4IJXA

Crystal structure of human ap4a hydrolase e58a mutant complexed with dpo
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
147
structure length
147
Chain Sequence
RACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRATQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEALEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
publication title Crystal structure of wild-type and mutant human Ap4A hydrolase.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature ec 3.6.1.17: Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical).
pdb deposition date 2012-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 4ijxA00
3O52A 5GHIA 3AC9A 3SMDA 1MK1A 1VIUA 3BHOA 4KG3A 1JKNA 2I8UA 1U20A 4K6EA 2I8TA 3U53A 5FSNA 2RRKA 3ZR1A 1MQWA 1G9QA 2A8TA 5ISYA 4YOQA 1KHZA 3MCFA 1JRKA 2J8QA 2A8PA 5DPKA 1Q54A 3O69A 1Q27A 1PUNA 2R5WA 2VNQA 2DSCA 3I7UA 3KVHA 3DKUA 2GT4A 3OGAA 5GHNA 4C9WA 5IW4A 3Q4IA 3X0MA 5ANTA 5C8LA 3A6VA 3DUPA 1V8TA 2A8RA 2B0VA 2CL3A 3RH7A 2QKMB 2YVMA 1XSCA 3BAPA 2JVBA 1G0SA 4ICKA 1V8VA 5FSKA 4KG4A 3A6SA 1R67A 3X0LA 1VK6A 4V14A 5ANVA 1OW2A 1K26A 2I6KA 2GB5A 3L85A 1GA7A 1VC8A 3Q91A 3X0SA 3X0PA 4YPHA 5DDGA 1HZTA 1VCDA 2PNYA 3GZ5A 3GWYA 4ILQA 5GHOA 5BONA 3MDIA 1V8WA 2A8SA 3A6UA 2ICJA 4JZTA 1I9AA 1XSBA 1X84A 2A6TA 4MPOA 1V8LA 4JZUA 2ICKA 4YPRA 3J7Ye 2GT2A 4ZG0A 1PUSA 1V8IA 2YVOA 3FFUA 1PVFA 4NFXA 1V8RA 5DD4A 3SHDA 1X83A 4DYWA 3HHJA 2A8QA 3QSJA 5C7TA 5DEQA 2DUKA 3I7VA 3X0RA 3X0JA 3BM4A 2B06A 1MUTA 3HYQA 1F3YA 5ANWA 3P6YA 3A6TA 2YYHA 4NFWA 2B2KA 3X0QA 2KDWA 2VNPA 3F6AA 1SU2A 3EF5A 3I9XA 3MGMA 3R03A 5ANUA 2YVNA 5HZXA 3G0QA 3O8SA 4S2WA 3O6ZA 5I8UA 1RRQA 3FJYA 1RYAA 5CFIA 2FMLA 3EXQA 2KDVA 5C7QA 3Q2TA 1MQEA 1PPXA 1V8YA 3ID9A 3N9UA 1NFSA 4HFQA 3MDGA 3F13A 2XSQA 5FSLA 3FCMA 3SONA 1QVJA 3COUA 3GZ6A 1Q33A 3GRNA 3O61A 2G73A 2QJOA 2YVPA 2DSBA 3H95A 5FSIA 5BS6A 1PPWA 5FSMA 5GHPA 4IJXA 3FSPA 1V8MA 1KT9A 3P5TA 3Q1PA 3Q2SA 1MR2A 1PPVA 3ZR0A 4C9XA 3X0NA 2AZWA 1NFZA 2PQVA 4JZSA 4KTBA 4S2XA 