3ZR1A

Crystal structure of human mth1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
154
structure length
154
Chain Sequence
ASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 7,8-DIHYDRO-8-OXOGUANINE TRIPHOSPHATASE
publication title Crystal Structure of Human Mth1 and the 8-Oxo-Dgmp Product Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2011-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3zr1A00
3COUA 5FSOA 3J7Ye 1PUNA 4N1UA 2A8PA 3GZ5A 1NFZA 2DSBA 1MQWA 3BM4A 1NFSA 3EXQA 3X0JA 3O61A 3P6YA 2A6TA 1RRQA 1MK1A 1SU2A 4JZUA 4JZTA 1VK6A 1V8RA 2G73A 1I9AA 3I7UA 3R03A 3X0OA 1XSBA 3GWYA 3H95A 5ANTA 3WHWA 3X0IA 1PUSA 2DHOA 2A8RA 1V8WA 5BONA 3ID9A 1Q27A 2O1CA 3X0MA 5GHOA 1V8NA 2B06A 3EEUA 5ANWA 4V14A 2O5FA 1VC9A 3A6SA 3HYQA 3O8SA 1Q54A 2YVOA 3Q1PA 3SMDA 3L85A 1K2EA 3Q4IA 3SONA 2FVVA 4JZVA 1RRSA 2W4EA 3MDGA 1NQZA 1RYAA 2PQVA 2A8TA 3MCFA 3O69A 4YOQA 1K26A 5DPKA 3EF5A 3P5TA 3GZ8A 3Q93A 2XSQA 1VC8A 1SOIA 1V8IA 2DSDA 3DUPA 1KHZA 3F6AA 4S2VA 2YVMA 1PUQA 4JZSA 3MDIA 1F3YA 1PVFA 5DD4A 5ANVA 2KDVA 3CNGA 3X0NA 3GG6A 5C7TA 1VRLA 1V8MA 1OW2A 5LPGA 1R67A 1SZ3A 2FMLA 2YVNA 3FFUA 3Q2TA 2RRKA 1HZTA 5GHPA 2QKMB 1V8LA 4IJXA 1PPVA 1MP2A 3O52A 3MGMA 1MUTA 2I8UA 3DKUA 4MPOA 3X0SA 2KDWA 2CL3A 1HX3A 4YPHA 3X0KA 1G0SA 3E57A 3ACAA 3X0LA 4N1TA 1U20A 3SHDA 4C9WA 2GT2A 2I8TA 2G74A 2B2KA 1VCDA 2ICKA 2QJOA 5FSKA 1V8YA 2DUKA 3HHJA 4NFXA 3BAPA 2AZWA 4KYXA 5ANUA 3N9UA 5DDGA 3A6UA 3RH7A 4C9XA 3I7VA 1NQYA 1XSAA 3X0RA 2A8QA 4DYWA 4ZG0A 2GT4A 3N77A 2JVBA 5FSIA 2YVPA 5GHMA 1JKNA 5C8LA 1VHGA 3QSJA 1V8TA 4K6EA 3I9XA 5FSNA 2YYHA 3F13A 3ZR1A 1G9QA 5ISYA 1QVJA 3FK9A 1JRKA 2Q9PA 4S2XA 4NFWA 5GHNA 2VNQA 5I8UA 1X51A 1KTGA 2QJTA 3A6VA 3X0QA 5IW5A 3X0PA 2PNYA 1X83A 2B0VA 2VNPA 1VHZA 3AC9A 5ANSA 1KT9A 2ICJA 3O6ZA 3OGAA 1SJYA 1PPWA 4KG4A 1VIQA 2DSCA 5DEQA 5CFIA 4YPRA 3U53A 3EESA 5GHQA 5HZXA 4ICKA 5C7QA 3FSPA 4KTBA 5GHJA 5GHIA 5CFJA 1TUMA 4S2YA 1IRYA 3FCMA 4ILQA 3GZ6A 2A8SA 3FJYA 3Q2SA 1XSCA 4HFQA 5BS6A 1GA7A 2J8QA 4KG3A 5IW4A 3G0QA 2GB5A 3KVHA 1PPXA 1V8VA 3Q91A 4HVYA 4S2WA 3A6TA 1V8UA 1MQEA 1X84A 2O5WA 2FKBA 3ZR0A 3BHOA 2I6KA 1VIUA 2R5WA 1MR2A 5FSLA 1V8SA 1Q33A 5FSMA 3GRNA
