3SONA

Crystal structure of a putativel nudix hydrolase (lmof2365_2679) from listeria monocytogenes str. 4b f2365 at 1.70 a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
147
structure length
147
Chain Sequence
RQPFQVLVIPFIKTEANYQFGVLHRTDADVWQFVAGGGEDEEAISETAKRESIEELNLDVDVKMYSLDSHASIPNFHFSFNKPYVVPEYCFAIDLTSCSYQVTLSLEHSELRWVSYESAIQLLEWDSNKTALYELNERLKNNDMKAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Hypothetical NUDIX hydrolase
publication title Crystal structure of a Hypothetical NUDIX hydrolase (LMOf2365_2679) from LISTERIA MONOCYTOGENES (ATCC 19115) at 1.70 A resolution
rcsb
source organism Listeria monocytogenes
total genus 36
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3sonA00
5DEQA 3X0NA 3HHJA 3P5TA 1TUMA 2KDVA 3DUPA 2O5WA 3EF5A 1K26A 3FJYA 1R67A 1NFSA 2A8RA 2FKBA 1SOIA 1VC8A 1XSAA 4KTBA 3MCFA 1V8IA 1V8WA 5ISYA 5C7TA 1PPVA 3WHWA 1VCDA 3A6UA 1G0SA 3AC9A 3CNGA 1VRLA 2RRKA 5GHQA 2VNPA 3GZ8A 2Q9PA 2G73A 2QJTA 1NQZA 3ACAA 1NFZA 2DSDA 2QJOA 3MDGA 1VIUA 2DSBA 4HVYA 1XSCA 1VC9A 5IW4A 3P6YA 2DHOA 4N1TA 3F13A 3BM4A 5ANSA 1G9QA 1KHZA 3GZ5A 3ZR1A 1K2EA 2YVPA 4ILQA 3GRNA 5FSIA 5FSMA 3RH7A 1F3YA 4JZVA 2VNQA 4JZSA 4NFXA 3O6ZA 4YPHA 2XSQA 5C8LA 1JKNA 3EXQA 3HYQA 5ANWA 2A8SA 3X0RA 2I6KA 5C7QA 1RRQA 3ZR0A 2FMLA 3X0OA 5GHMA 1MUTA 1QVJA 3FSPA 2YVMA 2GT2A 3O52A 2GB5A 2B2KA 1V8NA 1HZTA 4KYXA 4S2XA 1PVFA 1V8UA 2CL3A 3BAPA 4HFQA 3O69A 1MP2A 5FSKA 4YPRA 1X83A 4MPOA 2ICJA 1PUNA 1VK6A 1MK1A 1OW2A 3I7VA 5FSLA 2KDWA 1Q33A 1Q27A 2DUKA 2YYHA 3EEUA 3H95A 3X0IA 1V8TA 1MQWA 1X51A 1RYAA 3FCMA 2YVOA 5GHNA 5DD4A 4YOQA 3O8SA 4N1UA 3U53A 4S2VA 5CFJA 1V8VA 4V14A 2I8UA 1V8MA 4KG4A 2ICKA 1KT9A 5IW5A 5FSNA 1PUQA 1VIQA 5GHOA 1PPXA 3L85A 5HZXA 4IJXA 1I9AA 3N9UA 1GA7A 1RRSA 2G74A 3R03A 3A6TA 3G0QA 1VHGA 2PNYA 1JRKA 5FSOA 2I8TA 4S2YA 3N77A 1V8RA 2B0VA 1V8LA 4ICKA 5DDGA 3MDIA 2A8PA 3SMDA 1PUSA 1U20A 3O61A 3X0MA 5LPGA 3X0KA 1PPWA 3MGMA 4JZTA 4S2WA 3Q2SA 1V8YA 1MQEA 3E57A 5DPKA 3Q93A 3FK9A 5GHIA 4K6EA 2A8QA 2W4EA 