4N1UA

Structure of human mth1 in complex with th588
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
153
structure length
153
Chain Sequence
ASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7,8-dihydro-8-oxoguanine triphosphatase
publication title MTH1 inhibition eradicates cancer by preventing sanitation of the dNTP pool.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 38
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2013-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 4n1uA00
4KTBA 1V8WA 2A8RA 2B0VA 5C8LA 4NFWA 5DDGA 1MR2A 4JZSA 5ANTA 1QVJA 4ZG0A 1V8VA 1PPWA 3BHOA 5BS6A 5ANWA 3X0RA 1PUSA 1SZ3A 3F6AA 3FCMA 2FVVA 3E57A 3ID9A 5GHMA 5ANUA 1G0SA 1XSAA 3X0NA 4C9XA 2W4EA 3COUA 4NFXA 1PPXA 2YVMA 3H95A 4S2VA 4KYXA 5GHJA 2YYHA 4K6EA 3QSJA 3FFUA 2G73A 5HZXA 1GA7A 1VK6A 3WHWA 4V14A 3R03A 2CL3A 1MK1A 5C7TA 4JZUA 3A6VA 3ACAA 5DPKA 3EESA 5C7QA 1SJYA 3GWYA 1VC9A 1V8LA 1PVFA 3P5TA 5ANVA 2A8SA 2O5WA 2A6TA 3F13A 3FSPA 2RRKA 1Q54A 3GG6A 1VHGA 1XSBA 2A8TA 2B2KA 2QJTA 4YPHA 1NQYA 2DSDA 4JZTA 1V8UA 5GHQA 4N1UA 1JKNA 4ILQA 5IW5A 3GZ8A 3AC9A 4C9WA 3MCFA 2PQVA 3HHJA 3J7Ye 2YVOA 1R67A 1PPVA 1HX3A 1V8MA 3A6SA 1JRKA 2YVNA 3I7UA 3SMDA 3DKUA 4YPRA 4S2YA 5BONA 4S2XA 1VCDA 2GB5A 3X0SA 2KDVA 3MDGA 3N9UA 2AZWA 3O52A 5FSOA 1V8YA 3ZR0A 4S2WA 3EF5A 3O69A 2ICJA 2PNYA 2R5WA 2I8TA 2GT4A 2A8QA 3EXQA 3L85A 1V8SA 3N77A 4HFQA 1Q27A 3O8SA 3X0JA 5CFIA 5GHPA 2A8PA 2J8QA 3EEUA 4ICKA 3O61A 1V8IA 1PUNA 3Q1PA 3SHDA 1NQZA 2GT2A 1VIQA 5CFJA 1SU2A 2DUKA 2FMLA 2DSBA 2QKMB 3A6UA 2O1CA 2XSQA 3HYQA 3Q2SA 1I9AA 3CNGA 2YVPA 5FSIA 3U53A 2JVBA 4YOQA 3MGMA 3GZ6A 5LPGA 2I6KA 1KT9A 5ANSA 3DUPA 1VIUA 5GHIA 5FSNA 5FSMA 3X0IA 2Q9PA 2G74A 3GRNA 2FKBA 5ISYA 4IJXA 1VC8A 3A6TA 5DEQA 1V8NA 3I7VA 1K26A 4KG4A 5I8UA 1X83A 4MPOA 3Q2TA 3O6ZA 3Q4IA 2QJOA 1RYAA 3FJYA 1RRSA 3MDIA 4N1TA 1G9QA 4DYWA 1MQEA 1V8RA 1XSCA 3X0PA 3G0QA 1KTGA 2DHOA 5IW4A 1X84A 2O5FA 3X0QA 3BM4A 1NFSA 2KDWA 1TUMA 2I8UA 3FK9A 4HVYA 3X0KA 3Q93A 1SOIA 3ZR1A 4JZVA 5FSKA 5DD4A 2B06A 3GZ5A 1VHZA 1HZTA 5GHOA 3KVHA 1KHZA 3Q91A 5FSLA 3X0OA 3X0MA 3RH7A 1OW2A 1PUQA 2VNPA 3SONA 1MP2A 2ICKA 2VNQA 4KG3A 1IRYA 1X51A 1RRQA 1U20A 1V8TA 1K2EA 1MUTA 1MQWA 2DSCA 3BAPA 3OGAA 5GHNA 3X0LA 1Q33A 3P6YA 1NFZA 3I9XA 1F3YA 1VRLA
