4N1UA

Structure of human mth1 in complex with th588
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
153
structure length
153
Chain Sequence
ASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 7,8-dihydro-8-oxoguanine triphosphatase
publication title MTH1 inhibition eradicates cancer by preventing sanitation of the dNTP pool.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2013-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 4n1uA00
3I9XA 3R03A 5FSNA 2FMLA 2YVNA 1XSCA 4N1TA 1V8YA 3X0JA 4C9XA 5BONA 2PNYA 4K6EA 2I8UA 3MCFA 1V8NA 2DHOA 2VNQA 4JZTA 3X0NA 3ZR1A 3Q2TA 4JZUA 4MPOA 3A6TA 2YVMA 3A6SA 3GZ5A 5FSIA 1V8TA 3F6AA 4ICKA 3X0IA 5DDGA 1JKNA 1NFZA 1V8RA 1MK1A 3I7VA 1I9AA 3GZ6A 1X51A 3N9UA 1V8SA 4JZSA 5DPKA 1PVFA 1QVJA 4KTBA 3FK9A 1KT9A 2W4EA 4V14A 5GHIA 1PPVA 2GT2A 3GWYA 1SZ3A 3BHOA 1KHZA 5GHMA 5DEQA 4YOQA 2FVVA 1MP2A 3KVHA 1VHZA 2QJTA 1VHGA 3DKUA 3A6VA 4IJXA 1SJYA 1VIUA 1MR2A 2RRKA 1IRYA 1G9QA 2J8QA 1RRQA 2QKMB 3FCMA 3ID9A 3O52A 3O6ZA 5BS6A 4YPHA 4KG3A 3F13A 2VNPA 2XSQA 3HHJA 3MGMA 3COUA 5GHPA 5FSKA 1V8VA 1PPWA 4C9WA 3P5TA 5C7TA 1NQZA 1VIQA 2AZWA 2CL3A 2ICJA 3O8SA 4HFQA 5ANVA 2DSCA 3A6UA 3L85A 1NFSA 3ACAA 4DYWA 2A6TA 2KDVA 2B0VA 5ANSA 3MDGA 3O61A 4N1UA 3BM4A 3O69A 3Q93A 1TUMA 1X84A 2O5WA 5GHOA 1RRSA 5GHNA 2R5WA 2I8TA 4ILQA 2G74A 5C8LA 3SONA 5C7QA 3X0RA 3EF5A 3ZR0A 5ANTA 2B2KA 1V8MA 4HVYA 2G73A 2O5FA 3GG6A 2GB5A 5IW5A 2DSDA 1X83A 1KTGA 3X0MA 5DD4A 3RH7A 1RYAA 3H95A 3X0QA 4YPRA 1JRKA 3J7Ye 1VC9A 1MQEA 3SMDA 3X0KA 1V8WA 5HZXA 5FSMA 1V8LA 5CFIA 1F3YA 3FJYA 3OGAA 4KG4A 2Q9PA 3EEUA 2I6KA 3QSJA 2A8TA 5GHJA 2DUKA 5ISYA 1V8UA 1PUSA 2A8QA 4S2XA 1Q33A 3BAPA 5FSOA 3SHDA 5I8UA 1Q54A 3FSPA 1HZTA 2B06A 4S2VA 1VRLA 1GA7A 1PUNA 2A8RA 1VC8A 5ANUA 3WHWA 3X0SA 1HX3A 1PPXA 1NQYA 3E57A 1MUTA 4NFWA 3MDIA 3GRNA 3EESA 5ANWA 3AC9A 2ICKA 3I7UA 1SOIA 2A8SA 2GT4A 5FSLA 1XSBA 3G0QA 1VK6A 1PUQA 1SU2A 2O1CA 2DSBA 2PQVA 5IW4A 4JZVA 5GHQA 2YYHA 1U20A 3DUPA 5CFJA 1XSAA 3HYQA 1Q27A 1K26A 2YVPA 1G0SA 3Q1PA 2FKBA 1VCDA 3P6YA 1OW2A 3X0OA 2A8PA 2KDWA 4S2WA 3X0LA 1R67A 2YVOA 3GZ8A 3Q91A 2JVBA 1V8IA 1K2EA 3Q4IA 3CNGA 4NFXA 2QJOA 4KYXA 3X0PA 1MQWA 3FFUA 4S2YA 3EXQA 3Q2SA 3U53A 5LPGA 4ZG0A 3N77A