3KVHA 1HX3A 1X84A 2J8QA 1XSBA 2DSCA 5ANUA 5CFIA 3Q1PA 2B06A 1SZ3A 1KTGA 3COUA 3X0JA 5BS6A 2GT4A 4ZG0A 1MR2A 2JVBA 3GG6A 5GHPA 3ID9A 3SONA 3QSJA 2R5WA 3X0LA 3X0PA 3GZ6A 2O5FA 3OGAA 3X0SA 1SU2A 3X0QA 3J7Ye 3GWYA 4JZUA 4C9XA 1Q54A 1V8SA 1SJYA 4NFWA 3Q4IA 4DYWA 4C9WA 3I9XA 1IRYA 5I8UA 4KG3A 1VHZA 2YVNA 3DKUA 3I7UA 5GHJA 1NQYA 3A6SA 2AZWA 3FFUA 3Q91A 2QKMB 2O1CA 3EESA 5ANTA 3A6VA 3SHDA 2A8TA 2PQVA 3BHOA 2FVVA 5ANVA 5BONA 3Q2TA 3F6AA 2A6TA
chains in the Genus database with same CATH superfamily
5DEQA 3X0NA 3HHJA 3P5TA 1TUMA 2KDVA 3DUPA 2O5WA 3EF5A 2CZRA 1K26A 3FJYA 1R67A 1NFSA 2A8RA 2FKBA 1SOIA 1VC8A 1XSAA 4KTBA 3MCFA 1V8IA 1V8WA 5ISYA 5C7TA 1PPVA 3WHWA 1VCDA 3A6UA 1G0SA 3AC9A 3CNGA 1VRLA 2RRKA 5GHQA 2VNPA 3GZ8A 2Q9PA 2G73A 2QJTA 1NQZA 3ACAA 4J7GA 1NFZA 2DSDA 2QJOA 3MDGA 1VIUA 2DSBA 4HVYA 1XSCA 1VC9A 5IW4A 3P6YA 2DHOA 4N1TA 3F13A 3BM4A 5ANSA 1G9QA 1KHZA 3GZ5A 3ZR1A 1K2EA 2YVPA 4ILQA 3GRNA 5FSIA 5FSMA 3RH7A 1F3YA 4JZVA 2VNQA 4JZSA 4NFXA 3O6ZA 4YPHA 2XSQA 5C8LA 1JKNA 3EXQA 3HYQA 5ANWA 2A8SA 3X0RA 2I6KA 5C7QA 1RRQA 4J7HA 3ZR0A 2FMLA 3X0OA 5GHMA 1MUTA 1QVJA 3FSPA 2YVMA 2GT2A 3O52A 2GB5A 2B2KA 1V8NA 1HZTA 4KYXA 4S2XA 1PVFA 1V8UA 2CL3A 3BAPA 4HFQA 3O69A 1MP2A 5FSKA 4YPRA 1X83A 4MPOA 2ICJA 1PUNA 1VK6A 1MK1A 1OW2A 3I7VA 5FSLA 2KDWA 1Q33A 1Q27A 2DUKA 2YYHA 3EEUA 3H95A 3X0IA 1V8TA 1MQWA 1X51A 1RYAA 3FCMA 2YVOA 5GHNA 5DD4A 4YOQA 3O8SA 4N1UA 3U53A 4S2VA 5CFJA 1V8VA 4V14A 2I8UA 1V8MA 4KG4A 2ICKA 1KT9A 5IW5A 5FSNA 1PUQA 1VIQA 5GHOA 1PPXA 3L85A 5HZXA 4IJXA 1I9AA 3N9UA 1GA7A 1RRSA 2G74A 3R03A 3A6TA 3G0QA 1VHGA 2PNYA 1JRKA 5FSOA 2I8TA 4S2YA 3N77A 1V8RA 2B0VA 1V8LA 4ICKA 5DDGA 3MDIA 2A8PA 3SMDA 1PUSA 1U20A 3O61A 3X0MA 5LPGA 3X0KA 1PPWA 3MGMA 4JZTA 4S2WA 3Q2SA 1V8YA 1MQEA 3E57A 5DPKA 3Q93A 3FK9A 5GHIA 4K6EA 2A8QA 2W4EA 3KVHA 1HX3A 1X84A 2J8QA 1XSBA 2DSCA 5ANUA 5CFIA 3Q1PA 2B06A 1SZ3A 1KTGA 3COUA 3X0JA 5BS6A 2GT4A 4ZG0A 1MR2A 2JVBA 3GG6A 5GHPA 3ID9A 3SONA 3QSJA 2R5WA 3X0LA 3X0PA 3GZ6A 2O5FA 3OGAA 3X0SA 1SU2A 3X0QA 3J7Ye 3GWYA 4JZUA 4C9XA 1Q54A 1V8SA 1SJYA 4NFWA 3Q4IA 4DYWA 4C9WA 3I9XA 1IRYA 5I8UA 4KG3A 1VHZA 2YVNA 3DKUA 3I7UA 5GHJA 1NQYA 3A6SA 2AZWA 3FFUA 3Q91A 2QKMB 2O1CA 3EESA 5ANTA 3A6VA 3SHDA 2A8TA 2PQVA 3BHOA 2FVVA 5ANVA 5BONA 3Q2TA 3F6AA 2A6TA