chains in the Genus database with same CATH superfamily
4KTBA 1V8WA 2A8RA 2B0VA 5C8LA 4NFWA 5DDGA 1MR2A 4JZSA 5ANTA 1QVJA 2CZRA 4ZG0A 1V8VA 1PPWA 3BHOA 5BS6A 5ANWA 3X0RA 1PUSA 1SZ3A 3F6AA 3FCMA 2FVVA 3E57A 3ID9A 5GHMA 5ANUA 1G0SA 1XSAA 3X0NA 4C9XA 2W4EA 3COUA 4NFXA 1PPXA 2YVMA 3H95A 4S2VA 4KYXA 5GHJA 2YYHA 4K6EA 3QSJA 3FFUA 2G73A 4J7HA 5HZXA 1GA7A 1VK6A 3WHWA 4V14A 3R03A 2CL3A 1MK1A 5C7TA 4J7GA 4JZUA 3A6VA 3ACAA 5DPKA 3EESA 5C7QA 1SJYA 3GWYA 1VC9A 1V8LA 1PVFA 3P5TA 5ANVA 2A8SA 2O5WA 2A6TA 3F13A 3FSPA 2RRKA 1Q54A 3GG6A 1VHGA 1XSBA 2A8TA 2B2KA 2QJTA 4YPHA 1NQYA 2DSDA 4JZTA 1V8UA 5GHQA 4N1UA 1JKNA 4ILQA 5IW5A 3GZ8A 3AC9A 4C9WA 3MCFA 2PQVA 3HHJA 3J7Ye 2YVOA 1R67A 1PPVA 1HX3A 1V8MA 3A6SA 1JRKA 2YVNA 3I7UA 3SMDA 3DKUA 4YPRA 4S2YA 5BONA 4S2XA 1VCDA 2GB5A 3X0SA 2KDVA 3MDGA 3N9UA 2AZWA 3O52A 5FSOA 1V8YA 3ZR0A 4S2WA 3EF5A 3O69A 2ICJA 2PNYA 2R5WA 2I8TA 2GT4A 2A8QA 3EXQA 3L85A 1V8SA 3N77A 4HFQA 1Q27A 3O8SA 3X0JA 5CFIA 5GHPA 2A8PA 2J8QA 3EEUA 4ICKA 3O61A 1V8IA 1PUNA 3Q1PA 3SHDA 1NQZA 2GT2A 1VIQA 5CFJA 1SU2A 2DUKA 2FMLA 2DSBA 2QKMB 3A6UA 2O1CA 2XSQA 3HYQA 3Q2SA 1I9AA 3CNGA 2YVPA 5FSIA 3U53A 2JVBA 4YOQA 3MGMA 3GZ6A 5LPGA 2I6KA 1KT9A 5ANSA 3DUPA 1VIUA 5GHIA 5FSNA 5FSMA 3X0IA 2Q9PA 2G74A 3GRNA 2FKBA 5ISYA 4IJXA 1VC8A 3A6TA 5DEQA 1V8NA 3I7VA 1K26A 4KG4A 5I8UA 1X83A 4MPOA 3Q2TA 3O6ZA 3Q4IA 2QJOA 1RYAA 3FJYA 1RRSA 3MDIA 4N1TA 1G9QA 4DYWA 1MQEA 1V8RA 1XSCA 3X0PA 3G0QA 1KTGA 2DHOA 5IW4A 1X84A 2O5FA 3X0QA 3BM4A 1NFSA 2KDWA 1TUMA 2I8UA 3FK9A 4HVYA 3X0KA 3Q93A 1SOIA 3ZR1A 4JZVA 5FSKA 5DD4A 2B06A 3GZ5A 1VHZA 1HZTA 5GHOA 3KVHA 1KHZA 3Q91A 5FSLA 3X0OA 3X0MA 3RH7A 1OW2A 1PUQA 2VNPA 3SONA 1MP2A 2ICKA 2VNQA 4KG3A 1IRYA 1X51A 1RRQA 1U20A 1V8TA 1K2EA 1MUTA 1MQWA 2DSCA 3BAPA 3OGAA 5GHNA 3X0LA 1Q33A 3P6YA 1NFZA 3I9XA 1F3YA 1VRLA