chains in the Genus database with same CATH superfamily
3I9XA 3R03A 5FSNA 2FMLA 2YVNA 1XSCA 4N1TA 1V8YA 3X0JA 4C9XA 5BONA 2PNYA 4K6EA 2I8UA 3MCFA 1V8NA 2DHOA 2VNQA 4JZTA 3X0NA 3ZR1A 3Q2TA 4JZUA 4MPOA 3A6TA 2YVMA 3A6SA 3GZ5A 5FSIA 1V8TA 3F6AA 4ICKA 3X0IA 5DDGA 1JKNA 1NFZA 1V8RA 1MK1A 3I7VA 1I9AA 3GZ6A 1X51A 3N9UA 1V8SA 4JZSA 5DPKA 1PVFA 1QVJA 4KTBA 3FK9A 1KT9A 2W4EA 4V14A 5GHIA 1PPVA 2GT2A 3GWYA 1SZ3A 3BHOA 1KHZA 5GHMA 5DEQA 4YOQA 2FVVA 1MP2A 3KVHA 1VHZA 2QJTA 1VHGA 3DKUA 3A6VA 4IJXA 1SJYA 1VIUA 1MR2A 2RRKA 1IRYA 1G9QA 2J8QA 1RRQA 2QKMB 3FCMA 3ID9A 3O52A 3O6ZA 5BS6A 4YPHA 4KG3A 4J7HA 3F13A 2VNPA 2XSQA 3HHJA 3MGMA 3COUA 5GHPA 5FSKA 1V8VA 1PPWA 4C9WA 3P5TA 5C7TA 1NQZA 1VIQA 2AZWA 2CL3A 2ICJA 3O8SA 4HFQA 5ANVA 2DSCA 3A6UA 3L85A 1NFSA 3ACAA 4DYWA 2A6TA 2KDVA 2B0VA 5ANSA 3MDGA 3O61A 4N1UA 3BM4A 3O69A 3Q93A 1TUMA 1X84A 2O5WA 5GHOA 1RRSA 5GHNA 2R5WA 2I8TA 4ILQA 2G74A 5C8LA 3SONA 5C7QA 3X0RA 3EF5A 3ZR0A 5ANTA 2B2KA 1V8MA 4HVYA 2G73A 2O5FA 3GG6A 2GB5A 5IW5A 2DSDA 1X83A 1KTGA 3X0MA 5DD4A 2CZRA 3RH7A 1RYAA 3H95A 3X0QA 4YPRA 1JRKA 3J7Ye 1VC9A 1MQEA 3SMDA 3X0KA 1V8WA 5HZXA 5FSMA 1V8LA 5CFIA 1F3YA 3FJYA 3OGAA 4KG4A 2Q9PA 3EEUA 2I6KA 3QSJA 2A8TA 5GHJA 2DUKA 5ISYA 1V8UA 1PUSA 2A8QA 4S2XA 1Q33A 3BAPA 5FSOA 3SHDA 5I8UA 1Q54A 3FSPA 1HZTA 2B06A 4S2VA 1VRLA 1GA7A 1PUNA 2A8RA 1VC8A 5ANUA 3WHWA 3X0SA 1HX3A 1PPXA 1NQYA 3E57A 1MUTA 4NFWA 3MDIA 3GRNA 3EESA 5ANWA 3AC9A 2ICKA 3I7UA 1SOIA 2A8SA 2GT4A 5FSLA 1XSBA 3G0QA 1VK6A 1PUQA 1SU2A 2O1CA 2DSBA 2PQVA 5IW4A 4JZVA 5GHQA 2YYHA 1U20A 3DUPA 5CFJA 1XSAA 3HYQA 1Q27A 1K26A 2YVPA 1G0SA 3Q1PA 2FKBA 1VCDA 3P6YA 1OW2A 3X0OA 2A8PA 2KDWA 4S2WA 3X0LA 1R67A 2YVOA 3GZ8A 3Q91A 4J7GA 2JVBA 1V8IA 1K2EA 3Q4IA 3CNGA 4NFXA 2QJOA 4KYXA 3X0PA 1MQWA 3FFUA 4S2YA 3EXQA 3Q2SA 3U53A 5LPGA 4ZG0A 3N77A
