYCB 3GF2A 2RQQA 5F1JA 3RPUD 3F8NA 4PJNA 1SAUA 3BTJA 1Z67A 2J5PA 3HRTA 3NAUA 3OYBA 1FIPA 1BR1A 2IGOA 4ZTJA 4BBRJ 3A6VA 4GYIA 1U5TA 2O7OA 2EFWA 2AQEA 1BJZA 4F91B 4EJUA 3MCZA 1D5VA 2XKOA 5E8IA 5ED4A 1U3EM 2GZWA 1ONVA 2W82A 1A6QA 3F6OA 3L9FA 4DZPA 2QQBA 4G7HF 1IRZA 3A01A 4W1UA 4IX7A 3P9CA 3CUQB 4XRSG 3WGGA 2HQRA 3NWSA 3A4CA 3H5AA 2KDVA 1XGOA 1X83A 4C3IJ 2VJ4A 3ISPA 2V9KA 5K7ZA 1SVOA 4Y33A 1V8MA 4GYGA 3UR3C 2QSHX 2RREA 1JKPC 3QWLA 4IJXA 1JUPA 2BY3A 3DKXA 1V8VA 4IHVA 1LNWA 1X19A 3CCRI 1RNLA 1ULYA 3IC7A 1V3FA 3LQRA 1FC3A 3O8GA 1D1CA 1PPWA 4YRVA 1VCDA 3TGNA 1RUOA 1KGSA 1E3OC 3DU6A 1P2FA 4CUGA 1WZ2A 3I5UA 5F04A 2HU9A 5LD2C 3D5SC 3N77A 4N4NB 1ZR2A 5DCMB 1LVAA 4HVYA 2JPCA 3EYYA 5J6XA 2K27A 2Y2ZA 2CWEA 3HEFA 2F2EA 2P5KA 3L2QA 4DYWA 4MNUA 5H20A 1A35A 4L5JA 4IVNA 3U21A 3VFZA 3HRSA 2V79A 1Z91A 1JKRC 4RS8A 5E8GA 5IYCJ 3GFMA 4J7GA 2NXNB 2DYSH 2ME6A 2O0YA 3HZJA 3K4MA 4EGYA 2QKMB 3GO5A 3DV8A 5F08A 4Q4ZF 2HQ5A 2HZTA 1YJNI 2H8WA 4NNJA 4BJTA 3DP7A 1V4RA 2L2OA 3VPRA 3JCUC 1T95A 1SEUA 2PI0A 3CLOA 4OWRB 5D4SA 2ZBKA 3DKYA 4BXUA 3IKTA 3S8PA 2LLKA 4IPAA 1VQPI 3S17J 1ZHFA 1FSEA 2A69F 2QUFA 4HNUA 3S1RJ 3Q93A 2Y0MA 2HYFA 1E0EA 1XMKA 3N05A 4BEHA 3Q4IA 1JKQC 2H6CA 4FCYA 4JX4A 5ANUA 3IRRA 2EV0A 1FYLA 4JZVA 2DTZA 3RYPA 4HA8A 5H6RA 5JVGF 1D1AA 1VNDA 3BJ6A 1G3SA 4N1UA 2JUGA 2X6OA 1VTNC 1W7PA 3H9JA 4XN3A 3TL4X 3RQIA 3O52A 1MSFC 2MABA 2IA0A 4BE1A 1TNTA 1TT0A 3GFLA 4HQMA 2KDZA 1VHGA 3G3ZA 2LP0A 3ML6A 1HDPA 4M72A 2OBPA 3ERED 1T38A 2DTRA 2Y0SA 1PVFA 4B44A 1OMIA 2P8TA 2RDPA 2L01A 1X4PA 3J80Z 3WU1B 2MH9A 4PSXA 1J7KA 3A1YA 4E7KA 5E3LA 4B09A 4EM2A 2XSJC 3QPHA 1BIAA 1FIAA 4BU2A 1V8NA 1VQKI 4A2UA 3OOPA 2VQHA 2CMPA 4ZYAA 2WY7Q 4EATA 4DQ2A 4WX9A 1YS6A 1MW7A 1ZQ3P 3HJEA 3VEPA 2DBBA 3JSOA 2LF7A 1LKXA 2O3FA 2KHMA 4CDGA 3RSNA 2ZNZA 1YW9A 5ICGA 4QTRA 3O61A 1LE8A 3FFUA 2OZ6A 2CQKA 3MEXA 1WVRA 2VQGA 3AL0B 3OR2C 2ID3A 5DD8A 1RZ4A 3H9GA 3IAM2 3ZR1A 3IP4B 3PM1A 1IRYA 1UG0A 1LFBA 3MZ8A 4RAZA 3HPGA 1IF1A 2DOAA 3FZVA 4L0YB 3Q91A 2BE5F 3Q1PA 1BR2A 1T0FA 3NQOA 3CMEI 4KFCA 3H1CA 1SFEA 4KIBA 5C44J 1DP3A 4XK4A 4I6ZA 5FRMA 4ZJZA 1X1AA 1RRQA 1SFXA 2HS5A 2ISZA 2GOXB 2AZWA 2F5DA 1XCBA 4HDVA 1XCVA 3KP7A 3J7ZI 1WSUA 1PP7U 3T1BA 4IOAF 3U9GA 1OCRH 3JAMK 3OYFA 2STTA 3FXJA 4CCOA 3O8HA 4FX4A 1KTGA 3TDUC 1D8JA 1TWGJ 2AXTC 2DI3A 1VC8A 1GDTA 3TBIA 2XF7A 4ESBA 3BR2A 2GB5A 1PYVA 3BG3A 4OIOF 2O61A 2FMLA 3ZQLA 5LRSA 3SONA 2FSWA 4PJ0C 5FKOA 4F3QA 2OJED 1RC9A 4TV7A 1V8WA 4JZTA 1JKOC 1JT6A 2DA4A 1BI2A 1MJBA 2ME0A 4N4OB 1TBXA 4U7DA 2LKSA 3X0PA 2CGPA 2I6KA 1XMXA 1OYYA 4X1EA 3A2KA 4BH9A 4BUPA 4NBQA 3J7Ye 3LA7A 3I64A 3FMRA 1IUFA 2XAUA 3BTCA 3LSHA 3QQAA 3COAC 2UWMA 2QF7A 4MGRA 2E35A 1XSCA 2R7VA 3PO2J 4U0WA 1POGA 1WJAA 1DU0A 4NQWB 1Y0UA 2DU9A 2VT2A 3PFIA 3V7RA 3RKQA 5HDKA 3X0MA 4EJTA 1MMDA 2CH0A 1WHUA 1HDDC 3OSFA 3HGGA 2EIKH 2FOKA 5TJJA 2H94A 2X6XA 1G6NA 4RGRA 3HB9A 1G3WA 2XDVA 2IW5A 4ABZA 3HYQA 3RH7A 2R7DA 5A2QK 3PSIA 1ZK8A 4ILQA 1VQ8I 3EUAA 3HUGA 4CCKA 3X0KA 1HZTA 2BY0A 4V14A 