chains in the Genus database with same CATH superfamily
3COUA 5FSOA 3J7Ye 1PUNA 4N1UA 2A8PA 3GZ5A 1NFZA 2DSBA 1MQWA 3BM4A 1NFSA 3EXQA 3X0JA 3O61A 3P6YA 2A6TA 1RRQA 1MK1A 1SU2A 4JZUA 4JZTA 1VK6A 1V8RA 2G73A 1I9AA 3I7UA 3R03A 3X0OA 1XSBA 3GWYA 3H95A 5ANTA 3WHWA 3X0IA 1PUSA 2DHOA 2A8RA 1V8WA 5BONA 4J7HA 3ID9A 1Q27A 2O1CA 3X0MA 5GHOA 1V8NA 2B06A 3EEUA 5ANWA 4V14A 2O5FA 1VC9A 3A6SA 3HYQA 3O8SA 1Q54A 2YVOA 3Q1PA 3SMDA 3L85A 1K2EA 3Q4IA 3SONA 2FVVA 4JZVA 1RRSA 2W4EA 3MDGA 1NQZA 1RYAA 2PQVA 2A8TA 3MCFA 3O69A 4YOQA 1K26A 5DPKA 3EF5A 3P5TA 3GZ8A 3Q93A 2XSQA 1VC8A 1SOIA 1V8IA 2DSDA 3DUPA 1KHZA 3F6AA 4S2VA 2YVMA 1PUQA 4JZSA 3MDIA 1F3YA 1PVFA 5DD4A 5ANVA 2KDVA 3CNGA 3X0NA 3GG6A 5C7TA 1VRLA 1V8MA 1OW2A 5LPGA 1R67A 1SZ3A 2FMLA 2YVNA 3FFUA 3Q2TA 2RRKA 1HZTA 5GHPA 2QKMB 1V8LA 4IJXA 1PPVA 1MP2A 3O52A 3MGMA 1MUTA 2I8UA 3DKUA 4MPOA 3X0SA 2KDWA 2CL3A 1HX3A 4YPHA 3X0KA 1G0SA 3E57A 3ACAA 3X0LA 4N1TA 1U20A 3SHDA 4C9WA 2GT2A 2I8TA 2G74A 2B2KA 1VCDA 2ICKA 2QJOA 5FSKA 1V8YA 2DUKA 3HHJA 4NFXA 3BAPA 2AZWA 4KYXA 5ANUA 3N9UA 5DDGA 3A6UA 3RH7A 4C9XA 3I7VA 1NQYA 1XSAA 3X0RA 2A8QA 4DYWA 4ZG0A 2GT4A 3N77A 2JVBA 5FSIA 4J7GA 2YVPA 5GHMA 1JKNA 5C8LA 1VHGA 3QSJA 1V8TA 4K6EA 3I9XA 5FSNA 2YYHA 3F13A 3ZR1A 1G9QA 5ISYA 1QVJA 3FK9A 1JRKA 2Q9PA 4S2XA 2CZRA 4NFWA 5GHNA 2VNQA 5I8UA 1X51A 1KTGA 2QJTA 3A6VA 3X0QA 5IW5A 3X0PA 2PNYA 1X83A 2B0VA 2VNPA 1VHZA 3AC9A 5ANSA 1KT9A 2ICJA 3O6ZA 3OGAA 1SJYA 1PPWA 4KG4A 1VIQA 2DSCA 5DEQA 5CFIA 4YPRA 3U53A 3EESA 5GHQA 5HZXA 4ICKA 5C7QA 3FSPA 4KTBA 5GHJA 5GHIA 5CFJA 1TUMA 4S2YA 1IRYA 3FCMA 4ILQA 3GZ6A 2A8SA 3FJYA 3Q2SA 1XSCA 4HFQA 5BS6A 1GA7A 2J8QA 4KG3A 5IW4A 3G0QA 2GB5A 3KVHA 1PPXA 1V8VA 3Q91A 4HVYA 4S2WA 3A6TA 1V8UA 1MQEA 1X84A 2O5WA 2FKBA 3ZR0A 3BHOA 2I6KA 1VIUA 2R5WA 1MR2A 5FSLA 1V8SA 1Q33A 5FSMA 3GRNA