chains in the Genus database with same CATH topology
3I9XA 3R03A 5FSNA 2FMLA 2YVNA 1XSCA 4N1TA 1V8YA 3X0JA 4C9XA 5BONA 2PNYA 4K6EA 2I8UA 3MCFA 1V8NA 2DHOA 2VNQA 4JZTA 3X0NA 3ZR1A 3Q2TA 4JZUA 4MPOA 3A6TA 2YVMA 3A6SA 3GZ5A 5FSIA 1V8TA 3F6AA 4ICKA 3X0IA 5DDGA 1JKNA 1NFZA 1V8RA 1MK1A 3I7VA 1I9AA 3GZ6A 1X51A 3N9UA 1V8SA 4JZSA 5DPKA 1PVFA 1QVJA 4KTBA 3FK9A 1KT9A 2W4EA 4V14A 5GHIA 1PPVA 2GT2A 3GWYA 1SZ3A 3BHOA 1KHZA 5GHMA 5DEQA 4YOQA 2FVVA 1MP2A 3KVHA 1VHZA 2QJTA 1VHGA 3DKUA 3A6VA 4IJXA 1SJYA 1VIUA 1MR2A 2RRKA 1IRYA 1G9QA 2J8QA 1RRQA 2QKMB 3FCMA 3ID9A 3O52A 3O6ZA 5BS6A 4YPHA 4KG3A 4J7HA 3F13A 2VNPA 2XSQA 3HHJA 3MGMA 3COUA 5GHPA 5FSKA 1V8VA 1PPWA 4C9WA 3P5TA 5C7TA 1NQZA 1VIQA 2AZWA 2CL3A 2ICJA 3O8SA 4HFQA 5ANVA 2DSCA 3A6UA 3L85A 1NFSA 3ACAA 4DYWA 2A6TA 2KDVA 2B0VA 5ANSA 3MDGA 3O61A 4N1UA 3BM4A 3O69A 3Q93A 1TUMA 1X84A 2O5WA 5GHOA 1RRSA 5GHNA 2R5WA 2I8TA 4ILQA 2G74A 5C8LA 3SONA 5C7QA 3X0RA 3EF5A 3ZR0A 5ANTA 2B2KA 1V8MA 4HVYA 2G73A 2O5FA 3GG6A 2GB5A 5IW5A 2DSDA 1X83A 1KTGA 3X0MA 5DD4A 2CZRA 3RH7A 1RYAA 3H95A 3X0QA 4YPRA 1JRKA 3J7Ye 1VC9A 1MQEA 3SMDA 3X0KA 1V8WA 5HZXA 5FSMA 1V8LA 5CFIA 1F3YA 3FJYA 3OGAA 4KG4A 2Q9PA 3EEUA 2I6KA 3QSJA 2A8TA 5GHJA 2DUKA 5ISYA 1V8UA 1PUSA 2A8QA 4S2XA 1Q33A 3BAPA 5FSOA 3SHDA 5I8UA 1Q54A 3FSPA 1HZTA 2B06A 4S2VA 1VRLA 1GA7A 1PUNA 2A8RA 1VC8A 5ANUA 3WHWA 3X0SA 1HX3A 1PPXA 1NQYA 3E57A 1MUTA 4NFWA 3MDIA 3GRNA 3EESA 5ANWA 3AC9A 2ICKA 3I7UA 1SOIA 2A8SA 2GT4A 5FSLA 1XSBA 3G0QA 1VK6A 1PUQA 1SU2A 2O1CA 2DSBA 2PQVA 5IW4A 4JZVA 5GHQA 2YYHA 1U20A 3DUPA 5CFJA 1XSAA 3HYQA 1Q27A 1K26A 2YVPA 1G0SA 3Q1PA 2FKBA 1VCDA 3P6YA 1OW2A 3X0OA 2A8PA 2KDWA 4S2WA 3X0LA 1R67A 2YVOA 3GZ8A 3Q91A 4J7GA 2JVBA 1V8IA 1K2EA 3Q4IA 3CNGA 4NFXA 2QJOA 4KYXA 3X0PA 1MQWA 3FFUA 4S2YA 3EXQA 3Q2SA 3U53A 5LPGA 