2A07F 2CJJA 2LKPA 2E71A 1ZLKA 3J7AO 1OISA 3KE2A 3I4MJ 1H89C 3RIRA 1W5CC 2VKHA 2FBKA 4M6XA 4N9IA 4A93J 2HVQA 3BZCA 3E6MA 1OQYA 1UHWA 1YX3A 2DODA 4BGDA 4B3XA 2W84A 4A6EA 4DJAA 1VFCA 5J40A 2VQCA 2M45A 3KZIC 2FQ3A 4GO1A 4OAZA 2RAEA 3ZP5A 3IHUA 2LD5A 2V1XA 4RGUA 3GTLJ 2XPVA 3ROUA 1BM9A 3KX2A 1MMSA 2ESNA 1LB2A 5HS8A 1IC8A 1YITI 1QU3A 1HCRA 2V6CA 1PUEE 3JRBA 1R1UA 5TRDA 2G0EA 5IPAA 5IP7J 1WH7A 3O8SA 3R0AA 5M5XJ 3OL4A 4AVZA 1YE9A 1WJCA 5E3MA 4G6TB 2ZJ2A 2VC1A 3WHWA 4XNFA 1HSTA 1W7PD 2HZDA 4HEA2 5FLXK 2HOAA 1J5YA 2IGKA 3ESWB 3FCMA 1IW7F 4UV9A 3SHFA 1S9HA 2MC4A 4LIUA 3CMAI 1K78A 2OAZA 2HQAA 3DFGA 1MBHA 3U53A 4KN7X 5LLQA 4PJLA 3X0RA 4MO7A 2JRMA 3SMDA 2KKOA 3H95A 3LA2A 4CCLA 5ILVA 1XSBA 1EA3A 2YS9A 3M8FA 3LFUA 5IOYA 2VN2A 2D1HA 1X2MA 3DPLC 3LFKA 1ETXA 1ETKA 2L02A 2PMHA 2ZCWA 5H2FC 3CD6I 5B1AH 3BROA 5E17F 2O5FA 1X3ZB 2DMNA 3KLNA 2GXAA 3CJRB 4DNCA 2PBIA 3DEEA 1QVTA 1Y0NA 1IXSB 1AKHA 3CC4I 5AIPA 1TUMA 1V8LA 2CUFA 2FRHA 1BOBA 1E2XA 4LG0A 3ZMSA 3IL2A 1KU3A 3ABUA 5FGMA 3ZQFA 3L2CA 1ORKA 4U7BA 3OYJA 1D5YA 2JUCA 3KP4A 4CSWA 5BS6A 2OTLI 3G0QA 4LB6B 3J81K 3S1QJ 1F3YA 2YSRA 2HVRA 5F0FA 4S2YA 2B9SA 5CKTA 1KU2A 3OGAA 1ZGAA 3BG5A 4HF0A 3JTGA 2NNYA 2NVQJ 2M1BA 3LSRA 1Z7LA 5ANSA 3TOBA 4RDUA 4KYWA 2E36A 4UVAA 3OYIA 3UNGC 2DFFA 1FMWA 3RDIA 4L5EA 5EG0A 4CZCA 2OZUA 1MH4A 2XKPA 4FT8A 3BT9A 3KEOA 2R5YA 2DOFA 1IRFA 1SC7A 2X1DA 3Q3SA 4LK0F 3GZ5A 4LFUA 2YX4A 5IOZA 1WQ2A 1QO0D 1ETQA 3V8JA 4B48A 3WTSC 1NQYA 1B9MA 2I5UA 3X0LA 4IF4A 3REOA 1BOAA 1R5GA 2EV6A 4N0BA 5LEJA 2QKLB 1V55H 1W7PB 2L4AA 2XGEA 1BR4A 1S72I 4O3MA 1YO5C 2LF8A 2Z99A 3CZ6A 2M3AA 3G71I 3BCBA 3WG7H 1V5FA 2NVXJ 1TT5B 2WADA 1SVLA 2QYOA 2KIMA 3BQZA 1BW6A 1XGSA 2VQLA 1PVEA 1OCOH 2EFOA 3E6BA 1TW2A 2WA0A 4KN4X 1SU2A 2V1NA 4FE7A 1SMTA 3QP5A 1O3QA 1G8XA 3K1NA 3UKGA 2KFDA 2L54A 2W24A 2DLLA 3E6DA 4LGWA 1PUNA 1U8BA 3EETA 4CYCB 4A0YA 1NQZA 2Z1DA 3EQLF 2X85A 5IP9J 2VBWA 4IRHA 3VDXA 3K70C 3ZMVA 2EV5A 1R67A 3H5NA 1R58A 3GVAA 3A03A 1VK6A 2R7UA 1O3RA 1IG7A 1JGGA 2GXBA 1LE8B 3PFYA 2OD5A 2E2IJ 5EGOA 1FOKA 2F4OB 2LVSA 2HVSA 2MSYA 2G74A 3CO7C 4D7NA 2E19A 1Y8QB 1MNEA 3FM3A 3O2PE 2ZJQF 3VYSB 4M6YA 5L3CA 5D6EA 4EM1A 4O6JA 5M5WJ 1KQ0A 2ELJA 3LOCA 4R79A 1W0UA 1Z3XA 2IJLA 5KK1A 2M4GA 3TO7A 1Q54A 2YU3A 4ZYDA 3N97A 2L9RA 3J80K 2V6EA 3H92A 1FBUA 2HXIA 4CZZA 3BC8A 1FX7A 3QU6A 3P5JA 4HYEA 3CO6C 2A8PA 2LK2A 2GT4A 3PQJA 1OCCH 1PPVA 2KJBA 4LLLA 4LJZF 4BJ5C 2XASA 3RKXA 1K26A 1L3LA 2UXNA 4D5CA 1APLC 2Z9OA 4JQFA 4RB1A 5LHGA 3FXQA 2I8UA 1WFXA 3I7VA 1HLVA 3ZN1A 5LBQA 4BHPA 1LFUP 1I1SA 1UELB 3FHZA 1T8IA 1S29A 4FISA 4I09A 2DA2A 5LEKA 2LFBA 2X6WA 3DEWA 4F93B 5TISC 3OYNA 3GTJJ 1MP2A 2DUKA 4FASD 3S32A 1B72A 2LY1A 1G0SA 2CL3A 4AYBA 1BJAA 3ZOBA 4XLEA 2VKEA 5GHPA 2IS2A 2A5YB 3SZGA 3QAHA 5ILSA 1O4XA 2NOJB 1A6IA 1RPWA 2GT2A 1G4DA 2X9DA 4E7HA 1OCTC 4GXOA 5B66C 3KEQA 3CMYA 1ZGWA 3E97A 3I54A 5FKLA 3GBGA 4ZDOA 2JSCA 3OYEA 2I10A 3ECHA 3I3LA 4GRIA 4ZC3A 2MLGA 3NRVA 5DPKA 4A3CJ 3A6UA 1SD4A 2GBYA 5F0HA 4KIFA 2OV7A 2ZMEA 