1VRLA 3X0OA 5FSOA 3X0KA 1XSAA 1V8NA 1NQZA 3X0IA 1VIQA 2O5FA 2W4EA 1VHGA 4KYXA 1SJYA 1X51A 2O5WA 3ACAA 4S2YA 2FKBA 4JZVA 3E57A 1IRYA 5GHMA 1VHZA 2Q9PA 3FK9A 1TUMA 1V8UA 3GZ8A 2DHOA 5CFJA 3CNGA 1SZ3A 3N77A 3EEUA 5LPGA 2QJTA 4HVYA 1VC9A 1V8SA 3GG6A 4N1UA 4S2VA 1NQYA 5IW5A 1PUQA 2DSDA 2G74A 3EESA 3WHWA 4N1TA 2FVVA 2O1CA 5GHQA 5GHJA 1RRSA 1HX3A 1K2EA 1KTGA 5ANSA 3Q93A 1SOIA 1MP2A
chains in the Genus database with same CATH superfamily
3O52A 5GHIA 3AC9A 3SMDA 1MK1A 1VIUA 3BHOA 4KG3A 1JKNA 2I8UA 1U20A 4K6EA 2I8TA 3U53A 5FSNA 2RRKA 3ZR1A 1MQWA 1G9QA 2A8TA 5ISYA 4YOQA 1KHZA 3MCFA 1JRKA 2J8QA 2A8PA 5DPKA 1Q54A 3O69A 1Q27A 1PUNA 2R5WA 2VNQA 2DSCA 3I7UA 3KVHA 3DKUA 4J7GA 2GT4A 3OGAA 5GHNA 4C9WA 5IW4A 3Q4IA 3X0MA 5ANTA 5C8LA 3A6VA 3DUPA 1V8TA 2A8RA 2B0VA 2CL3A 3RH7A 2QKMB 2YVMA 1XSCA 3BAPA 2JVBA 1G0SA 4ICKA 1V8VA 5FSKA 4KG4A 3A6SA 1R67A 3X0LA 1VK6A 4V14A 5ANVA 1OW2A 1K26A 2I6KA 2GB5A 3L85A 1GA7A 1VC8A 3Q91A 3X0SA 3X0PA 4YPHA 5DDGA 1HZTA 1VCDA 2PNYA 3GZ5A 3GWYA 4ILQA 5GHOA 5BONA 3MDIA 1V8WA 2A8SA 3A6UA 2ICJA 4JZTA 1I9AA 1XSBA 1X84A 2A6TA 4MPOA 1V8LA 4JZUA 2ICKA 4YPRA 3J7Ye 2GT2A 4ZG0A 1PUSA 1V8IA 2YVOA 3FFUA 1PVFA 4NFXA 1V8RA 5DD4A 3SHDA 1X83A 4DYWA 3HHJA 2A8QA 3QSJA 5C7TA 5DEQA 2DUKA 3I7VA 3X0RA 3X0JA 3BM4A 2B06A 1MUTA 3HYQA 1F3YA 5ANWA 3P6YA 3A6TA 2YYHA 4NFWA 2B2KA 3X0QA 2KDWA 2VNPA 3F6AA 1SU2A 3EF5A 3I9XA 3MGMA 3R03A 5ANUA 2YVNA 2CZRA 5HZXA 3G0QA 3O8SA 4S2WA 3O6ZA 5I8UA 1RRQA 3FJYA 1RYAA 5CFIA 2FMLA 3EXQA 2KDVA 5C7QA 3Q2TA 1MQEA 1PPXA 1V8YA 3ID9A 3N9UA 1NFSA 4HFQA 3MDGA 3F13A 2XSQA 5FSLA 3FCMA 3SONA 1QVJA 3COUA 3GZ6A 1Q33A 3GRNA 3O61A 2G73A 2QJOA 2YVPA 2DSBA 3H95A 5FSIA 5BS6A 1PPWA 5FSMA 5GHPA 4IJXA 3FSPA 1V8MA 1KT9A 3P5TA 3Q1PA 3Q2SA 1MR2A 1PPVA 3ZR0A 4C9XA 3X0NA 2AZWA 1NFZA 2PQVA 4JZSA 4KTBA 4S2XA 1VRLA 3X0OA 5FSOA 3X0KA 1XSAA 1V8NA 1NQZA 3X0IA 1VIQA 2O5FA 2W4EA 1VHGA 4KYXA 1SJYA 1X51A 2O5WA 3ACAA 4J7HA 2FKBA 4S2YA 3E57A 4JZVA 1IRYA 5GHMA 1VHZA 2Q9PA 3FK9A 1TUMA 1V8UA 3GZ8A 2DHOA 5CFJA 3CNGA 1SZ3A 3N77A 3EEUA 5LPGA 2QJTA 4HVYA 1VC9A 1V8SA 3GG6A 4N1UA 4S2VA 1NQYA 5IW5A 1PUQA 2DSDA 2G74A 3EESA 3WHWA 4N1TA 2FVVA 2O1CA 5GHQA 5GHJA 1RRSA 1HX3A 1K2EA 1KTGA 5ANSA 3Q93A 1SOIA 1MP2A