4ZG0A 3N77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I9X A;  3R03 A;  5FSN A;  2FML A;  2YVN A;  1XSC A;  4N1T A;  1V8Y A;  3X0J A;  4C9X A;  5BON A;  2PNY A;  4K6E A;  2I8U A;  3MCF A;  1V8N A;  2DHO A;  2VNQ A;  4JZT A;  3X0N A;  3ZR1 A;  3Q2T A;  4JZU A;  4MPO A;  3A6T A;  2YVM A;  3A6S A;  3GZ5 A;  5FSI A;  1V8T A;  3F6A A;  4ICK A;  3X0I A;  5DDG A;  1JKN A;  1NFZ A;  1V8R A;  1MK1 A;  3I7V A;  1I9A A;  3GZ6 A;  1X51 A;  3N9U A;  1V8S A;  4JZS A;  5DPK A;  1PVF A;  1QVJ A;  4KTB A;  3FK9 A;  1KT9 A;  2W4E A;  4V14 A;  5GHI A;  1PPV A;  2GT2 A;  3GWY A;  1SZ3 A;  3BHO A;  1KHZ A;  5GHM A;  5DEQ A;  4YOQ A;  2FVV A;  1MP2 A;  3KVH A;  1VHZ A;  2QJT A;  1VHG A;  3DKU A;  3A6V A;  4IJX A;  1SJY A;  1VIU A;  1MR2 A;  2RRK A;  1IRY A;  1G9Q A;  2J8Q A;  1RRQ A;  2QKM B;  3FCM A;  3ID9 A;  3O52 A;  3O6Z A;  5BS6 A;  4YPH A;  4KG3 A;  3F13 A;  2VNP A;  2XSQ A;  3HHJ A;  3MGM A;  3COU A;  5GHP A;  5FSK A;  1V8V A;  1PPW A;  4C9W A;  3P5T A;  5C7T A;  1NQZ A;  1VIQ A;  2AZW A;  2CL3 A;  2ICJ A;  3O8S A;  4HFQ A;  5ANV A;  2DSC A;  3A6U A;  3L85 A;  1NFS A;  3ACA A;  4DYW A;  2A6T A;  2KDV A;  2B0V A;  5ANS A;  3MDG A;  3O61 A;  4N1U A;  3BM4 A;  3O69 A;  3Q93 A;  1TUM A;  1X84 A;  2O5W A;  5GHO A;  1RRS A;  5GHN A;  2R5W A;  2I8T A;  4ILQ A;  2G74 A;  5C8L A;  3SON A;  5C7Q A;  3X0R A;  3EF5 A;  3ZR0 A;  5ANT A;  2B2K A;  1V8M A;  4HVY A;  2G73 A;  2O5F A;  3GG6 A;  2GB5 A;  5IW5 A;  2DSD A;  1X83 A;  1KTG A;  3X0M A;  5DD4 A;  3RH7 A;  1RYA A;  3H95 A;  3X0Q A;  4YPR A;  1JRK A;  3J7Y e;  1VC9 A;  1MQE A;  3SMD A;  3X0K A;  1V8W A;  5HZX A;  5FSM A;  1V8L A;  5CFI A;  1F3Y A;  3FJY A;  3OGA A;  4KG4 A;  2Q9P A;  3EEU A;  2I6K A;  3QSJ A;  2A8T A;  5GHJ A;  2DUK A;  5ISY A;  1V8U A;  1PUS A;  2A8Q A;  4S2X A;  1Q33 A;  3BAP A;  5FSO A;  3SHD A;  5I8U A;  1Q54 A;  3FSP A;  1HZT A;  2B06 A;  4S2V A;  1VRL A;  1GA7 