4A5MA 1TQPA 2ZJPF 1XSVA 2OA4A 3ZGKA 2D2WA 3RZDJ 1EH6A 2UZKA 3HKZN 5FD5A 3LSKA 1A5JA 2AO9A 1S7AA 3W6VA 1S3JA 2VASA 3RJPA 1FT9A 3AG2H 1DDNA 1I3AA 5K7HA 3GWYA 3DCFA 3DPTA 3NARA 1A31A 2HOSA 2LR8A 1BC7C 3W2WA 1MKMA 5K1YA 1YX5A 3HOWJ 1G3YA 1EF4A 3TW7A 4BHCA 1U0JA 1T98A 2HKOA 1YS7A 4IL6C 2CQ7A 3MDGA 3VYRB 2VI6A 2XSQA 2FOWA 2WAEA 5CVUA 3CUQC 5CFIA 2YYHA 2DN0A 4NUBA 1KYZA 1SFKA 1TW3A 4OU0A 5GHMA 1G2HA 2ESHA 4XR6A 1V5GA 3HSRA 2R7ZJ 1KA8A 3O6BB 2ZB9A 2ICKA 4L9VA 3WTVC 4NC7A 2DPDA 1R1TA 4BNCA 1VHZA 3H9QA 2R5ZB 1V8UA 5LHHA 2NVYJ 3I71A 4M6VA 4C30A 3KYDB 3MKWB 4N1TA 3H3VK 3GFIA 4H4KC 4Y52J 4NFXA 4ZYGA 1NFSA 3DQVC 1H9GA 1TQMA 3JW4A 5EEAA 4I7HA 2IA1A 4X0GA 1P4WA 5JHUA 5FLXZ 3JRIA 1MNMC 2QZ8A 5EZGA 2VLAA 5FLMJ 1ZRFA 3GTQJ 2JWTA 3G6EI 2RGVA 1K78B 1IDZA 2DDBA 3LA3A 1FMVA 1P9QC 3DBRB 2R7QA 2KP6A 3MQ0A 5ILUA 1B8IA 2DMPA 2VOOA 2K9SA 3F72A 3QYEA 3L09A 4W97A 3TKYA 1B4AA 1YTYA 1XGMA 1HSJA 1MJAA 3GW2A 5HDGA 3S16J 1NH3A 4CGZA 3BHOA 3U1KA 2F5VA 4H0EA 3LSJA 2ADUA 1XMAA 4IHWA 1Q1VA 2BXZA 3GFJA 2XAHA 5FSLA 1B9NA 1AA7A 2FBHA 4M71A 1XN7A 3PO3J 2JZYA 2DA1A 5GPCA 2MD0A 2ETHA 1IN7A 3I7UA 4A3KJ 1SVMA 1I39A 2KRCA 4S05A 3L1PA 1XG1A 3J81Z 1FBSA 5H6QA 2BW3A 2EIJH 2WB1N 4UNOA 4CH7A 5K7FA 2CQQA 1SZ3A 2JSPA 3HC7A 3OIPA 4MFEA 4NDLA 4RBOA 2M8EA 4ON0A 3E5XA 4ZYHA 4ZDLA 3FM5A 1SFUA 5EG0B 3I53A 2LYCA 1BI3A 1Y8RB 4YIFA 1GT0C 1VQ9I 1K61A 2K4BA 1MBEA 3BTIA 3X0JA 4RM2A 2HOEA 5J4VA 5EYRA 2QENA 1R5ID 3O3KA 1R5HA 3VSLA 2HGCA 4HV5A 4QWQA 1E17A 2CW0F 4BXFA 3M9AA 4HX7A 4A3JJ 4CHUA 2TCTA 2X4HA 3CDIA 4PZJA 4WF2A 4KG3A 5FD6A 2E1CA 3K2ZA 4EM0B 5GHOA 4YIRX 3N9UA 2MBFA 3LL7A 1WJFA 1S8NA 2CYYA 3E0JB 2PEXA 1A04A 3OY9A 1WI3A 3MMYB 2DMUA 5AIQA 5IYDJ 3MAJA 2UV1A 4HG2A 4I02A 2PFBA 1YIOA 1OR7C 2B7EA 3C2GA 1QHHD 4XRMA 2IXSA 1FYKA 1E3PA 3EESA 2R92J 4RAYA 1JHFA 2TDXA 4E7JA 4YPHA 3V4GA 2EFPA 3K4LA 2G7UA 4GGGA 3S93A 3MDIA 3AL0C 3KIOA 3K2AA 4BBSJ 1JT0A 2PMZN 4LOCA 1JRKA 1UCRA 5EEHA 5I8UA 3C2BA 3DTIA 4AD9A 1RIOH 3CC7I 4RB2C 2CZRA 3HM5A 2HDCA 1MGTA 3QSJA 3DXJF 1ZELA 1LDJA 1IRXA 3K7AJ 2EA2A 2WTEA 1P6RA 2O8XA 2FKBA 2XF6A 1UFMA 4J00A 5EGOB 4GDFA 3KVHA 4J7HA 1TWCJ 2VC0A 1JUMA 4EEFG 1IN4A 2JVBA 1LVKA 1XDSA 2DT6A 2PJRA 4AWXB 1CF7A 4IRIA 4E4HA 2R7SA 3GZ8A 1Z0XA 2EZLA 3CP8A 3ZQCA 1WWXA 3CMMA 5C7QA 1HBXG 2O5RA 4YELA 3O69A 1Y1VJ 2M7BA 4FHTA 4MTDA 1Z9CA 3BG7A 3QYFA 4EMSA 1ODDA 4J01A 2MH2A 4M9ZA 4DGWB 1H0MA 3E1SA 3X0IA 3DTKA 4BAYA 1O3SA 5GTHC 3GEZA 4LITA 1ZYRF 4RB3C 2CSOA 1WGXA 4IKFA 3W2VA 3LWFA 1J59A 2ZSHB 1D0YA 2V9PA 2CV1A 2E60A 2QSGX 1U6GA 3DKUA 3KYLA 2JK3A 2Y31A 1MMGA 3X0NA 3CJTB 2QLZA 2EZKA 2BHZA 2OTJI 2R5WA 4IJAA 1QVJA 2VE9A 1MUTA 3BZ6A 3EUKL 2XHKA 2ZFWA 4BQOA 1VQ4I 3SHDA 4UV8A 2XROA 1DGRM 3GTPJ 4M73A 3BPXA 3K6GA 3LQQA 3KETA 1ZG5A 5DCFA 4S2WA 3FWEA 4DOZA 4QPQA 5KNLA 1B72B 2XAJA 1MNDA 4LD5A 4UUSA 5HNHA 4XM3A 3BM4A 2XGXA 5J1RA 2DA6A 4C9WA 2WAQA 2ISYA 1HW1A 5ICCA 2A3SA 5LGNA 4F55A 4XICA 1U8RA 4AIKA 1MQEA 2KZGA 2Y9YA 2IA2A 3KP6A 3WE3A 3RKWA 2DT5A 3FK9A 2MYSA 4R1HA 3VODA 2F6CA 