chains in the Genus database with same CATH topology
4KTBA 1V8WA 2A8RA 2B0VA 5C8LA 4NFWA 5DDGA 1MR2A 4JZSA 5ANTA 1QVJA 2CZRA 4ZG0A 1V8VA 1PPWA 3BHOA 5BS6A 5ANWA 3X0RA 1PUSA 1SZ3A 3F6AA 3FCMA 2FVVA 3E57A 3ID9A 5GHMA 5ANUA 1G0SA 1XSAA 3X0NA 4C9XA 2W4EA 3COUA 4NFXA 1PPXA 2YVMA 3H95A 4S2VA 4KYXA 5GHJA 2YYHA 4K6EA 3QSJA 3FFUA 2G73A 4J7HA 5HZXA 1GA7A 1VK6A 3WHWA 4V14A 3R03A 2CL3A 1MK1A 5C7TA 4J7GA 4JZUA 3A6VA 3ACAA 5DPKA 3EESA 5C7QA 1SJYA 3GWYA 1VC9A 1V8LA 1PVFA 3P5TA 5ANVA 2A8SA 2O5WA 2A6TA 3F13A 3FSPA 2RRKA 1Q54A 3GG6A 1VHGA 1XSBA 2A8TA 2B2KA 2QJTA 4YPHA 1NQYA 2DSDA 4JZTA 1V8UA 5GHQA 4N1UA 1JKNA 4ILQA 5IW5A 3GZ8A 3AC9A 4C9WA 3MCFA 2PQVA 3HHJA 3J7Ye 2YVOA 1R67A 1PPVA 1HX3A 1V8MA 3A6SA 1JRKA 2YVNA 3I7UA 3SMDA 3DKUA 4YPRA 4S2YA 5BONA 4S2XA 1VCDA 2GB5A 3X0SA 2KDVA 3MDGA 3N9UA 2AZWA 3O52A 5FSOA 1V8YA 3ZR0A 4S2WA 3EF5A 3O69A 2ICJA 2PNYA 2R5WA 2I8TA 2GT4A 2A8QA 3EXQA 3L85A 1V8SA 3N77A 4HFQA 1Q27A 3O8SA 3X0JA 5CFIA 5GHPA 2A8PA 2J8QA 3EEUA 4ICKA 3O61A 1V8IA 1PUNA 3Q1PA 3SHDA 1NQZA 2GT2A 1VIQA 5CFJA 1SU2A 2DUKA 2FMLA 2DSBA 2QKMB 3A6UA 2O1CA 2XSQA 3HYQA 3Q2SA 1I9AA 3CNGA 2YVPA 5FSIA 3U53A 2JVBA 4YOQA 3MGMA 3GZ6A 5LPGA 2I6KA 1KT9A 5ANSA 3DUPA 1VIUA 5GHIA 5FSNA 5FSMA 3X0IA 2Q9PA 2G74A 3GRNA 2FKBA 5ISYA 4IJXA 1VC8A 3A6TA 5DEQA 1V8NA 3I7VA 1K26A 4KG4A 5I8UA 1X83A 4MPOA 3Q2TA 3O6ZA 3Q4IA 2QJOA 1RYAA 3FJYA 1RRSA 3MDIA 4N1TA 1G9QA 4DYWA 1MQEA 1V8RA 1XSCA 3X0PA 3G0QA 1KTGA 2DHOA 5IW4A 1X84A 2O5FA 3X0QA 3BM4A 1NFSA 2KDWA 1TUMA 2I8UA 3FK9A 4HVYA 3X0KA 3Q93A 1SOIA 3ZR1A 4JZVA 5FSKA 5DD4A 2B06A 3GZ5A 1VHZA 1HZTA 5GHOA 3KVHA 1KHZA 3Q91A 5FSLA 3X0OA 3X0MA 3RH7A 1OW2A 1PUQA 2VNPA 3SONA 1MP2A 2ICKA 2VNQA 4KG3A 1IRYA 1X51A 1RRQA 1U20A 1V8TA 1K2EA 1MUTA 1MQWA 2DSCA 3BAPA 3OGAA 5GHNA 3X0LA 1Q33A 3P6YA 1NFZA 3I9XA 1F3YA 1VRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KTB A;  1V8W A;  2A8R A;  2B0V A;  5C8L