A;  1PUN A;  2A8R A;  1VC8 A;  5ANU A;  3WHW A;  3X0S A;  1HX3 A;  1PPX A;  1NQY A;  3E57 A;  1MUT A;  4NFW A;  3MDI A;  3GRN A;  3EES A;  5ANW A;  3AC9 A;  2ICK A;  3I7U A;  1SOI A;  2A8S A;  2GT4 A;  5FSL A;  1XSB A;  3G0Q A;  1VK6 A;  1PUQ A;  1SU2 A;  2O1C A;  2DSB A;  2PQV A;  5IW4 A;  4JZV A;  5GHQ A;  2YYH A;  1U20 A;  3DUP A;  5CFJ A;  1XSA A;  3HYQ A;  1Q27 A;  1K26 A;  2YVP A;  1G0S A;  3Q1P A;  2FKB A;  1VCD A;  3P6Y A;  1OW2 A;  3X0O A;  2A8P A;  2KDW A;  4S2W A;  3X0L A;  1R67 A;  2YVO A;  3GZ8 A;  3Q91 A;  2JVB A;  1V8I A;  1K2E A;  3Q4I A;  3CNG A;  4NFX A;  2QJO A;  4KYX A;  3X0P A;  1MQW A;  3FFU A;  4S2Y A;  3EXQ A;  3Q2S A;  3U53 A;  5LPG A;  4ZG0 A;  3N77 A; 
#chains in the Genus database with same CATH topology
 3I9X A;  3R03 A;  5FSN A;  2FML A;  2YVN A;  1XSC A;  4N1T A;  1V8Y A;  3X0J A;  4C9X A;  5BON A;  2PNY A;  4K6E A;  2I8U A;  3MCF A;  1V8N A;  2DHO A;  2VNQ A;  4JZT A;  3X0N A;  3ZR1 A;  3Q2T A;  4JZU A;  4MPO A;  3A6T A;  2YVM A;  3A6S A;  3GZ5 A;  5FSI A;  1V8T A;  3F6A A;  4ICK A;  3X0I A;  5DDG A;  1JKN A;  1NFZ A;  1V8R A;  1MK1 A;  3I7V A;  1I9A A;  3GZ6 A;  1X51 A;  3N9U A;  1V8S A;  4JZS A;  5DPK A;  1PVF A;  1QVJ A;  4KTB A;  3FK9 A;  1KT9 A;  2W4E A;  4V14 A;  5GHI A;  1PPV A;  2GT2 A;  3GWY A;  1SZ3 A;  3BHO A;  1KHZ A;  5GHM A;  5DEQ A;  4YOQ A;  2FVV A;  1MP2 A;  3KVH A;  1VHZ A;  2QJT A;  1VHG A;  3DKU A;  3A6V A;  4IJX A;  1SJY A;  1VIU A;  1MR2 A;  2RRK A;  1IRY A;  1G9Q A;  2J8Q A;  1RRQ A;  2QKM B;  3FCM A;  3ID9 A;  3O52 A;  3O6Z A;  5BS6 A;  4YPH A;  4KG3 A;  4J7H A;  3F13 A;  2VNP A;  2XSQ A;  3HHJ A;  3MGM A;  3COU A;  5GHP A;  5FSK A;  1V8V A;  1PPW A;  4C9W A;  3P5T A;  5C7T A;  1NQZ A;  1VIQ A;  2AZW A;  2CL3 A;  2ICJ A;  3O8S A;  4HFQ A;  5ANV A;  2DSC A;  3A6U A;  3L85 A;  1NFS A;  3ACA A;  4DYW A;  2A6T A;  2KDV A;  2B0V A;  5ANS A;  3MDG A;  3O61 A;  4N1U A;  