chains in the Genus database with same CATH topology
3O52A 5GHIA 3AC9A 3SMDA 1MK1A 1VIUA 3BHOA 4KG3A 1JKNA 2I8UA 1U20A 4K6EA 2I8TA 3U53A 5FSNA 2RRKA 3ZR1A 1MQWA 1G9QA 2A8TA 5ISYA 4YOQA 1KHZA 3MCFA 1JRKA 2J8QA 2A8PA 5DPKA 1Q54A 3O69A 1Q27A 1PUNA 2R5WA 2VNQA 2DSCA 3I7UA 3KVHA 3DKUA 4J7GA 2GT4A 3OGAA 5GHNA 4C9WA 5IW4A 3Q4IA 3X0MA 5ANTA 5C8LA 3A6VA 3DUPA 1V8TA 2A8RA 2B0VA 2CL3A 3RH7A 2QKMB 2YVMA 1XSCA 3BAPA 2JVBA 1G0SA 4ICKA 1V8VA 5FSKA 4KG4A 3A6SA 1R67A 3X0LA 1VK6A 4V14A 5ANVA 1OW2A 1K26A 2I6KA 2GB5A 3L85A 1GA7A 1VC8A 3Q91A 3X0SA 3X0PA 4YPHA 5DDGA 1HZTA 1VCDA 2PNYA 3GZ5A 3GWYA 4ILQA 5GHOA 5BONA 3MDIA 1V8WA 2A8SA 3A6UA 2ICJA 4JZTA 1I9AA 1XSBA 1X84A 2A6TA 4MPOA 1V8LA 4JZUA 2ICKA 4YPRA 3J7Ye 2GT2A 4ZG0A 1PUSA 1V8IA 2YVOA 3FFUA 1PVFA 4NFXA 1V8RA 5DD4A 3SHDA 1X83A 4DYWA 3HHJA 2A8QA 3QSJA 5C7TA 5DEQA 2DUKA 3I7VA 3X0RA 3X0JA 3BM4A 2B06A 1MUTA 3HYQA 1F3YA 5ANWA 3P6YA 3A6TA 2YYHA 4NFWA 2B2KA 3X0QA 2KDWA 2VNPA 3F6AA 1SU2A 3EF5A 3I9XA 3MGMA 3R03A 5ANUA 2YVNA 2CZRA 5HZXA 3G0QA 3O8SA 4S2WA 3O6ZA 5I8UA 1RRQA 3FJYA 1RYAA 5CFIA 2FMLA 3EXQA 2KDVA 5C7QA 3Q2TA 1MQEA 1PPXA 1V8YA 3ID9A 3N9UA 1NFSA 4HFQA 3MDGA 3F13A 2XSQA 5FSLA 3FCMA 3SONA 1QVJA 3COUA 3GZ6A 1Q33A 3GRNA 3O61A 2G73A 2QJOA 2YVPA 2DSBA 3H95A 5FSIA 5BS6A 1PPWA 5FSMA 5GHPA 4IJXA 3FSPA 1V8MA 1KT9A 3P5TA 3Q1PA 3Q2SA 1MR2A 1PPVA 3ZR0A 4C9XA 3X0NA 2AZWA 1NFZA 2PQVA 4JZSA 4KTBA 4S2XA 1VRLA 3X0OA 5FSOA 3X0KA 1XSAA 1V8NA 1NQZA 3X0IA 1VIQA 2O5FA 2W4EA 1VHGA 4KYXA 1SJYA 1X51A 2O5WA 3ACAA 4J7HA 2FKBA 4S2YA 3E57A 4JZVA 1IRYA 5GHMA 1VHZA 2Q9PA 3FK9A 1TUMA 1V8UA 3GZ8A 2DHOA 5CFJA 3CNGA 1SZ3A 3N77A 3EEUA 5LPGA 2QJTA 4HVYA 1VC9A 1V8SA 3GG6A 4N1UA 4S2VA 1NQYA 5IW5A 1PUQA 2DSDA 2G74A 3EESA 3WHWA 4N1TA 2FVVA 2O1CA 5GHQA 5GHJA 1RRSA 1HX3A 1K2EA 1KTGA 5ANSA 3Q93A 1SOIA 