chains in the Genus database with same CATH topology
3COUA 5FSOA 3J7Ye 1PUNA 4N1UA 2A8PA 3GZ5A 1NFZA 2DSBA 1MQWA 3BM4A 1NFSA 3EXQA 3X0JA 3O61A 3P6YA 2A6TA 1RRQA 1MK1A 1SU2A 4JZUA 4JZTA 1VK6A 1V8RA 2G73A 1I9AA 3I7UA 3R03A 3X0OA 1XSBA 3GWYA 3H95A 5ANTA 3WHWA 3X0IA 1PUSA 2DHOA 2A8RA 1V8WA 5BONA 4J7HA 3ID9A 1Q27A 2O1CA 3X0MA 5GHOA 1V8NA 2B06A 3EEUA 5ANWA 4V14A 2O5FA 1VC9A 3A6SA 3HYQA 3O8SA 1Q54A 2YVOA 3Q1PA 3SMDA 3L85A 1K2EA 3Q4IA 3SONA 2FVVA 4JZVA 1RRSA 2W4EA 3MDGA 1NQZA 1RYAA 2PQVA 2A8TA 3MCFA 3O69A 4YOQA 1K26A 5DPKA 3EF5A 3P5TA 3GZ8A 3Q93A 2XSQA 1VC8A 1SOIA 1V8IA 2DSDA 3DUPA 1KHZA 3F6AA 4S2VA 2YVMA 1PUQA 4JZSA 3MDIA 1F3YA 1PVFA 5DD4A 5ANVA 2KDVA 3CNGA 3X0NA 3GG6A 5C7TA 1VRLA 1V8MA 1OW2A 5LPGA 1R67A 1SZ3A 2FMLA 2YVNA 3FFUA 3Q2TA 2RRKA 1HZTA 5GHPA 2QKMB 1V8LA 4IJXA 1PPVA 1MP2A 3O52A 3MGMA 1MUTA 2I8UA 3DKUA 4MPOA 3X0SA 2KDWA 2CL3A 1HX3A 4YPHA 3X0KA 1G0SA 3E57A 3ACAA 3X0LA 4N1TA 1U20A 3SHDA 4C9WA 2GT2A 2I8TA 2G74A 2B2KA 1VCDA 2ICKA 2QJOA 5FSKA 1V8YA 2DUKA 3HHJA 4NFXA 3BAPA 2AZWA 4KYXA 5ANUA 3N9UA 5DDGA 3A6UA 3RH7A 4C9XA 3I7VA 1NQYA 1XSAA 3X0RA 2A8QA 4DYWA 4ZG0A 2GT4A 3N77A 2JVBA 5FSIA 4J7GA 2YVPA 5GHMA 1JKNA 5C8LA 1VHGA 3QSJA 1V8TA 4K6EA 3I9XA 5FSNA 2YYHA 3F13A 3ZR1A 1G9QA 5ISYA 1QVJA 3FK9A 1JRKA 2Q9PA 4S2XA 2CZRA 4NFWA 5GHNA 2VNQA 5I8UA 1X51A 1KTGA 2QJTA 3A6VA 3X0QA 5IW5A 3X0PA 2PNYA 1X83A 2B0VA 2VNPA 1VHZA 3AC9A 5ANSA 1KT9A 2ICJA 3O6ZA 3OGAA 1SJYA 1PPWA 4KG4A 1VIQA 2DSCA 5DEQA 5CFIA 4YPRA 3U53A 3EESA 5GHQA 5HZXA 4ICKA 5C7QA 3FSPA 4KTBA 5GHJA 5GHIA 5CFJA 1TUMA 4S2YA 1IRYA 3FCMA 4ILQA 3GZ6A 2A8SA 3FJYA 3Q2SA 1XSCA 4HFQA 5BS6A 1GA7A 2J8QA 4KG3A 5IW4A 3G0QA 2GB5A 3KVHA 1PPXA 1V8VA 3Q91A 4HVYA 4S2WA 3A6TA 1V8UA 1MQEA 1X84A 2O5WA 2FKBA 3ZR0A 3BHOA 2I6KA 1VIUA 2R5WA 1MR2A 5FSLA 1V8SA 1Q33A 5FSMA 3GRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3COU A;  5FSO A;  3J7Y e;  1PUN A;  4N1U A;  2A8P A;  3GZ5 A;  1NFZ A;  2DSB A;  1MQW A;  