A;  4NFW A;  5DDG A;  1MR2 A;  4JZS A;  5ANT A;  1QVJ A;  4ZG0 A;  1V8V A;  1PPW A;  3BHO A;  5BS6 A;  5ANW A;  3X0R A;  1PUS A;  1SZ3 A;  3F6A A;  3FCM A;  2FVV A;  3E57 A;  3ID9 A;  5GHM A;  5ANU A;  1G0S A;  1XSA A;  3X0N A;  4C9X A;  2W4E A;  3COU A;  4NFX A;  1PPX A;  2YVM A;  3H95 A;  4S2V A;  4KYX A;  5GHJ A;  2YYH A;  4K6E A;  3QSJ A;  3FFU A;  2G73 A;  5HZX A;  1GA7 A;  1VK6 A;  3WHW A;  4V14 A;  3R03 A;  2CL3 A;  1MK1 A;  5C7T A;  4JZU A;  3A6V A;  3ACA A;  5DPK A;  3EES A;  5C7Q A;  1SJY A;  3GWY A;  1VC9 A;  1V8L A;  1PVF A;  3P5T A;  5ANV A;  2A8S A;  2O5W A;  2A6T A;  3F13 A;  3FSP A;  2RRK A;  1Q54 A;  3GG6 A;  1VHG A;  1XSB A;  2A8T A;  2B2K A;  2QJT A;  4YPH A;  1NQY A;  2DSD A;  4JZT A;  1V8U A;  5GHQ A;  4N1U A;  1JKN A;  4ILQ A;  5IW5 A;  3GZ8 A;  3AC9 A;  4C9W A;  3MCF A;  2PQV A;  3HHJ A;  3J7Y e;  2YVO A;  1R67 A;  1PPV A;  1HX3 A;  1V8M A;  3A6S A;  1JRK A;  2YVN A;  3I7U A;  3SMD A;  3DKU A;  4YPR A;  4S2Y A;  5BON A;  4S2X A;  1VCD A;  2GB5 A;  3X0S A;  2KDV A;  3MDG A;  3N9U A;  2AZW A;  3O52 A;  5FSO A;  1V8Y A;  3ZR0 A;  4S2W A;  3EF5 A;  3O69 A;  2ICJ A;  2PNY A;  2R5W A;  2I8T A;  2GT4 A;  2A8Q A;  3EXQ A;  3L85 A;  1V8S A;  3N77 A;  4HFQ A;  1Q27 A;  3O8S A;  3X0J A;  5CFI A;  5GHP A;  2A8P A;  2J8Q A;  3EEU A;  4ICK A;  3O61 A;  1V8I A;  1PUN A;  3Q1P A;  3SHD A;  1NQZ A;  2GT2 A;  1VIQ A;  5CFJ A;  1SU2 A;  2DUK A;  2FML A;  2DSB A;  2QKM B;  3A6U A;  2O1C A;  2XSQ A;  3HYQ A;  3Q2S A;  1I9A A;  3CNG A;  2YVP A;  5FSI A;  3U53 A;  2JVB A;  4YOQ A;  3MGM A;  3GZ6 A;  5LPG A;  2I6K A;  1KT9 A;  5ANS A;  3DUP A;  1VIU A;  5GHI A;  5FSN A;  5FSM A;  3X0I A;  2Q9P A;  2G74 A;  3GRN A;  2FKB A;  5ISY A;  4IJX A;  1VC8 A;  3A6T A;  5DEQ A;  1V8N A;  3I7V A;  1K26 A;  4KG4 A;  5I8U A;  1X83 A;  4MPO A;  3Q2T A;  3O6Z A;  3Q4I A;  2QJO A;  1RYA A;  3FJY A;  1RRS A;  3MDI A;  4N1T A;  1G9Q A;  4DYW A;  1MQE A;  1V8R A;  1XSC A;  3X0P A;  3G0Q