1MP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O52 A;  5GHI A;  3AC9 A;  3SMD A;  1MK1 A;  1VIU A;  3BHO A;  4KG3 A;  1JKN A;  2I8U A;  1U20 A;  4K6E A;  2I8T A;  3U53 A;  5FSN A;  2RRK A;  3ZR1 A;  1MQW A;  1G9Q A;  2A8T A;  5ISY A;  4YOQ A;  1KHZ A;  3MCF A;  1JRK A;  2J8Q A;  2A8P A;  5DPK A;  1Q54 A;  3O69 A;  1Q27 A;  1PUN A;  2R5W A;  2VNQ A;  2DSC A;  3I7U A;  3KVH A;  3DKU A;  2GT4 A;  3OGA A;  5GHN A;  4C9W A;  5IW4 A;  3Q4I A;  3X0M A;  5ANT A;  5C8L A;  3A6V A;  3DUP A;  1V8T A;  2A8R A;  2B0V A;  2CL3 A;  3RH7 A;  2QKM B;  2YVM A;  1XSC A;  3BAP A;  2JVB A;  1G0S A;  4ICK A;  1V8V A;  5FSK A;  4KG4 A;  3A6S A;  1R67 A;  3X0L A;  1VK6 A;  4V14 A;  5ANV A;  1OW2 A;  1K26 A;  2I6K A;  2GB5 A;  3L85 A;  1GA7 A;  1VC8 A;  3Q91 A;  3X0S A;  3X0P A;  4YPH A;  5DDG A;  1HZT A;  1VCD A;  2PNY A;  3GZ5 A;  3GWY A;  4ILQ A;  5GHO A;  5BON A;  3MDI A;  1V8W A;  2A8S A;  3A6U A;  2ICJ A;  4JZT A;  1I9A A;  1XSB A;  1X84 A;  2A6T A;  4MPO A;  1V8L A;  4JZU A;  2ICK A;  4YPR A;  3J7Y e;  2GT2 A;  4ZG0 A;  1PUS A;  1V8I A;  2YVO A;  3FFU A;  1PVF A;  4NFX A;  1V8R A;  5DD4 A;  3SHD A;  1X83 A;  4DYW A;  3HHJ A;  2A8Q A;  3QSJ A;  5C7T A;  5DEQ A;  2DUK A;  3I7V A;  3X0R A;  3X0J A;  3BM4 A;  2B06 A;  1MUT A;  3HYQ A;  1F3Y A;  5ANW A;  3P6Y A;  3A6T A;  2YYH A;  4NFW A;  2B2K A;  3X0Q A;  2KDW A;  2VNP A;  3F6A A;  1SU2 A;  3EF5 A;  3I9X A;  3MGM A;  3R03 A;  5ANU A;  2YVN A;  5HZX A;  3G0Q A;  3O8S A;  4S2W A;  3O6Z A;  5I8U A;  1RRQ A;  3FJY A;  1RYA A;  5CFI A;  2FML A;  3EXQ A;  2KDV A;  5C7Q A;  3Q2T A;  1MQE A;  1PPX A;  1V8Y A;  3ID9 A;  3N9U A;  1NFS A;  4HFQ A;  3MDG A;  3F13 A;  2XSQ A;  5FSL A;  3FCM A;  3SON A;  1QVJ A;  3COU A;  3GZ6 A;  1Q33 A;  3GRN A;  3O61 A;  2G73 A;  2QJO A;  2YVP A;  2DSB A;  3H95 A;  5FSI A;  5BS6 A;  1PPW A;  5FSM A;  5GHP A;  4IJX A;  3FSP A;  1V8M A;  1KT9 A;  3P5T A;  3Q1P A;  3Q2S A;  1MR2 A;  1PPV A;  3ZR0 A;  4C9X A;  3X0N A;  2AZW A;  1NFZ A;  2PQV A;  4JZS