3BM4 A;  1NFS A;  3EXQ A;  3X0J A;  3O61 A;  3P6Y A;  2A6T A;  1RRQ A;  1MK1 A;  1SU2 A;  4JZU A;  4JZT A;  1VK6 A;  1V8R A;  2G73 A;  1I9A A;  3I7U A;  3R03 A;  3X0O A;  1XSB A;  3GWY A;  3H95 A;  5ANT A;  3WHW A;  3X0I A;  1PUS A;  2DHO A;  2A8R A;  1V8W A;  5BON A;  3ID9 A;  1Q27 A;  2O1C A;  3X0M A;  5GHO A;  1V8N A;  2B06 A;  3EEU A;  5ANW A;  4V14 A;  2O5F A;  1VC9 A;  3A6S A;  3HYQ A;  3O8S A;  1Q54 A;  2YVO A;  3Q1P A;  3SMD A;  3L85 A;  1K2E A;  3Q4I A;  3SON A;  2FVV A;  4JZV A;  1RRS A;  2W4E A;  3MDG A;  1NQZ A;  1RYA A;  2PQV A;  2A8T A;  3MCF A;  3O69 A;  4YOQ A;  1K26 A;  5DPK A;  3EF5 A;  3P5T A;  3GZ8 A;  3Q93 A;  2XSQ A;  1VC8 A;  1SOI A;  1V8I A;  2DSD A;  3DUP A;  1KHZ A;  3F6A A;  4S2V A;  2YVM A;  1PUQ A;  4JZS A;  3MDI A;  1F3Y A;  1PVF A;  5DD4 A;  5ANV A;  2KDV A;  3CNG A;  3X0N A;  3GG6 A;  5C7T A;  1VRL A;  1V8M A;  1OW2 A;  5LPG A;  1R67 A;  1SZ3 A;  2FML A;  2YVN A;  3FFU A;  3Q2T A;  2RRK A;  1HZT A;  5GHP A;  2QKM B;  1V8L A;  4IJX A;  1PPV A;  1MP2 A;  3O52 A;  3MGM A;  1MUT A;  2I8U A;  3DKU A;  4MPO A;  3X0S A;  2KDW A;  2CL3 A;  1HX3 A;  4YPH A;  3X0K A;  1G0S A;  3E57 A;  3ACA A;  3X0L A;  4N1T A;  1U20 A;  3SHD A;  4C9W A;  2GT2 A;  2I8T A;  2G74 A;  2B2K A;  1VCD A;  2ICK A;  2QJO A;  5FSK A;  1V8Y A;  2DUK A;  3HHJ A;  4NFX A;  3BAP A;  2AZW A;  4KYX A;  5ANU A;  3N9U A;  5DDG A;  3A6U A;  3RH7 A;  4C9X A;  3I7V A;  1NQY A;  1XSA A;  3X0R A;  2A8Q A;  4DYW A;  4ZG0 A;  2GT4 A;  3N77 A;  2JVB A;  5FSI A;  2YVP A;  5GHM A;  1JKN A;  5C8L A;  1VHG A;  3QSJ A;  1V8T A;  4K6E A;  3I9X A;  5FSN A;  2YYH A;  3F13 A;  3ZR1 A;  1G9Q A;  5ISY A;  1QVJ A;  3FK9 A;  1JRK A;  2Q9P A;  4S2X A;  4NFW A;  5GHN A;  2VNQ A;  5I8U A;  1X51 A;  1KTG A;  2QJT A;  3A6V A;  3X0Q A;  5IW5 A;  3X0P A;  2PNY A;  1X83 A;  2B0V A;  2VNP A;  1VHZ A;  3AC9 A;  5ANS A;  1KT9 A;  2ICJ A;  3O6Z A;  3OGA A;  1SJY A;  1PPW A;  4KG4 A;  1VIQ A;  2DSC A;  