A;  1KTG A;  2DHO A;  5IW4 A;  1X84 A;  2O5F A;  3X0Q A;  3BM4 A;  1NFS A;  2KDW A;  1TUM A;  2I8U A;  3FK9 A;  4HVY A;  3X0K A;  3Q93 A;  1SOI A;  3ZR1 A;  4JZV A;  5FSK A;  5DD4 A;  2B06 A;  3GZ5 A;  1VHZ A;  1HZT A;  5GHO A;  3KVH A;  1KHZ A;  3Q91 A;  5FSL A;  3X0O A;  3X0M A;  3RH7 A;  1OW2 A;  1PUQ A;  2VNP A;  3SON A;  1MP2 A;  2ICK A;  2VNQ A;  4KG3 A;  1IRY A;  1X51 A;  1RRQ A;  1U20 A;  1V8T A;  1K2E A;  1MUT A;  1MQW A;  2DSC A;  3BAP A;  3OGA A;  5GHN A;  3X0L A;  1Q33 A;  3P6Y A;  1NFZ A;  3I9X A;  1F3Y A;  1VRL A; 
#chains in the Genus database with same CATH topology
 4KTB A;  1V8W A;  2A8R A;  2B0V A;  5C8L A;  4NFW A;  5DDG A;  1MR2 A;  4JZS A;  5ANT A;  1QVJ A;  2CZR A;  4ZG0 A;  1V8V A;  1PPW A;  3BHO A;  5BS6 A;  5ANW A;  3X0R A;  1PUS A;  1SZ3 A;  3F6A A;  3FCM A;  2FVV A;  3E57 A;  3ID9 A;  5GHM A;  5ANU A;  1G0S A;  1XSA A;  3X0N A;  4C9X A;  2W4E A;  3COU A;  4NFX A;  1PPX A;  2YVM A;  3H95 A;  4S2V A;  4KYX A;  5GHJ A;  2YYH A;  4K6E A;  3QSJ A;  3FFU A;  2G73 A;  4J7H A;  5HZX A;  1GA7 A;  1VK6 A;  3WHW A;  4V14 A;  3R03 A;  2CL3 A;  1MK1 A;  5C7T A;  4J7G A;  4JZU A;  3A6V A;  3ACA A;  5DPK A;  3EES A;  5C7Q A;  1SJY A;  3GWY A;  1VC9 A;  1V8L A;  1PVF A;  3P5T A;  5ANV A;  2A8S A;  2O5W A;  2A6T A;  3F13 A;  3FSP A;  2RRK A;  1Q54 A;  3GG6 A;  1VHG A;  1XSB A;  2A8T A;  2B2K A;  2QJT A;  4YPH A;  1NQY A;  2DSD A;  4JZT A;  1V8U A;  5GHQ A;  4N1U A;  1JKN A;  4ILQ A;  5IW5 A;  3GZ8 A;  3AC9 A;  4C9W A;  3MCF A;  2PQV A;  3HHJ A;  3J7Y e;  2YVO A;  1R67 A;  1PPV A;  1HX3 A;  1V8M A;  3A6S A;  1JRK A;  2YVN A;  3I7U A;  3SMD A;  3DKU A;  4YPR A;  4S2Y A;  5BON A;  4S2X A;  1VCD A;  2GB5 A;  3X0S A;  2KDV A;  3MDG A;  3N9U A;  2AZW A;  3O52 A;  5FSO A;  1V8Y A;  3ZR0 A;  4S2W A;  3EF5 A;  3O69 A;  2ICJ A;  2PNY A;  2R5W A;  2I8T A;  2GT4 A;  2A8Q A;  3EXQ A;  3L85 A;  1V8S A;  3N77 A;  4HFQ A;  1Q27 A;  3O8S A;  3X0J A;  5CFI A;  5GHP A;  2A8P