chains in the Genus database with same CATH topology
5DEQA 3X0NA 3HHJA 3P5TA 1TUMA 2KDVA 3DUPA 2O5WA 3EF5A 2CZRA 1K26A 3FJYA 1R67A 1NFSA 2A8RA 2FKBA 1SOIA 1VC8A 1XSAA 4KTBA 3MCFA 1V8IA 1V8WA 5ISYA 5C7TA 1PPVA 3WHWA 1VCDA 3A6UA 1G0SA 3AC9A 3CNGA 1VRLA 2RRKA 5GHQA 2VNPA 3GZ8A 2Q9PA 2G73A 2QJTA 1NQZA 3ACAA 4J7GA 1NFZA 2DSDA 2QJOA 3MDGA 1VIUA 2DSBA 4HVYA 1XSCA 1VC9A 5IW4A 3P6YA 2DHOA 4N1TA 3F13A 3BM4A 5ANSA 1G9QA 1KHZA 3GZ5A 3ZR1A 1K2EA 2YVPA 4ILQA 3GRNA 5FSIA 5FSMA 3RH7A 1F3YA 4JZVA 2VNQA 4JZSA 4NFXA 3O6ZA 4YPHA 2XSQA 5C8LA 1JKNA 3EXQA 3HYQA 5ANWA 2A8SA 3X0RA 2I6KA 5C7QA 1RRQA 4J7HA 3ZR0A 2FMLA 3X0OA 5GHMA 1MUTA 1QVJA 3FSPA 2YVMA 2GT2A 3O52A 2GB5A 2B2KA 1V8NA 1HZTA 4KYXA 4S2XA 1PVFA 1V8UA 2CL3A 3BAPA 4HFQA 3O69A 1MP2A 5FSKA 4YPRA 1X83A 4MPOA 2ICJA 1PUNA 1VK6A 1MK1A 1OW2A 3I7VA 5FSLA 2KDWA 1Q33A 1Q27A 2DUKA 2YYHA 3EEUA 3H95A 3X0IA 1V8TA 1MQWA 1X51A 1RYAA 3FCMA 2YVOA 5GHNA 5DD4A 4YOQA 3O8SA 4N1UA 3U53A 4S2VA 5CFJA 1V8VA 4V14A 2I8UA 1V8MA 4KG4A 2ICKA 1KT9A 5IW5A 5FSNA 1PUQA 1VIQA 5GHOA 1PPXA 3L85A 5HZXA 4IJXA 1I9AA 3N9UA 1GA7A 1RRSA 2G74A 3R03A 3A6TA 3G0QA 1VHGA 2PNYA 1JRKA 5FSOA 2I8TA 4S2YA 3N77A 1V8RA 2B0VA 1V8LA 4ICKA 5DDGA 3MDIA 2A8PA 3SMDA 1PUSA 1U20A 3O61A 3X0MA 5LPGA 3X0KA 1PPWA 3MGMA 4JZTA 4S2WA 3Q2SA 1V8YA 1MQEA 3E57A 5DPKA 3Q93A 3FK9A 5GHIA 4K6EA 2A8QA 2W4EA 3KVHA 1HX3A 1X84A 2J8QA 1XSBA 2DSCA 5ANUA 5CFIA 3Q1PA 2B06A 1SZ3A 1KTGA 3COUA 3X0JA 5BS6A 2GT4A 4ZG0A 1MR2A 2JVBA 3GG6A 5GHPA 3ID9A 3SONA 3QSJA 2R5WA 3X0LA 3X0PA 3GZ6A 2O5FA 3OGAA 3X0SA 1SU2A 3X0QA 3J7Ye 3GWYA 4JZUA 4C9XA 1Q54A 1V8SA 1SJYA 4NFWA 3Q4IA 4DYWA 4C9WA 3I9XA 1IRYA 5I8UA 4KG3A 1VHZA 2YVNA 3DKUA 3I7UA 5GHJA 1NQYA 3A6SA 2AZWA 3FFUA 3Q91A 2QKMB 2O1CA 3EESA 5ANTA 3A6VA 3SHDA 2A8TA 2PQVA 3BHOA 2FVVA 5ANVA 