5DEQ A;  5CFI A;  4YPR A;  3U53 A;  3EES A;  5GHQ A;  5HZX A;  4ICK A;  5C7Q A;  3FSP A;  4KTB A;  5GHJ A;  5GHI A;  5CFJ A;  1TUM A;  4S2Y A;  1IRY A;  3FCM A;  4ILQ A;  3GZ6 A;  2A8S A;  3FJY A;  3Q2S A;  1XSC A;  4HFQ A;  5BS6 A;  1GA7 A;  2J8Q A;  4KG3 A;  5IW4 A;  3G0Q A;  2GB5 A;  3KVH A;  1PPX A;  1V8V A;  3Q91 A;  4HVY A;  4S2W A;  3A6T A;  1V8U A;  1MQE A;  1X84 A;  2O5W A;  2FKB A;  3ZR0 A;  3BHO A;  2I6K A;  1VIU A;  2R5W A;  1MR2 A;  5FSL A;  1V8S A;  1Q33 A;  5FSM A;  3GRN A; 
#chains in the Genus database with same CATH topology
 3COU A;  5FSO A;  3J7Y e;  1PUN A;  4N1U A;  2A8P A;  3GZ5 A;  1NFZ A;  2DSB A;  1MQW A;  3BM4 A;  1NFS A;  3EXQ A;  3X0J A;  3O61 A;  3P6Y A;  2A6T A;  1RRQ A;  1MK1 A;  1SU2 A;  4JZU A;  4JZT A;  1VK6 A;  1V8R A;  2G73 A;  1I9A A;  3I7U A;  3R03 A;  3X0O A;  1XSB A;  3GWY A;  3H95 A;  5ANT A;  3WHW A;  3X0I A;  1PUS A;  2DHO A;  2A8R A;  1V8W A;  5BON A;  4J7H A;  3ID9 A;  1Q27 A;  2O1C A;  3X0M A;  5GHO A;  1V8N A;  2B06 A;  3EEU A;  5ANW A;  4V14 A;  2O5F A;  1VC9 A;  3A6S A;  3HYQ A;  3O8S A;  1Q54 A;  2YVO A;  3Q1P A;  3SMD A;  3L85 A;  1K2E A;  3Q4I A;  3SON A;  2FVV A;  4JZV A;  1RRS A;  2W4E A;  3MDG A;  1NQZ A;  1RYA A;  2PQV A;  2A8T A;  3MCF A;  3O69 A;  4YOQ A;  1K26 A;  5DPK A;  3EF5 A;  3P5T A;  3GZ8 A;  3Q93 A;  2XSQ A;  1VC8 A;  1SOI A;  1V8I A;  2DSD A;  3DUP A;  1KHZ A;  3F6A A;  4S2V A;  2YVM A;  1PUQ A;  4JZS A;  3MDI A;  1F3Y A;  1PVF A;  5DD4 A;  5ANV A;  2KDV A;  3CNG A;  3X0N A;  3GG6 A;  5C7T A;  1VRL A;  1V8M A;  1OW2 A;  5LPG A;  1R67 A;  1SZ3 A;  2FML A;  2YVN A;  3FFU A;  3Q2T A;  2RRK A;  1HZT A;  5GHP A;  2QKM B;  1V8L A;  4IJX A;  1PPV A;  1MP2 A;  3O52 A;  3MGM A;  1MUT A;  2I8U A;  3DKU A;  4MPO A;  3X0S A;  2KDW A;  2CL3 A;  1HX3 A;  4YPH A;  3X0K A;  1G0S A;  3E57 A;  3ACA A;  3X0L A;  4N1T A;  1U20 A;  3SHD A;  4C9W A;  2GT2 A;  2I8T A;  2G74 A;  2B2K A;  1VCD A;  2ICK A;  2QJO