A;  2J8Q A;  3EEU A;  4ICK A;  3O61 A;  1V8I A;  1PUN A;  3Q1P A;  3SHD A;  1NQZ A;  2GT2 A;  1VIQ A;  5CFJ A;  1SU2 A;  2DUK A;  2FML A;  2DSB A;  2QKM B;  3A6U A;  2O1C A;  2XSQ A;  3HYQ A;  3Q2S A;  1I9A A;  3CNG A;  2YVP A;  5FSI A;  3U53 A;  2JVB A;  4YOQ A;  3MGM A;  3GZ6 A;  5LPG A;  2I6K A;  1KT9 A;  5ANS A;  3DUP A;  1VIU A;  5GHI A;  5FSN A;  5FSM A;  3X0I A;  2Q9P A;  2G74 A;  3GRN A;  2FKB A;  5ISY A;  4IJX A;  1VC8 A;  3A6T A;  5DEQ A;  1V8N A;  3I7V A;  1K26 A;  4KG4 A;  5I8U A;  1X83 A;  4MPO A;  3Q2T A;  3O6Z A;  3Q4I A;  2QJO A;  1RYA A;  3FJY A;  1RRS A;  3MDI A;  4N1T A;  1G9Q A;  4DYW A;  1MQE A;  1V8R A;  1XSC A;  3X0P A;  3G0Q A;  1KTG A;  2DHO A;  5IW4 A;  1X84 A;  2O5F A;  3X0Q A;  3BM4 A;  1NFS A;  2KDW A;  1TUM A;  2I8U A;  3FK9 A;  4HVY A;  3X0K A;  3Q93 A;  1SOI A;  3ZR1 A;  4JZV A;  5FSK A;  5DD4 A;  2B06 A;  3GZ5 A;  1VHZ A;  1HZT A;  5GHO A;  3KVH A;  1KHZ A;  3Q91 A;  5FSL A;  3X0O A;  3X0M A;  3RH7 A;  1OW2 A;  1PUQ A;  2VNP A;  3SON A;  1MP2 A;  2ICK A;  2VNQ A;  4KG3 A;  1IRY A;  1X51 A;  1RRQ A;  1U20 A;  1V8T A;  1K2E A;  1MUT A;  1MQW A;  2DSC A;  3BAP A;  3OGA A;  5GHN A;  3X0L A;  1Q33 A;  3P6Y A;  1NFZ A;  3I9X A;  1F3Y A;  1VRL A; 
#chains in the Genus database with same CATH homology
 4KTB A;  1V8W A;  2A8R A;  2B0V A;  5C8L A;  4NFW A;  5DDG A;  1MR2 A;  4JZS A;  5ANT A;  1QVJ A;  2CZR A;  4ZG0 A;  1V8V A;  1PPW A;  3BHO A;  5BS6 A;  5ANW A;  3X0R A;  1PUS A;  1SZ3 A;  3F6A A;  3FCM A;  2FVV A;  3E57 A;  3ID9 A;  5GHM A;  5ANU A;  1G0S A;  1XSA A;  3X0N A;  4C9X A;  2W4E A;  3COU A;  4NFX A;  1PPX A;  2YVM A;  3H95 A;  4S2V A;  4KYX A;  5GHJ A;  2YYH A;  4K6E A;  3QSJ A;  3FFU A;  2G73 A;  4J7H A;  5HZX A;  1GA7 A;  1VK6 A;  3WHW A;  4V14 A;  3R03 A;  2CL3 A;  1MK1 A;  5C7T A;  4J7G A;  4JZU A;  3A6V A;  3ACA A;  5DPK A;  3EES A;  5C7Q A;  1SJY A;  3GWY A;  1VC9 A;  1V8L A;  1PVF A;  3P5T A;  5ANV A;  2A8S A;  2O5W A;  2A6T