5BONA 3Q2TA 3F6AA 2A6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DEQ A;  3X0N A;  3HHJ A;  3P5T A;  1TUM A;  2KDV A;  3DUP A;  2O5W A;  3EF5 A;  1K26 A;  3FJY A;  1R67 A;  1NFS A;  2A8R A;  2FKB A;  1SOI A;  1VC8 A;  1XSA A;  4KTB A;  3MCF A;  1V8I A;  1V8W A;  5ISY A;  5C7T A;  1PPV A;  3WHW A;  1VCD A;  3A6U A;  1G0S A;  3AC9 A;  3CNG A;  1VRL A;  2RRK A;  5GHQ A;  2VNP A;  3GZ8 A;  2Q9P A;  2G73 A;  2QJT A;  1NQZ A;  3ACA A;  1NFZ A;  2DSD A;  2QJO A;  3MDG A;  1VIU A;  2DSB A;  4HVY A;  1XSC A;  1VC9 A;  5IW4 A;  3P6Y A;  2DHO A;  4N1T A;  3F13 A;  3BM4 A;  5ANS A;  1G9Q A;  1KHZ A;  3GZ5 A;  3ZR1 A;  1K2E A;  2YVP A;  4ILQ A;  3GRN A;  5FSI A;  5FSM A;  3RH7 A;  1F3Y A;  4JZV A;  2VNQ A;  4JZS A;  4NFX A;  3O6Z A;  4YPH A;  2XSQ A;  5C8L A;  1JKN A;  3EXQ A;  3HYQ A;  5ANW A;  2A8S A;  3X0R A;  2I6K A;  5C7Q A;  1RRQ A;  3ZR0 A;  2FML A;  3X0O A;  5GHM A;  1MUT A;  1QVJ A;  3FSP A;  2YVM A;  2GT2 A;  3O52 A;  2GB5 A;  2B2K A;  1V8N A;  1HZT A;  4KYX A;  4S2X A;  1PVF A;  1V8U A;  2CL3 A;  3BAP A;  4HFQ A;  3O69 A;  1MP2 A;  5FSK A;  4YPR A;  1X83 A;  4MPO A;  2ICJ A;  1PUN A;  1VK6 A;  1MK1 A;  1OW2 A;  3I7V A;  5FSL A;  2KDW A;  1Q33 A;  1Q27 A;  2DUK A;  2YYH A;  3EEU A;  3H95 A;  3X0I A;  1V8T A;  1MQW A;  1X51 A;  1RYA A;  3FCM A;  2YVO A;  5GHN A;  5DD4 A;  4YOQ A;  3O8S A;  4N1U A;  3U53 A;  4S2V A;  5CFJ A;  1V8V A;  4V14 A;  2I8U A;  1V8M A;  4KG4 A;  2ICK A;  1KT9 A;  5IW5 A;  5FSN A;  1PUQ A;  1VIQ A;  5GHO A;  1PPX A;  3L85 A;  5HZX A;  4IJX A;  1I9A A;  3N9U A;  1GA7 A;  1RRS A;  2G74 A;  3R03 A;  3A6T A;  3G0Q A;  1VHG A;  2PNY A;  1JRK A;  5FSO A;  2I8T A;  4S2Y A;  3N77 A;  1V8R A;  2B0V A;  1V8L A;  4ICK A;  5DDG A;  3MDI A;  2A8P A;  3SMD A;  1PUS A;  1U20 A;  3O61 A;  3X0M A;  5LPG A;  3X0K A;  1PPW A;  3MGM A;  4JZT A;  4S2W A;  3Q2S A;  1V8Y A;  1MQE A;  3E57 A;  5DPK A;  3Q93 A;  3FK9 A;  5GHI A;  4K6E A;  2A8Q A;  2W4E A;  3KVH A;  1HX3 A;  1X84 A;  2J8Q A;  