3V7CA 2IAIA 1W36C 3F8CA 2IVMA 1BI0A 3CCVI 5FFXA 1FYMA 3HKZA 1X58A 3L7WA 2ZMEB 2K9NA 3ZN0A 2V4JC 2PN6A 2O1CA 1DGWY 1KONA 1TZLA 4L18B 3R0JA 1UHMA 2VXZA 4AVPA 4R8HA 4DZJA 3HPHA 4ENKA 2HDDA 4O5VA 2VNQA 1Q33A 5CPRB 2EH3A 1RESA 4XLCA 5JVTA 1GUUA 4YFKF 4HOBA 1BN5A 3OYKA 2ECCA 3K4JA 5D6FA 1QRYA 4XN0A 5J1UA 4WXCA 2BEOA 2OCCH 5GHQA 2OU2A 1WI9A 5EEGA 4WCGA 4XLPF 3Q0WA 2R7XA 3MKLA 2BZTA 1FBQA 4X6AJ 2HDWA 2PMUA 1R7JA 3S2HJ 3PQKA 3JRFA 4YFNF 2YU9J 2P81A 4XKVA 3KP5A 3KZZA 5BPIA 5BOXA 4Z6YA 2F5CA 3BR6A 3I9V2 3ABMH 4XONA 1ZARA 3X0QA 4AU7A 3QU3A 5DS9A 3ZMDA 1QZZA 2JT1A 2RN7A 1WH5A 4XORA 4S0HB 4CCMA 2HQNA 5FFZA 2CU7A 2MA3A 3TP3A 2XC7A 5FRNA 4OMYA 1XD7A 3KCCA 3B02A 2YVOA 4A0XA 2BHYA 3NWTA 2FNAA 4KJZA 3F22A 2KDWA 2XV4S 5HS9A 2GA1A 2NAZA 1GXQA 1ETOA 1QPIA 2XPWA 2RNGA 3MFKA 2CRGA 4HDUA 1PPXA 2DSBA 3Q0UA 2K3FA 1B8IB 2VKVA 1MMNA 5JFRA 4G7ZF 5FSIA 4KUMA 1ZH5A 1MBKA 4EVIA 1O7FA 3B73A 5M3FJ 2R7TA 3WG9A 1W5TA 3FK6A 2A5WA 3E6CC 3KLOA 4JBAA 3R03A 4BY1J 2H1KA 3DTEA 4OAYA 2E34A 4ZZLA 1V8RA 2K02A 4RGSA 1U9NA 3G2BA 4E7LA 5D4RA 1JXSA 2LNBA 2KLOA 2QJOA 1U5TB 2CW8A 4PJMA 2EWNA 4BE0A 1W1WE 1Z21A 1R4MB 1E3HA 3HOYJ 5HODA 2OQGA 4RM3A 3L2UA 4UUTA 4GFBA 2BV6A 5D8KB 4CICA 4D9JA 1RRJA 2VBXA 3EPZA 1K79A 5FKKA 1KYWA 3F6AA 1EV7A 2M7AA 2WB1A 3WTTC 2HWVA 3A01B 4MFDA 1HW5A 2KL4A 3BQYA 2XGDA 4PSWA 1REPC 3F3XA 4S04A 2BW3B 5CVJA 1Q1HA 1R1VA 2K9LA 1JJ6C 1F4KA 5FKNA 3V7SA 3CJNA 4L9NA 5GTIC 2LY2A 2CQXA 3PUFA 4LMYA 1XS9A 5F6FA 3VB2A 5DTDA 1U20A 2GIVA 2K86A 3FX3A 1OYIA 2V7FA 3HHGA 1K83J 1P4AA 1Y56A 4G12A 2FVVA 3I59A 2OC6A 4EV0A 4B8XA 3PNVA 3VYTB 1ZKGA 5L3BA 2LREA 1RI7A 2K40A 5DUKA 3HTUA 4P9UA 4JZUA 1B6AA 2R7RA 4EJVA 2IBDA 3KEYA 5E1XA 5HS7A 5BQTA 4CCJA 1UB9A 2CS3A 5GHNA 1KQ9A 4JX5A 3ULQB 4JX6A 1AU7A 1R9TJ 2HXOA 2H6BA 2RKHA 2F4MB 2LMDA 3BY6A 3DU5A 1SAXA 1ZR4A 1VZ0A 2Y48A 3FJYA 2BYVE 1PUFA 5M3MJ 4BXXJ 3GLXA 4XSZF 1R00A 4Y13A 2L7ZA 2A8SA 2UUZA 3BP8A 5FB2A 3G73A 4A0ZA 1J2XA 2EIMH 4A3IJ 4ENMA 4UB8C 4HW0A 2Z2SB 3D1NI 3DUPA 3F8FA 2PQ8A 5ANTA 4XRSA 1F9NA 5ICFA 3S3OA 3F21A 4JK1X 2VUMJ 3I0TA 1S6LA 1T56A 4V19K 5E79C 3LAJA 5IP6A 2KT0A 3IV5A 4LK1F 1S7EA 1PUSA 2EQRA 3PJRA 4OIRF 3CUOA 3JRDA 4EGZA 3O6ZA 2QVOA 3HSFA 5GHJA 2CG4A 2OQRA 4BEHB 2IS1A 1H9TA 2BVMA 3GWZA 4P1WA 1VIQA 2RVCA 3BTLA 3CUQA 3X0SA 1WPKA 1W0TA 1K2EA 2KRFA 3WTWC 1QNTA 1T0FC 4BDZA 3FIWA 3FKJA 2W7NA 2DFIA 2EINH 1J0RA 2ACJA 2H09A 3X2QH 4ZG0A 2WY8Q 1LFPA 3GZNB 3CCLI 2KJCA 4NFWA 1QZEA 5M5YJ 1K7AA 1L0OC 2L7KA 2DFHA 1CF7B 2ZO4A 4JP0A 1V54H 3I58A 3JTHA 1NG6A 1YLFA 2MC3A 1FPQA 2LBFA 3QOPA 3FHNA 3M3YJ 4HBLA 3GTMJ 1DUXC 2DJNA 2VIXA 2E1MB 1I9AA 1V8TA 4RAGA 1BBYA 5DCMA 5FJ8J 3E3VA 1WKMA 4ESFA 3S2DJ 3CF5F 2WC2A 3G1LA 3NEUA 2Z33A 1FWZA 4RMNA 1LEBA 2IPQX 5LRRA 2AS5F 1GV5A 3DBHB 3R6SA 3E57A 4UB6C 3LAPA 3M8EA 4L9JA 1D3YA 3LSTA 3G1OA 3S2WA 2VXDA 5E1WA 2HTSA 3OIOA 5KCMA 3IWFA 2L5QA 4AC0A 3OYGA 4HNVA 3AG3H 1NHAA 3BG9A 3ELKA 5GP9A 2WWYA 2X51A 2O9LA 1A36A 1O7LA 3DKWA 1TWHJ 3M07A 1X1CA 2IS4A 4BDYA 1P4XA 2LH9A 2QSFX 3RPUA 