A;  5FSK A;  1V8Y A;  2DUK A;  3HHJ A;  4NFX A;  3BAP A;  2AZW A;  4KYX A;  5ANU A;  3N9U A;  5DDG A;  3A6U A;  3RH7 A;  4C9X A;  3I7V A;  1NQY A;  1XSA A;  3X0R A;  2A8Q A;  4DYW A;  4ZG0 A;  2GT4 A;  3N77 A;  2JVB A;  5FSI A;  4J7G A;  2YVP A;  5GHM A;  1JKN A;  5C8L A;  1VHG A;  3QSJ A;  1V8T A;  4K6E A;  3I9X A;  5FSN A;  2YYH A;  3F13 A;  3ZR1 A;  1G9Q A;  5ISY A;  1QVJ A;  3FK9 A;  1JRK A;  2Q9P A;  4S2X A;  2CZR A;  4NFW A;  5GHN A;  2VNQ A;  5I8U A;  1X51 A;  1KTG A;  2QJT A;  3A6V A;  3X0Q A;  5IW5 A;  3X0P A;  2PNY A;  1X83 A;  2B0V A;  2VNP A;  1VHZ A;  3AC9 A;  5ANS A;  1KT9 A;  2ICJ A;  3O6Z A;  3OGA A;  1SJY A;  1PPW A;  4KG4 A;  1VIQ A;  2DSC A;  5DEQ A;  5CFI A;  4YPR A;  3U53 A;  3EES A;  5GHQ A;  5HZX A;  4ICK A;  5C7Q A;  3FSP A;  4KTB A;  5GHJ A;  5GHI A;  5CFJ A;  1TUM A;  4S2Y A;  1IRY A;  3FCM A;  4ILQ A;  3GZ6 A;  2A8S A;  3FJY A;  3Q2S A;  1XSC A;  4HFQ A;  5BS6 A;  1GA7 A;  2J8Q A;  4KG3 A;  5IW4 A;  3G0Q A;  2GB5 A;  3KVH A;  1PPX A;  1V8V A;  3Q91 A;  4HVY A;  4S2W A;  3A6T A;  1V8U A;  1MQE A;  1X84 A;  2O5W A;  2FKB A;  3ZR0 A;  3BHO A;  2I6K A;  1VIU A;  2R5W A;  1MR2 A;  5FSL A;  1V8S A;  1Q33 A;  5FSM A;  3GRN A; 
#chains in the Genus database with same CATH homology
 3COU A;  5FSO A;  3J7Y e;  1PUN A;  4N1U A;  2A8P A;  3GZ5 A;  1NFZ A;  2DSB A;  1MQW A;  3BM4 A;  1NFS A;  3EXQ A;  3X0J A;  3O61 A;  3P6Y A;  2A6T A;  1RRQ A;  1MK1 A;  1SU2 A;  4JZU A;  4JZT A;  1VK6 A;  1V8R A;  2G73 A;  1I9A A;  3I7U A;  3R03 A;  3X0O A;  1XSB A;  3GWY A;  3H95 A;  5ANT A;  3WHW A;  3X0I A;  1PUS A;  2DHO A;  2A8R A;  1V8W A;  5BON A;  4J7H A;  3ID9 A;  1Q27 A;  2O1C A;  3X0M A;  5GHO A;  1V8N A;  2B06 A;  3EEU A;  5ANW A;  4V14 A;  2O5F A;  1VC9 A;  3A6S A;  3HYQ A;  3O8S A;  1Q54 A;  2YVO A;  3Q1P A;  3SMD A;  3L85 A;  1K2E A;  3Q4I A;  3SON A;  2FVV A;  4JZV A;  1RRS A;  2W4E A;  3MDG A;  1NQZ A;  1RYA A;  2PQV A;  2A8T A;  3MCF A;  