A;  4KTB A;  4S2X A;  1VRL A;  3X0O A;  5FSO A;  3X0K A;  1XSA A;  1V8N A;  1NQZ A;  3X0I A;  1VIQ A;  2O5F A;  2W4E A;  1VHG A;  4KYX A;  1SJY A;  1X51 A;  2O5W A;  3ACA A;  4S2Y A;  2FKB A;  4JZV A;  3E57 A;  1IRY A;  5GHM A;  1VHZ A;  2Q9P A;  3FK9 A;  1TUM A;  1V8U A;  3GZ8 A;  2DHO A;  5CFJ A;  3CNG A;  1SZ3 A;  3N77 A;  3EEU A;  5LPG A;  2QJT A;  4HVY A;  1VC9 A;  1V8S A;  3GG6 A;  4N1U A;  4S2V A;  1NQY A;  5IW5 A;  1PUQ A;  2DSD A;  2G74 A;  3EES A;  3WHW A;  4N1T A;  2FVV A;  2O1C A;  5GHQ A;  5GHJ A;  1RRS A;  1HX3 A;  1K2E A;  1KTG A;  5ANS A;  3Q93 A;  1SOI A;  1MP2 A; 
#chains in the Genus database with same CATH topology
 3O52 A;  5GHI A;  3AC9 A;  3SMD A;  1MK1 A;  1VIU A;  3BHO A;  4KG3 A;  1JKN A;  2I8U A;  1U20 A;  4K6E A;  2I8T A;  3U53 A;  5FSN A;  2RRK A;  3ZR1 A;  1MQW A;  1G9Q A;  2A8T A;  5ISY A;  4YOQ A;  1KHZ A;  3MCF A;  1JRK A;  2J8Q A;  2A8P A;  5DPK A;  1Q54 A;  3O69 A;  1Q27 A;  1PUN A;  2R5W A;  2VNQ A;  2DSC A;  3I7U A;  3KVH A;  3DKU A;  4J7G A;  2GT4 A;  3OGA A;  5GHN A;  4C9W A;  5IW4 A;  3Q4I A;  3X0M A;  5ANT A;  5C8L A;  3A6V A;  3DUP A;  1V8T A;  2A8R A;  2B0V A;  2CL3 A;  3RH7 A;  2QKM B;  2YVM A;  1XSC A;  3BAP A;  2JVB A;  1G0S A;  4ICK A;  1V8V A;  5FSK A;  4KG4 A;  3A6S A;  1R67 A;  3X0L A;  1VK6 A;  4V14 A;  5ANV A;  1OW2 A;  1K26 A;  2I6K A;  2GB5 A;  3L85 A;  1GA7 A;  1VC8 A;  3Q91 A;  3X0S A;  3X0P A;  4YPH A;  5DDG A;  1HZT A;  1VCD A;  2PNY A;  3GZ5 A;  3GWY A;  4ILQ A;  5GHO A;  5BON A;  3MDI A;  1V8W A;  2A8S A;  3A6U A;  2ICJ A;  4JZT A;  1I9A A;  1XSB A;  1X84 A;  2A6T A;  4MPO A;  1V8L A;  4JZU A;  2ICK A;  4YPR A;  3J7Y e;  2GT2 A;  4ZG0 A;  1PUS A;  1V8I A;  2YVO A;  3FFU A;  1PVF A;  4NFX A;  1V8R A;  5DD4 A;  3SHD A;  1X83 A;  4DYW A;  3HHJ A;  2A8Q A;  3QSJ A;  5C7T A;  5DEQ A;  2DUK A;  3I7V A;  3X0R A;  3X0J A;  3BM4 A;  2B06 A;  1MUT A;  3HYQ A;  1F3Y A;  5ANW A;  3P6Y A;  3A6T A;  2YYH A;  4NFW A;  2B2K A;  3X0Q A;  2KDW