3MVPA 3WTUC 4WXHA 2YVNA 5J4YA 1HA8A 1T33A 3F23A 4UUSB 2A61A 2D45A 2IT0A 1IDYA 2VBYA 2ZXWH 3R4KA 4BHBA 2R4GA 4ESJA 1Q27A 4XOPA 5K5QA 4AM3A 5C4JJ 4J19A 3AG4H 4HQEA 4PGHA 4XBFA 1BC8C 3TMOA 1R6RA 1TLHB 2CO5A 4PFOA 2IEKA 2QEXI 3Q5FA 4N9HA 3TOAA 1YRNA 1XX5A 2P7VB 4YEJA 2KDOA 3W3CA 5IT3A 3T5XA 2RV8A 1YFHA 4BACA 1IN8A 3DLAA 2B0VA 1UAAA 4KIGA 3HYIA 1T08B 4M3GA 5J47A 1VQLI 4YOQA 2XRLA 2W25A 2BOLA 5KHDA 3LSIA 2CQNA 1JHHA 2QGUA 4XQFA 4Y7NJ 5HLGA 2Q9PA 4C9XA 1STZA 4HX4A 5D5WB 1R36A 2AQFA 1BIBA 3Q2SA 3CCSI 1TNSA 1VF9A 4V2FA 4DYRA 2JJ7A 2XAGA 2B0LA 2GA2A 2DQRA 3BR1A 2VPLA 1HX3A 3GMEA 3X0OA 1SANA 2D1VA 3DEUA 2XIGA 4KICA 4D7MA 4II2A 1X4OA 1IUYA 1TL8A 1T6SA 2A6EF 3AC9A 4E7IA 2JTVA 4RGXA 5AONA 2G73A 2YUSA 1X3UA 2L7MP 2NOGA 2WV1A 1J09A 2V9VA 1U9OA 4AIJA 1N77A 4C2MJ 4PK4A 4ASNA 3CCJI 3HBLA 4IRGA 2FF4A 2JPBA 4A3BJ 1FNNA 2DK8A 1RR8C 1OR7A 3HG9A 2R3SA 2NS8A 2MW8A 4BQQA 2MGQA 3ACAA 2ICWG 4B43A 1LQ1A 5CFJA 2MD5A 5JR3A 1QVUA 4JYKA 2P6SA 1VQ5I 1S5LC 2KIUA 3ASOH 4FE4A 3P5TA 1U78A 2KMUA 4ANJA 1GLNA 2DYRH 4I98B 2NS0A 2FXAA 3DF8A 1S7OA 3V42A 3HUGB 2M5WA 3BOQA 1OFCX 1XC5A 1HOMA 4A6DA 1ON1A 2VBZA 1IGNA 5J8CA 1HKTA 5DV5A 3I55I 4XLAA 4XMYA 4MIMA 3FDYA 1V8YA 1Z1DA 3ERMA 4IZZA 1DU6A 4S2XA 2XGCA 3DLLF 4RLFA 2LC2A 3ABKH 4I0AA 3HL2A 1KHZA 2DMQA 3ASNH 5CVRA 2M4KA 2K4JA 3CCUI 3AKZA 2DK5A 2V26A 2DHOA 2HEOA 1XSXA 1MBFA 1RKTA 1BW5A 3ZQHA 1O57A 2EK5A 3KZYA 5CQEA 5HNFA 3IRQA 2ZNYA 1VI0A 2IGMA 1VQOI 1JI8A 2OUMA 2K7LA 3C3WA 3ONQA 4F52A 1MMAA 3R61A 2ZSIB 2BBYA 1Y39A 2L0KA 3HOXJ 3K4NA 3S3MA 4A3GJ 1HXDA 2X48A 3ECOA 5J8FA 2G7HA 1FTZA 4E6KG 1SD7A 3IAS2 2M9HA 1N25A 3FBIB 1LDDA 3I59B 1RRSA 4QPOA 1FEXA 3FISA 2VNPA 1SJYA 4G7OF 4Y15A 4U0YA 3ZR8X 2PQVA 2HNHA 4XL9A 3WHBA 2ZXIA 3WGHA 3D5RC 2EJRA 3CLQA 5DM7F 1BA5A 4S2VA 5LPGA 4K2EA 3Q2TA 1X51A 2CFXA 1FOWA 2E7XA 2FE3A 2GOMA 1QQIA 1AKHB 5LFAA 1B59A 4LLNA 5FSOA 5FKMA 1LDKB 5C7TA 4LG0B 2XAQA 4A12A 2PLYA 4IO9F 5CYVA 2Q8KA 3IKVA 3OYMA 1X1BA 3HOTA 4A3FJ 3P6YA 3WGIA 3OWTA 1F1ZA 3H5RA 2M0CA 3QP6A 2W1OA 2CV0A 3FMQA 2QWWA 1YJ9I 4OINF 4GCVA 1K4TA 1I6HJ 2F5EA 2R7WA 2RQPA 3H36A 2VOPA 1R23A 2QBYA 1XB4A 4ZZDA 1IJWC 4M3DA 1NG7A 2N8GA 2EPFA 4CXFA 3GYHX 4HSRA 1JTXA 4KT5C 2R5YB 1ZRDA 2VE8A 3P7NA 2R0QC 4YFXF 4BYYA 4UY8I 2D5VA 1SD5A 1HKSA 4U87A 2K3PA 5F64A 1GA7A 2EZIA 3SFIA 2GAUA 3ZQGA 2E2JJ 4PGGA 4ZH4F 1AHDP 3LMMA 5FSMA 1ON2A 2WAFA 3OOUA 4I2OA 1WRJA 2FU4A 3EXQA 4B1RA 3FMSA 5DEQA 5TGTA 3SFZA 4AUXA 1KT9A 4P96A 1TC3C 2GLOA 1V5EA 2MFZA 5HLTA 2XPUA 2IP2A 5ANVA 2LBFB 3D0SA 4ZDPA 2X1CA 4YG2F 1ZREA 5B5EC 4XIDA 2DO7A 1YOVB 2B2KA 3BZKA 2EB7A 4M3EA 1X84A 1FTTA 1SOIA 2EFQA 2NYXA 4LIVA 2PJPA 1VRLA 2Q2EA 3Q9SA 3QOEA 3TW6A 3TQNA 3JRCA 2L9NA 4ICKA 2HFHA 3LSMA 5C3EJ 2JA8J 2VKDA 3K0LA 2X0LA 3PUBA 3CCEI 5FO5A 4A3LJ 3EUHC 1I1GA 1MSEC 2JVGA 1BL0A 2FX0A 2ELKA 3MKZA 4XRFA 5FROA 1X3WB 2E1NA 4DW6A 2F48A 1MBJA 2EBIA 3P9IA 3K4BA 3GZ6A 3N4MA 1ZG3A 1SFOJ 4Q47A 2FMYA 2QJTA 2Y30A 2L4MA 5KVRA 2LOOA 3RZOJ 1Z6RA 3GLLA 3HOZJ 1FZPB 4BQAA 2LY9A 3E5UA 1R22A 3ABTA 2ZMEC 2E1OA 1FJLA 3HHJA 4XLNF 3LSGA 1MBGA 3SYTA 3CCYA 1ETVA 4G94A 4AIDA 5DDGA 2UXXA 4IEJA 3W2AA 2K85A 4U0VA 1KU7A 1WCMJ 2HPIA 3C2HA 4CCNA 2LDUA 1YRNB 3CP2A 4IQJA 2L7FP 3FSPA 1ENHA 3FK7A 2QCOA 1IV8A 5IY5H 1WJ5A