3O69 A;  4YOQ A;  1K26 A;  5DPK A;  3EF5 A;  3P5T A;  3GZ8 A;  3Q93 A;  2XSQ A;  1VC8 A;  1SOI A;  1V8I A;  2DSD A;  3DUP A;  1KHZ A;  3F6A A;  4S2V A;  2YVM A;  1PUQ A;  4JZS A;  3MDI A;  1F3Y A;  1PVF A;  5DD4 A;  5ANV A;  2KDV A;  3CNG A;  3X0N A;  3GG6 A;  5C7T A;  1VRL A;  1V8M A;  1OW2 A;  5LPG A;  1R67 A;  1SZ3 A;  2FML A;  2YVN A;  3FFU A;  3Q2T A;  2RRK A;  1HZT A;  5GHP A;  2QKM B;  1V8L A;  4IJX A;  1PPV A;  1MP2 A;  3O52 A;  3MGM A;  1MUT A;  2I8U A;  3DKU A;  4MPO A;  3X0S A;  2KDW A;  2CL3 A;  1HX3 A;  4YPH A;  3X0K A;  1G0S A;  3E57 A;  3ACA A;  3X0L A;  4N1T A;  1U20 A;  3SHD A;  4C9W A;  2GT2 A;  2I8T A;  2G74 A;  2B2K A;  1VCD A;  2ICK A;  2QJO A;  5FSK A;  1V8Y A;  2DUK A;  3HHJ A;  4NFX A;  3BAP A;  2AZW A;  4KYX A;  5ANU A;  3N9U A;  5DDG A;  3A6U A;  3RH7 A;  4C9X A;  3I7V A;  1NQY A;  1XSA A;  3X0R A;  2A8Q A;  4DYW A;  4ZG0 A;  2GT4 A;  3N77 A;  2JVB A;  5FSI A;  4J7G A;  2YVP A;  5GHM A;  1JKN A;  5C8L A;  1VHG A;  3QSJ A;  1V8T A;  4K6E A;  3I9X A;  5FSN A;  2YYH A;  3F13 A;  3ZR1 A;  1G9Q A;  5ISY A;  1QVJ A;  3FK9 A;  1JRK A;  2Q9P A;  4S2X A;  2CZR A;  4NFW A;  5GHN A;  2VNQ A;  5I8U A;  1X51 A;  1KTG A;  2QJT A;  3A6V A;  3X0Q A;  5IW5 A;  3X0P A;  2PNY A;  1X83 A;  2B0V A;  2VNP A;  1VHZ A;  3AC9 A;  5ANS A;  1KT9 A;  2ICJ A;  3O6Z A;  3OGA A;  1SJY A;  1PPW A;  4KG4 A;  1VIQ A;  2DSC A;  5DEQ A;  5CFI A;  4YPR A;  3U53 A;  3EES A;  5GHQ A;  5HZX A;  4ICK A;  5C7Q A;  3FSP A;  4KTB A;  5GHJ A;  5GHI A;  5CFJ A;  1TUM A;  4S2Y A;  1IRY A;  3FCM A;  4ILQ A;  3GZ6 A;  2A8S A;  3FJY A;  3Q2S A;  1XSC A;  4HFQ A;  5BS6 A;  1GA7 A;  2J8Q A;  4KG3 A;  5IW4 A;  3G0Q A;  2GB5 A;  3KVH A;  1PPX A;  1V8V A;  3Q91 A;  4HVY A;  4S2W A;  3A6T A;  1V8U A;  1MQE A;  1X84 A;  2O5W A;  2FKB A;  3ZR0 A;  3BHO A;  2I6K A;  1VIU A;  2R5W A;  1MR2 A;  5FSL A;  1V8S A;  1Q33 A;  5FSM A;  3GRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...