A;  2VNP A;  3F6A A;  1SU2 A;  3EF5 A;  3I9X A;  3MGM A;  3R03 A;  5ANU A;  2YVN A;  2CZR A;  5HZX A;  3G0Q A;  3O8S A;  4S2W A;  3O6Z A;  5I8U A;  1RRQ A;  3FJY A;  1RYA A;  5CFI A;  2FML A;  3EXQ A;  2KDV A;  5C7Q A;  3Q2T A;  1MQE A;  1PPX A;  1V8Y A;  3ID9 A;  3N9U A;  1NFS A;  4HFQ A;  3MDG A;  3F13 A;  2XSQ A;  5FSL A;  3FCM A;  3SON A;  1QVJ A;  3COU A;  3GZ6 A;  1Q33 A;  3GRN A;  3O61 A;  2G73 A;  2QJO A;  2YVP A;  2DSB A;  3H95 A;  5FSI A;  5BS6 A;  1PPW A;  5FSM A;  5GHP A;  4IJX A;  3FSP A;  1V8M A;  1KT9 A;  3P5T A;  3Q1P A;  3Q2S A;  1MR2 A;  1PPV A;  3ZR0 A;  4C9X A;  3X0N A;  2AZW A;  1NFZ A;  2PQV A;  4JZS A;  4KTB A;  4S2X A;  1VRL A;  3X0O A;  5FSO A;  3X0K A;  1XSA A;  1V8N A;  1NQZ A;  3X0I A;  1VIQ A;  2O5F A;  2W4E A;  1VHG A;  4KYX A;  1SJY A;  1X51 A;  2O5W A;  3ACA A;  4J7H A;  2FKB A;  4S2Y A;  3E57 A;  4JZV A;  1IRY A;  5GHM A;  1VHZ A;  2Q9P A;  3FK9 A;  1TUM A;  1V8U A;  3GZ8 A;  2DHO A;  5CFJ A;  3CNG A;  1SZ3 A;  3N77 A;  3EEU A;  5LPG A;  2QJT A;  4HVY A;  1VC9 A;  1V8S A;  3GG6 A;  4N1U A;  4S2V A;  1NQY A;  5IW5 A;  1PUQ A;  2DSD A;  2G74 A;  3EES A;  3WHW A;  4N1T A;  2FVV A;  2O1C A;  5GHQ A;  5GHJ A;  1RRS A;  1HX3 A;  1K2E A;  1KTG A;  5ANS A;  3Q93 A;  1SOI A;  1MP2 A; 
#chains in the Genus database with same CATH homology
 3O52 A;  5GHI A;  3AC9 A;  3SMD A;  1MK1 A;  1VIU A;  3BHO A;  4KG3 A;  1JKN A;  2I8U A;  1U20 A;  4K6E A;  2I8T A;  3U53 A;  5FSN A;  2RRK A;  3ZR1 A;  1MQW A;  1G9Q A;  2A8T A;  5ISY A;  4YOQ A;  1KHZ A;  3MCF A;  1JRK A;  2J8Q A;  2A8P A;  5DPK A;  1Q54 A;  3O69 A;  1Q27 A;  1PUN A;  2R5W A;  2VNQ A;  2DSC A;  3I7U A;  3KVH A;  3DKU A;  4J7G A;  2GT4 A;  3OGA A;  5GHN A;  4C9W A;  5IW4 A;  3Q4I A;  3X0M A;  5ANT A;  5C8L A;  3A6V A;  3DUP A;  1V8T A;  2A8R A;  2B0V A;  2CL3 A;  3RH7 A;  2QKM B;  2YVM A;  1XSC A;  3BAP A;  2JVB A;  1G0S A;  4ICK A;  1V8V A;  5FSK A;  4KG4 A;  3A6S A;  1R67 A;  3X0L A;  1VK6 A;  4V14 A;  5ANV