chains in the Genus database with same CATH topology
3E5QA 4G8XA 2O03A 1W4MA 2RNJA 1PUQA 4ETSA 3MZHA 1FSHA 1DPUA 4EJOA 1MQWA 2YVMA 1JGSA 2XUBA 4L9TA 3TO9A 3I4PA 3RI4A 1HKQA 5HLIA 4U88A 1IN6A 1KU9A 1XDUA 1JE8A 1IAWA 5K5RA 5ISYA 1QPMA 1SD6A 2HKXA 3M1EA 2FA5A 3CNGA 1K6OA 3SZPA 4CYDA 1G3TA 3WU0A 1O3TA 4L0ZB 1TQIA 3KFWX 5D5XB 4IHSA 3MZYA 1VIUA 2DSCA 3HIFA 1U5TC 5F1RA 5C8LA 1YW7A 1LEAA 1YW8A 3MWMA 1QZYA 2GXGA 3CTAA 1I27A 2A8TA 4I0BA 4Q48A 3WTZA 2W85A 2VT3A 4HX8A 4Y17A 5E1ZB 1ZGJA 3FXRA 5HLHA 3KP2A 3Q9VA 3FXUA 4G9YA 1GXPA 3SZTA 4EQQA 4K6EA 1FLIA 5FSKA 1MDMA 3U1DA 4HLYA 3P9KA 1P92A 3CDHA 3BWGA 4CO8A 5BPDA 3F8MA 4MPOA 5ANWA 3GG6A 1YG2A 1TTYA 3TDZC 1J9IA 1OYWA 2ICJA 1IXCA 4HFQA 3FF5A 1MR2A 4PCQA 1XSDA 5ERIA 1HW2A 2F5FA 3HRMA 4M74A 3H3UA 2FNPA 5CJ9A 1V8IA 3F13A 1I5ZA 1SMYF 1XGNA 3WODF 1EH8A 2P7CB 1PP8F 2NRAC 4M9SA 4UUVA 4D0PA 2GQQA 4MEYF 1FP1D 5IT9K 2P4WA 2QM3A 1OKRA 3W6JB 2QBYB 3MCFA 4WXDA 4KA4A 1JKNA 2P5VA 1V8SA 5HVQC 6PAXA 1IRGA 1W5SA 1GHCA 1YYVA 1Z6TA 4I01A 1MJ9A 2WV0A 3M7GA 3K1MA 2DQLA 4NB5A 2COMA 5BMZA 1D8KA 5DUIA 1RUNA 4MEXF 1CGPA 2ZXJA 1ZRCA 5LHIA 4YPRA 4EJWA 3HHHA 3TO6A 5GHIA 3WTXC 5L3FA 4ENJA 2GWRA 2KIFA 2PG4A 4FX0A 3C7JA 4KYXA 2MLKA 2C6YA 4E70A 3L85A 4IHTA 3COUA 2XRNA 3IWZA 2O5WA 4ENNA 5HZXA 3C18A 2YX7A 4KTBA 3F6VA 2W57A 1OW2A 3OV8A 3V8LA 5LGUA 4HV6A 5E18F 2HR3A 4OOIA 3T8RA 2HYGD 3RKYA 2FEZA 4MTEA 3H3ZA 1USSA 1QBJA 5BONA 4UVBA 4F7ZA 2VODA 3V8KA 2QQ9A 3ZMZA 4KDPA 3ZMUA 1MK1A 4AIHA 4MQVA 3T8TA 4KMUX 1T2KA 2A8RA 4WWCA 1FP2A 1FY7A 5CLSA 3WE2A 3JSPA 1IZ1A 4HF1A 4OMZA 2A8QA 3K9TA 3ID9A 4RB0A 5E20A 2QQAA 5D8LB 2DPUA 2RRKA 3U2RA 1XSAA 2ZKZA 3MGMA 4MHGA 4HLXA 2Q0OA 4NHJA 5DYMA 2O6GE 1ZAOA 1Z7UA 2DAOA 3A6SA 1F5TA 2BGCA 2FBIA 2E7WA 4P55A 3EYIA 2W4EA 2YPRA 3ZR0A 2A68F 3EF5A 2EFNA 3BDDA 1Z05A 2Z3YA 2JRTA 3RYRA 1BI1A 1HQCA 3HRUA 4G6DA 1T39A 3HTSB 2P6TA 2RC4A 4ZYEA 4PDKA 5IW4A 1G9QA 3K69A 2AXLA 4QLCU 5K5OA 4OIQF 1VC9A 4JZSA 1ZLJA 5D5VB 4UVCA 3W6KB 2G9WA 2IRFG 3ZQ7A 4KG4A 5FSNA 1J75A 2XAFA 3D5LA 2Y75A 1QGPA 5D5UB 3JAMZ 3GUDA 2HTJA 2YVPA 4YIIA 3GRNA 2V1DA 4HF2A 3F8BA 5HOOA 1MD0A 4M9XA 2I8TA 3A6TA 4HAMA 4A5NA 2H27A 5DD4A 5CVVA 3HSEA 1AOYA 3C1DA 4UXNA 1MDMB 5L3GA 2VONA 1NFZA 2XVCA 2EA4A 1U2WA 3EUHA 2ELHA 1AWCA 3ZPLA 2PNYA 3SQNA 3RPQA 3R60A 4OIPF 3GX4X 3HOSA 3EDPA 4Z2YA 2STWA 4IXAA 5ICEA 2B06A 5L3EA 3SXYA 4L5IA 3K1PA 3VOEA 2LSOA 4Q5SF 3L00A 2J5OA 2Z5UA 1PDNC 1RYAA 1KQ8A 1B1BA 5LGTA 4LLGF 4KNYA 2A6TA 1USTA 5IW5A 4P9FA 5A2QZ 2P5LC 1LJ9A 1MZBA 1IXRC 1GVJA 4G6QA 1DPRA 4P5OA 3BJOA 1I6XA 4MQ9F 5L3DA 1ZN2A 1EH7A 3KP3A 3BJAA 5IT9Z 4KMFA 1DP7P 4HZFA 3RTRA 2NNNA 2L3DA 3QPTA 3AAFA 5HDNA 3BPVA 2J8QA 4NQWA 2M30A 4UHTA 3QRFF 1ZG1A 2M87A 3ZMTA 4LB5A 5CVIA 3T0YA 3EEUA 3I9XA 1C0WA 2YR2A 2DSDA 2R7FA 1OPCA 1IN5A 