1XSB A;  2DSC A;  5ANU A;  5CFI A;  3Q1P A;  2B06 A;  1SZ3 A;  1KTG A;  3COU A;  3X0J A;  5BS6 A;  2GT4 A;  4ZG0 A;  1MR2 A;  2JVB A;  3GG6 A;  5GHP A;  3ID9 A;  3SON A;  3QSJ A;  2R5W A;  3X0L A;  3X0P A;  3GZ6 A;  2O5F A;  3OGA A;  3X0S A;  1SU2 A;  3X0Q A;  3J7Y e;  3GWY A;  4JZU A;  4C9X A;  1Q54 A;  1V8S A;  1SJY A;  4NFW A;  3Q4I A;  4DYW A;  4C9W A;  3I9X A;  1IRY A;  5I8U A;  4KG3 A;  1VHZ A;  2YVN A;  3DKU A;  3I7U A;  5GHJ A;  1NQY A;  3A6S A;  2AZW A;  3FFU A;  3Q91 A;  2QKM B;  2O1C A;  3EES A;  5ANT A;  3A6V A;  3SHD A;  2A8T A;  2PQV A;  3BHO A;  2FVV A;  5ANV A;  5BON A;  3Q2T A;  3F6A A;  2A6T A; 
#chains in the Genus database with same CATH topology
 5DEQ A;  3X0N A;  3HHJ A;  3P5T A;  1TUM A;  2KDV A;  3DUP A;  2O5W A;  3EF5 A;  2CZR A;  1K26 A;  3FJY A;  1R67 A;  1NFS A;  2A8R A;  2FKB A;  1SOI A;  1VC8 A;  1XSA A;  4KTB A;  3MCF A;  1V8I A;  1V8W A;  5ISY A;  5C7T A;  1PPV A;  3WHW A;  1VCD A;  3A6U A;  1G0S A;  3AC9 A;  3CNG A;  1VRL A;  2RRK A;  5GHQ A;  2VNP A;  3GZ8 A;  2Q9P A;  2G73 A;  2QJT A;  1NQZ A;  3ACA A;  4J7G A;  1NFZ A;  2DSD A;  2QJO A;  3MDG A;  1VIU A;  2DSB A;  4HVY A;  1XSC A;  1VC9 A;  5IW4 A;  3P6Y A;  2DHO A;  4N1T A;  3F13 A;  3BM4 A;  5ANS A;  1G9Q A;  1KHZ A;  3GZ5 A;  3ZR1 A;  1K2E A;  2YVP A;  4ILQ A;  3GRN A;  5FSI A;  5FSM A;  3RH7 A;  1F3Y A;  4JZV A;  2VNQ A;  4JZS A;  4NFX A;  3O6Z A;  4YPH A;  2XSQ A;  5C8L A;  1JKN A;  3EXQ A;  3HYQ A;  5ANW A;  2A8S A;  3X0R A;  2I6K A;  5C7Q A;  1RRQ A;  4J7H A;  3ZR0 A;  2FML A;  3X0O A;  5GHM A;  1MUT A;  1QVJ A;  3FSP A;  2YVM A;  2GT2 A;  3O52 A;  2GB5 A;  2B2K A;  1V8N A;  1HZT A;  4KYX A;  4S2X A;  1PVF A;  1V8U A;  2CL3 A;  3BAP A;  4HFQ A;  3O69 A;  1MP2 A;  5FSK A;  4YPR A;  1X83 A;  4MPO A;  2ICJ A;  1PUN A;  1VK6 A;  1MK1 A;  1OW2 A;  3I7V A;  5FSL A;  2KDW A;  1Q33 A;  1Q27 A;  2DUK A;  2YYH A;  3EEU A;  3H95 A;  3X0I A;  1V8T A;  1MQW A;  1X51 A;  1RYA A;  3FCM A;  2YVO A;  5GHN A;  5DD4 A;  