A;  1OW2 A;  1K26 A;  2I6K A;  2GB5 A;  3L85 A;  1GA7 A;  1VC8 A;  3Q91 A;  3X0S A;  3X0P A;  4YPH A;  5DDG A;  1HZT A;  1VCD A;  2PNY A;  3GZ5 A;  3GWY A;  4ILQ A;  5GHO A;  5BON A;  3MDI A;  1V8W A;  2A8S A;  3A6U A;  2ICJ A;  4JZT A;  1I9A A;  1XSB A;  1X84 A;  2A6T A;  4MPO A;  1V8L A;  4JZU A;  2ICK A;  4YPR A;  3J7Y e;  2GT2 A;  4ZG0 A;  1PUS A;  1V8I A;  2YVO A;  3FFU A;  1PVF A;  4NFX A;  1V8R A;  5DD4 A;  3SHD A;  1X83 A;  4DYW A;  3HHJ A;  2A8Q A;  3QSJ A;  5C7T A;  5DEQ A;  2DUK A;  3I7V A;  3X0R A;  3X0J A;  3BM4 A;  2B06 A;  1MUT A;  3HYQ A;  1F3Y A;  5ANW A;  3P6Y A;  3A6T A;  2YYH A;  4NFW A;  2B2K A;  3X0Q A;  2KDW A;  2VNP A;  3F6A A;  1SU2 A;  3EF5 A;  3I9X A;  3MGM A;  3R03 A;  5ANU A;  2YVN A;  2CZR A;  5HZX A;  3G0Q A;  3O8S A;  4S2W A;  3O6Z A;  5I8U A;  1RRQ A;  3FJY A;  1RYA A;  5CFI A;  2FML A;  3EXQ A;  2KDV A;  5C7Q A;  3Q2T A;  1MQE A;  1PPX A;  1V8Y A;  3ID9 A;  3N9U A;  1NFS A;  4HFQ A;  3MDG A;  3F13 A;  2XSQ A;  5FSL A;  3FCM A;  3SON A;  1QVJ A;  3COU A;  3GZ6 A;  1Q33 A;  3GRN A;  3O61 A;  2G73 A;  2QJO A;  2YVP A;  2DSB A;  3H95 A;  5FSI A;  5BS6 A;  1PPW A;  5FSM A;  5GHP A;  4IJX A;  3FSP A;  1V8M A;  1KT9 A;  3P5T A;  3Q1P A;  3Q2S A;  1MR2 A;  1PPV A;  3ZR0 A;  4C9X A;  3X0N A;  2AZW A;  1NFZ A;  2PQV A;  4JZS A;  4KTB A;  4S2X A;  1VRL A;  3X0O A;  5FSO A;  3X0K A;  1XSA A;  1V8N A;  1NQZ A;  3X0I A;  1VIQ A;  2O5F A;  2W4E A;  1VHG A;  4KYX A;  1SJY A;  1X51 A;  2O5W A;  3ACA A;  4J7H A;  2FKB A;  4S2Y A;  3E57 A;  4JZV A;  1IRY A;  5GHM A;  1VHZ A;  2Q9P A;  3FK9 A;  1TUM A;  1V8U A;  3GZ8 A;  2DHO A;  5CFJ A;  3CNG A;  1SZ3 A;  3N77 A;  3EEU A;  5LPG A;  2QJT A;  4HVY A;  1VC9 A;  1V8S A;  3GG6 A;  4N1U A;  4S2V A;  1NQY A;  5IW5 A;  1PUQ A;  2DSD A;  2G74 A;  3EES A;  3WHW A;  4N1T A;  2FVV A;  2O1C A;  5GHQ A;  5GHJ A;  1RRS A;  1HX3 A;  1K2E A;  1KTG A;  5ANS A;  3Q93 A;  1SOI A;  1MP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...