2V1UA 2DW4A 1YQAA 3WTYC 5JI6A 4WK8F 3GXOA 2A6HF 4XSXF 3BAPA 3GF2A 3F8NA 2J5PA 3HRTA 3A6VA 4GYIA 1U5TA 2EFWA 4EJUA 3MCZA 1D5VA 2XKOA 5E8IA 5ED4A 1U3EM 2GZWA 1ONVA 3F6OA 3L9FA 2QQBA 4G7HF 3P9CA 3CUQB 3WGGA 2HQRA 2KDVA 1XGOA 1X83A 3ISPA 1V8MA 4GYGA 4IJXA 1V8VA 1LNWA 1RNLA 1ULYA 3IC7A 1V3FA 3LQRA 1FC3A 1PPWA 1VCDA 3TGNA 1RUOA 1KGSA 1P2FA 3I5UA 3N77A 5DCMB 1LVAA 4HVYA 2JPCA 3EYYA 5J6XA 2K27A 2CWEA 2F2EA 2P5KA 4DYWA 4MNUA 5H20A 4L5JA 4IVNA 3VFZA 3HRSA 2V79A 1Z91A 4RS8A 5E8GA 3GFMA 4J7GA 2O0YA 4EGYA 2QKMB 3GO5A 3DV8A 4Q4ZF 2HZTA 3DP7A 1V4RA 2PI0A 3CLOA 5D4SA 2ZBKA 4BXUA 3IKTA 4IPAA 3Q93A 1ZHFA 1FSEA 2A69F 2QUFA 2Y0MA 2HYFA 1XMKA 3Q4IA 2H6CA 5ANUA 3IRRA 2EV0A 1FYLA 4JZVA 3RYPA 4HA8A 5H6RA 3BJ6A 1G3SA 4N1UA 1VTNC 1W7PA 3O52A 2IA0A 1TNTA 3GFLA 4HQMA 1VHGA 3G3ZA 3ML6A 4M72A 2OBPA 3ERED 1T38A 2DTRA 1PVFA 1OMIA 2P8TA 2RDPA 2L01A 3WU1B 3J80Z 2MH9A 1J7KA 4B09A 4EM2A 3QPHA 1BIAA 1V8NA 4A2UA 3OOPA 4DQ2A 4WX9A 1YS6A 3VEPA 2DBBA 3JSOA 2LF7A 2O3FA 4CDGA 2ZNZA 1YW9A 5ICGA 3O61A 3FFUA 2OZ6A 2CQKA 3MEXA 5DD8A 1RZ4A 3ZR1A 1IRYA 4RAZA 1IF1A 3FZVA 4L0YB 3Q91A 2BE5F 3Q1PA 1T0FA 3NQOA 4KFCA 1SFEA 4KIBA 1RRQA 1SFXA 2HS5A 2ISZA 2AZWA 2F5DA 1XCBA 4HDVA 1XCVA 3KP7A 1WSUA 1PP7U 3T1BA 3U9GA 3JAMK 2STTA 4FX4A 1KTGA 3TDUC 1D8JA 1VC8A 2DI3A 4ESBA 2GB5A 4OIOF 2O61A 2FMLA 5LRSA 3SONA 2FSWA 4TV7A 1V8WA 4JZTA 1BI2A 1MJBA 4U7DA 1TBXA 3X0PA 2CGPA 2I6KA 1OYYA 4BH9A 3J7Ye 3LA7A 3I64A 3FMRA 3COAC 2UWMA 4MGRA 1XSCA 4U0WA 1Y0UA 2DU9A 2VT2A 3PFIA 3V7RA 5HDKA 3X0MA 4EJTA 2FOKA 5TJJA 2H94A 1G6NA 4RGRA 1G3WA 2IW5A 3HYQA 3RH7A 2R7DA 5A2QK 4ILQA 3X0KA 3HUGA 1HZTA 4V14A 2A07F 2LKPA 1ZLKA 3J7AO 3KE2A 3RIRA 4M6XA 2FBKA 4N9IA 3E6MA 1UHWA 2W84A 4A6EA 2M45A 2FQ3A 4GO1A 3ZP5A 3IHUA 2V1XA 4RGUA 3ROUA 1BM9A 2ESNA 1LB2A 5HS8A 2V6CA 1PUEE 5TRDA 1R1UA 3O8SA 3R0AA 2ZJ2A 2VC1A 3WHWA 1HSTA 1W7PD 5FLXK 1J5YA 3FCMA 1IW7F 4UV9A 3SHFA 1K78A 2OAZA 3DFGA 3U53A 4KN7X 5LLQA 3X0RA 3SMDA 2KKOA 3H95A 3LA2A 5ILVA 1XSBA 3M8FA 2VN2A 2D1HA 3DPLC 3LFKA 2L02A 2PMHA 5E17F 5FSMA 2ZCWA 2O5FA 3BROA 3KLNA 4DNCA 2PBIA 1IXSB 5AIPA 1TUMA 1V8LA 2FRHA 1E2XA 4LG0A 3ZMSA 3IL2A 1KU3A 3ABUA 3L2CA 5FGMA 4U7BA 5BS6A 3KP4A 3G0QA 4LB6B 3J81K 1F3YA 2YSRA 4S2YA 1KU2A 3OGAA 1ZGAA 2NNYA 4HF0A 3JTGA 2M1BA 5ANSA 3TOBA 4KYWA 4UVAA 3RDIA 2OZUA 2XKPA 4FT8A 3KEOA 1IRFA 4LK0F 3GZ5A 4LFUA 2YX4A 1WQ2A 1QO0D 3V8JA 3WTSC 1NQYA 1B9MA 3X0LA 4IF4A 3REOA 1BOAA 1R5GA 2EV6A 4N0BA 5LEJA 1W7PB 2L4AA 4O3MA 1YO5C 2LF8A 2Z99A 2QYOA 2KIMA 1XGSA 2EFOA 3E6BA 1TW2A 4KN4X 1SU2A 1SMTA 3QP5A 1O3QA 3K1NA 2L54A 2W24A 2DLLA 3E6DA 4LGWA 1PUNA 3EETA 4A0YA 1NQZA 3EQLF 2VBWA 4IRHA 3ZMVA 2EV5A 1R67A 1R58A 3GVAA 1VK6A 1O3RA 2GXBA 2OD5A 1FOKA 2G74A 3CO7C 3FM3A 3O2PE 4M6YA 5L3CA 5D6EA 4EM1A 4O6JA 1KQ0A 4R79A 2IJLA 5KK1A 3TO7A 1Q54A 2YU3A 4ZYDA 3N97A 3J80K 3H92A 1FBUA 4CZZA 1FX7A 3QU6A 4HYEA 3CO6C 2A8PA 2GT4A 3PQJA 1PPVA 2KJBA 4LLLA 4LJZF 2XASA 3RKXA 1K26A 1L3LA 2UXNA 2Z9OA 4JQFA 4RB1A 5LHGA 3FXQA 2I8UA 3I7VA 3ZN1A 5LBQA 4BHPA 1I1SA 