4YOQ A;  3O8S A;  4N1U A;  3U53 A;  4S2V A;  5CFJ A;  1V8V A;  4V14 A;  2I8U A;  1V8M A;  4KG4 A;  2ICK A;  1KT9 A;  5IW5 A;  5FSN A;  1PUQ A;  1VIQ A;  5GHO A;  1PPX A;  3L85 A;  5HZX A;  4IJX A;  1I9A A;  3N9U A;  1GA7 A;  1RRS A;  2G74 A;  3R03 A;  3A6T A;  3G0Q A;  1VHG A;  2PNY A;  1JRK A;  5FSO A;  2I8T A;  4S2Y A;  3N77 A;  1V8R A;  2B0V A;  1V8L A;  4ICK A;  5DDG A;  3MDI A;  2A8P A;  3SMD A;  1PUS A;  1U20 A;  3O61 A;  3X0M A;  5LPG A;  3X0K A;  1PPW A;  3MGM A;  4JZT A;  4S2W A;  3Q2S A;  1V8Y A;  1MQE A;  3E57 A;  5DPK A;  3Q93 A;  3FK9 A;  5GHI A;  4K6E A;  2A8Q A;  2W4E A;  3KVH A;  1HX3 A;  1X84 A;  2J8Q A;  1XSB A;  2DSC A;  5ANU A;  5CFI A;  3Q1P A;  2B06 A;  1SZ3 A;  1KTG A;  3COU A;  3X0J A;  5BS6 A;  2GT4 A;  4ZG0 A;  1MR2 A;  2JVB A;  3GG6 A;  5GHP A;  3ID9 A;  3SON A;  3QSJ A;  2R5W A;  3X0L A;  3X0P A;  3GZ6 A;  2O5F A;  3OGA A;  3X0S A;  1SU2 A;  3X0Q A;  3J7Y e;  3GWY A;  4JZU A;  4C9X A;  1Q54 A;  1V8S A;  1SJY A;  4NFW A;  3Q4I A;  4DYW A;  4C9W A;  3I9X A;  1IRY A;  5I8U A;  4KG3 A;  1VHZ A;  2YVN A;  3DKU A;  3I7U A;  5GHJ A;  1NQY A;  3A6S A;  2AZW A;  3FFU A;  3Q91 A;  2QKM B;  2O1C A;  3EES A;  5ANT A;  3A6V A;  3SHD A;  2A8T A;  2PQV A;  3BHO A;  2FVV A;  5ANV A;  5BON A;  3Q2T A;  3F6A A;  2A6T A; 
#chains in the Genus database with same CATH homology
 5DEQ A;  3X0N A;  3HHJ A;  3P5T A;  1TUM A;  2KDV A;  3DUP A;  2O5W A;  3EF5 A;  2CZR A;  1K26 A;  3FJY A;  1R67 A;  1NFS A;  2A8R A;  2FKB A;  1SOI A;  1VC8 A;  1XSA A;  4KTB A;  3MCF A;  1V8I A;  1V8W A;  5ISY A;  5C7T A;  1PPV A;  3WHW A;  1VCD A;  3A6U A;  1G0S A;  3AC9 A;  3CNG A;  1VRL A;  2RRK A;  5GHQ A;  2VNP A;  3GZ8 A;  2Q9P A;  2G73 A;  2QJT A;  1NQZ A;  3ACA A;  4J7G A;  1NFZ A;  2DSD A;  2QJO A;  3MDG A;  1VIU A;  2DSB A;  4HVY A;  1XSC A;  1VC9 A;  5IW4 A;  3P6Y A;  2DHO A;  4N1T A;  3F13 A;  3BM4 A;  5ANS A;  1G9Q A;  1KHZ A;  3GZ5 A;  3ZR1 A;  1K2E A;  2YVP A;  4ILQ A;  3GRN A;  5FSI A;  5FSM A;  3RH7 