A;  3F13 A;  3FSP A;  2RRK A;  1Q54 A;  3GG6 A;  1VHG A;  1XSB A;  2A8T A;  2B2K A;  2QJT A;  4YPH A;  1NQY A;  2DSD A;  4JZT A;  1V8U A;  5GHQ A;  4N1U A;  1JKN A;  4ILQ A;  5IW5 A;  3GZ8 A;  3AC9 A;  4C9W A;  3MCF A;  2PQV A;  3HHJ A;  3J7Y e;  2YVO A;  1R67 A;  1PPV A;  1HX3 A;  1V8M A;  3A6S A;  1JRK A;  2YVN A;  3I7U A;  3SMD A;  3DKU A;  4YPR A;  4S2Y A;  5BON A;  4S2X A;  1VCD A;  2GB5 A;  3X0S A;  2KDV A;  3MDG A;  3N9U A;  2AZW A;  3O52 A;  5FSO A;  1V8Y A;  3ZR0 A;  4S2W A;  3EF5 A;  3O69 A;  2ICJ A;  2PNY A;  2R5W A;  2I8T A;  2GT4 A;  2A8Q A;  3EXQ A;  3L85 A;  1V8S A;  3N77 A;  4HFQ A;  1Q27 A;  3O8S A;  3X0J A;  5CFI A;  5GHP A;  2A8P A;  2J8Q A;  3EEU A;  4ICK A;  3O61 A;  1V8I A;  1PUN A;  3Q1P A;  3SHD A;  1NQZ A;  2GT2 A;  1VIQ A;  5CFJ A;  1SU2 A;  2DUK A;  2FML A;  2DSB A;  2QKM B;  3A6U A;  2O1C A;  2XSQ A;  3HYQ A;  3Q2S A;  1I9A A;  3CNG A;  2YVP A;  5FSI A;  3U53 A;  2JVB A;  4YOQ A;  3MGM A;  3GZ6 A;  5LPG A;  2I6K A;  1KT9 A;  5ANS A;  3DUP A;  1VIU A;  5GHI A;  5FSN A;  5FSM A;  3X0I A;  2Q9P A;  2G74 A;  3GRN A;  2FKB A;  5ISY A;  4IJX A;  1VC8 A;  3A6T A;  5DEQ A;  1V8N A;  3I7V A;  1K26 A;  4KG4 A;  5I8U A;  1X83 A;  4MPO A;  3Q2T A;  3O6Z A;  3Q4I A;  2QJO A;  1RYA A;  3FJY A;  1RRS A;  3MDI A;  4N1T A;  1G9Q A;  4DYW A;  1MQE A;  1V8R A;  1XSC A;  3X0P A;  3G0Q A;  1KTG A;  2DHO A;  5IW4 A;  1X84 A;  2O5F A;  3X0Q A;  3BM4 A;  1NFS A;  2KDW A;  1TUM A;  2I8U A;  3FK9 A;  4HVY A;  3X0K A;  3Q93 A;  1SOI A;  3ZR1 A;  4JZV A;  5FSK A;  5DD4 A;  2B06 A;  3GZ5 A;  1VHZ A;  1HZT A;  5GHO A;  3KVH A;  1KHZ A;  3Q91 A;  5FSL A;  3X0O A;  3X0M A;  3RH7 A;  1OW2 A;  1PUQ A;  2VNP A;  3SON A;  1MP2 A;  2ICK A;  2VNQ A;  4KG3 A;  1IRY A;  1X51 A;  1RRQ A;  1U20 A;  1V8T A;  1K2E A;  1MUT A;  1MQW A;  2DSC A;  3BAP A;  3OGA A;  5GHN A;  3X0L A;  1Q33 A;  3P6Y A;  1NFZ A;  3I9X A;  1F3Y A;  1VRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...