3FHZA 1S29A 4I09A 5LEKA 1MP2A 2DUKA 1G0SA 2CL3A 1BJAA 5GHPA 2A5YB 3QAHA 5ILSA 2GT2A 1G4DA 4GXOA 3KEQA 3E97A 3I54A 2JSCA 3ECHA 2MLGA 3NRVA 5DPKA 3A6UA 1SD4A 4KIFA 4A5MA 2ZMEA 1TQPA 1XSVA 2OA4A 2D2WA 1EH6A 2UZKA 5FD5A 1S7AA 1S3JA 3RJPA 1FT9A 1DDNA 3GWYA 3DPTA 1BC7C 1MKMA 5K1YA 1G3YA 4BHCA 1T98A 2HKOA 1YS7A 3MDGA 2XSQA 5CVUA 3CUQC 5CFIA 2YYHA 1KYZA 1TW3A 4OU0A 5GHMA 2ESHA 3HSRA 1KA8A 3O6BB 2ICKA 4L9VA 3WTVC 2DPDA 1R1TA 4BNCA 1VHZA 1V8UA 5LHHA 3I71A 4N1TA 3GFIA 4NFXA 4ZYGA 1NFSA 3DQVC 1H9GA 1TQMA 3JW4A 4I7HA 2IA1A 1P4WA 5JHUA 5FLXZ 2QZ8A 1ZRFA 2RGVA 1K78B 3LA3A 3MQ0A 5ILUA 2VOOA 3F72A 3L09A 3TKYA 1B4AA 1YTYA 1XGMA 1HSJA 1MJAA 3GW2A 5HDGA 4CGZA 3BHOA 4H0EA 2ADUA 1XMAA 3GFJA 2XAHA 5FSLA 1B9NA 2FBHA 4M71A 1XN7A 2JZYA 2ETHA 1IN7A 3I7UA 4S05A 3J81Z 1FBSA 5H6QA 4UNOA 1SZ3A 2M8EA 4ON0A 3E5XA 4ZYHA 3FM5A 1SFUA 3I53A 1BI3A 4YIFA 2K4BA 3X0JA 2HOEA 2QENA 3O3KA 1R5HA 2HGCA 4HV5A 4QWQA 1E17A 2CW0F 3M9AA 4HX7A 4CHUA 2X4HA 4PZJA 4WF2A 4KG3A 5FD6A 2E1CA 3K2ZA 4EM0B 5GHOA 3N9UA 2MBFA 1S8NA 2CYYA 2PEXA 1A04A 5AIQA 3MAJA 4I02A 2PFBA 1YIOA 1FYKA 3EESA 4RAYA 1JHFA 2TDXA 4YPHA 3V4GA 2EFPA 2G7UA 4GGGA 3MDIA 1JRKA 1UCRA 5EEHA 5I8UA 4AD9A 1RIOH 4RB2C 2CZRA 2HDCA 1MGTA 3QSJA 3DXJF 1LDJA 2EA2A 2WTEA 1P6RA 2O8XA 2FKBA 1UFMA 3KVHA 4J7HA 2VC0A 1IN4A 2JVBA 1XDSA 4AWXB 1CF7A 4IRIA 3GZ8A 1WWXA 5C7QA 1HBXG 3O69A 4FHTA 4MTDA 1Z9CA 4EMSA 1ODDA 2MH2A 4M9ZA 1H0MA 3X0IA 4BAYA 1O3SA 3GEZA 1ZYRF 4RB3C 2CSOA 3LWFA 1J59A 1U6GA 3DKUA 3X0NA 2QLZA 2R5WA 4IJAA 1QVJA 2VE9A 1MUTA 3BZ6A 2XHKA 2ZFWA 3SHDA 4UV8A 2XROA 4M73A 3BPXA 3LQQA 3KETA 1ZG5A 5DCFA 4S2WA 3FWEA 2XAJA 4LD5A 3BM4A 2XGXA 4C9WA 5ICCA 2ISYA 1HW1A 5LGNA 2A3SA 1U8RA 4AIKA 1MQEA 2IA2A 3KP6A 3WE3A 3RKWA 2DT5A 3FK9A 4R1HA 3VODA 3V7CA 3F8CA 2IVMA 1BI0A 1FYMA 5FFXA 3L7WA 2ZMEB 3ZN0A 2PN6A 2O1CA 4L18B 3R0JA 1UHMA 2VXZA 4AVPA 4R8HA 4ENKA 4O5VA 2VNQA 1Q33A 5JVTA 4YFKF 4HOBA 1BN5A 5D6FA 4WXCA 2BEOA 5GHQA 2OU2A 1WI9A 5EEGA 4WCGA 4XLPF 1FBQA 2PMUA 1R7JA 3PQKA 4YFNF 3KP5A 3KZZA 5BPIA 5BOXA 2F5CA 1ZARA 3X0QA 3QU3A 3ZMDA 1QZZA 2JT1A 2RN7A 2HQNA 5FFZA 2MA3A 4OMYA 1XD7A 3KCCA 3B02A 2YVOA 4A0XA 3F22A 2FNAA 2KDWA 2XV4S 5HS9A 2GA1A 2NAZA 1GXQA 3MFKA 4HDUA 1PPXA 2DSBA 5JFRA 4G7ZF 5FSIA 4KUMA 1ZH5A 4EVIA 1O7FA 3B73A 3WG9A 1W5TA 3E6CC 3KLOA 4JBAA 3R03A 1V8RA 4ZZLA 2K02A 4RGSA 5D4RA 1JXSA 2LNBA 2QJOA 1U5TB 2EWNA 2OQGA 2BV6A 5D8KB 4CICA 2VBXA 1K79A 1KYWA 3F6AA 1EV7A 3WTTC 2HWVA 1HW5A 1REPC 3F3XA 4S04A 5CVJA 1Q1HA 1R1VA 1F4KA 3V7SA 3CJNA 4L9NA 4LMYA 5F6FA 3VB2A 1U20A 2GIVA 2K86A 3FX3A 1OYIA 3HHGA 1P4AA 2FVVA 3I59A 4EV0A 4B8XA 5L3BA 1RI7A 5DUKA 3HTUA 4P9UA 4JZUA 1B6AA 4EJVA 5E1XA 5HS7A 5BQTA 1UB9A 5GHNA 1KQ9A 3ULQB 2H6BA 2RKHA 3BY6A 1SAXA 2Y48A 3FJYA 2BYVE 3GLXA 4XSZF 1R00A 4Y13A 2A8SA 3BP8A 5FB2A 3G73A 4A0ZA 1J2XA 4ENMA 4HW0A 3DUPA 3F8FA 2PQ8A 5ANTA 1F9NA 5ICFA 3F21A 4JK1X 3I0TA 1S6LA 3LAJA 4LK1F 1PUSA 4OIRF 3CUOA 4EGZA 3O6ZA 2QVOA 3HSFA 5GHJA 2CG4A 2OQRA 1H9TA 3GWZA 1VIQA 2RVCA 3CUQA 3X0SA 1K2EA 2KRFA