A;  1F3Y A;  4JZV A;  2VNQ A;  4JZS A;  4NFX A;  3O6Z A;  4YPH A;  2XSQ A;  5C8L A;  1JKN A;  3EXQ A;  3HYQ A;  5ANW A;  2A8S A;  3X0R A;  2I6K A;  5C7Q A;  1RRQ A;  4J7H A;  3ZR0 A;  2FML A;  3X0O A;  5GHM A;  1MUT A;  1QVJ A;  3FSP A;  2YVM A;  2GT2 A;  3O52 A;  2GB5 A;  2B2K A;  1V8N A;  1HZT A;  4KYX A;  4S2X A;  1PVF A;  1V8U A;  2CL3 A;  3BAP A;  4HFQ A;  3O69 A;  1MP2 A;  5FSK A;  4YPR A;  1X83 A;  4MPO A;  2ICJ A;  1PUN A;  1VK6 A;  1MK1 A;  1OW2 A;  3I7V A;  5FSL A;  2KDW A;  1Q33 A;  1Q27 A;  2DUK A;  2YYH A;  3EEU A;  3H95 A;  3X0I A;  1V8T A;  1MQW A;  1X51 A;  1RYA A;  3FCM A;  2YVO A;  5GHN A;  5DD4 A;  4YOQ A;  3O8S A;  4N1U A;  3U53 A;  4S2V A;  5CFJ A;  1V8V A;  4V14 A;  2I8U A;  1V8M A;  4KG4 A;  2ICK A;  1KT9 A;  5IW5 A;  5FSN A;  1PUQ A;  1VIQ A;  5GHO A;  1PPX A;  3L85 A;  5HZX A;  4IJX A;  1I9A A;  3N9U A;  1GA7 A;  1RRS A;  2G74 A;  3R03 A;  3A6T A;  3G0Q A;  1VHG A;  2PNY A;  1JRK A;  5FSO A;  2I8T A;  4S2Y A;  3N77 A;  1V8R A;  2B0V A;  1V8L A;  4ICK A;  5DDG A;  3MDI A;  2A8P A;  3SMD A;  1PUS A;  1U20 A;  3O61 A;  3X0M A;  5LPG A;  3X0K A;  1PPW A;  3MGM A;  4JZT A;  4S2W A;  3Q2S A;  1V8Y A;  1MQE A;  3E57 A;  5DPK A;  3Q93 A;  3FK9 A;  5GHI A;  4K6E A;  2A8Q A;  2W4E A;  3KVH A;  1HX3 A;  1X84 A;  2J8Q A;  1XSB A;  2DSC A;  5ANU A;  5CFI A;  3Q1P A;  2B06 A;  1SZ3 A;  1KTG A;  3COU A;  3X0J A;  5BS6 A;  2GT4 A;  4ZG0 A;  1MR2 A;  2JVB A;  3GG6 A;  5GHP A;  3ID9 A;  3SON A;  3QSJ A;  2R5W A;  3X0L A;  3X0P A;  3GZ6 A;  2O5F A;  3OGA A;  3X0S A;  1SU2 A;  3X0Q A;  3J7Y e;  3GWY A;  4JZU A;  4C9X A;  1Q54 A;  1V8S A;  1SJY A;  4NFW A;  3Q4I A;  4DYW A;  4C9W A;  3I9X A;  1IRY A;  5I8U A;  4KG3 A;  1VHZ A;  2YVN A;  3DKU A;  3I7U A;  5GHJ A;  1NQY A;  3A6S A;  2AZW A;  3FFU A;  3Q91 A;  2QKM B;  2O1C A;  3EES A;  5ANT A;  3A6V A;  3SHD A;  2A8T A;  2PQV A;  3BHO A;  2FVV A;  5ANV A;  5BON A;  3Q2T A;  3F6A A;  2A6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...