3BM4 A;  3O69 A;  3Q93 A;  1TUM A;  1X84 A;  2O5W A;  5GHO A;  1RRS A;  5GHN A;  2R5W A;  2I8T A;  4ILQ A;  2G74 A;  5C8L A;  3SON A;  5C7Q A;  3X0R A;  3EF5 A;  3ZR0 A;  5ANT A;  2B2K A;  1V8M A;  4HVY A;  2G73 A;  2O5F A;  3GG6 A;  2GB5 A;  5IW5 A;  2DSD A;  1X83 A;  1KTG A;  3X0M A;  5DD4 A;  2CZR A;  3RH7 A;  1RYA A;  3H95 A;  3X0Q A;  4YPR A;  1JRK A;  3J7Y e;  1VC9 A;  1MQE A;  3SMD A;  3X0K A;  1V8W A;  5HZX A;  5FSM A;  1V8L A;  5CFI A;  1F3Y A;  3FJY A;  3OGA A;  4KG4 A;  2Q9P A;  3EEU A;  2I6K A;  3QSJ A;  2A8T A;  5GHJ A;  2DUK A;  5ISY A;  1V8U A;  1PUS A;  2A8Q A;  4S2X A;  1Q33 A;  3BAP A;  5FSO A;  3SHD A;  5I8U A;  1Q54 A;  3FSP A;  1HZT A;  2B06 A;  4S2V A;  1VRL A;  1GA7 A;  1PUN A;  2A8R A;  1VC8 A;  5ANU A;  3WHW A;  3X0S A;  1HX3 A;  1PPX A;  1NQY A;  3E57 A;  1MUT A;  4NFW A;  3MDI A;  3GRN A;  3EES A;  5ANW A;  3AC9 A;  2ICK A;  3I7U A;  1SOI A;  2A8S A;  2GT4 A;  5FSL A;  1XSB A;  3G0Q A;  1VK6 A;  1PUQ A;  1SU2 A;  2O1C A;  2DSB A;  2PQV A;  5IW4 A;  4JZV A;  5GHQ A;  2YYH A;  1U20 A;  3DUP A;  5CFJ A;  1XSA A;  3HYQ A;  1Q27 A;  1K26 A;  2YVP A;  1G0S A;  3Q1P A;  2FKB A;  1VCD A;  3P6Y A;  1OW2 A;  3X0O A;  2A8P A;  2KDW A;  4S2W A;  3X0L A;  1R67 A;  2YVO A;  3GZ8 A;  3Q91 A;  4J7G A;  2JVB A;  1V8I A;  1K2E A;  3Q4I A;  3CNG A;  4NFX A;  2QJO A;  4KYX A;  3X0P A;  1MQW A;  3FFU A;  4S2Y A;  3EXQ A;  3Q2S A;  3U53 A;  5LPG A;  4ZG0 A;  3N77 A; 
#chains in the Genus database with same CATH homology
 3I9X A;  3R03 A;  5FSN A;  2FML A;  2YVN A;  1XSC A;  4N1T A;  1V8Y A;  3X0J A;  4C9X A;  5BON A;  2PNY A;  4K6E A;  2I8U A;  3MCF A;  1V8N A;  2DHO A;  2VNQ A;  4JZT A;  3X0N A;  3ZR1 A;  3Q2T A;  4JZU A;  4MPO A;  3A6T A;  2YVM A;  3A6S A;  3GZ5 A;  5FSI A;  1V8T A;  3F6A A;  4ICK A;  3X0I A;  5DDG A;  1JKN A;  1NFZ A;  1V8R A;  1MK1 A;  3I7V A;  1I9A A;  3GZ6 A;  1X51 A;  3N9U A;  1V8S A;  4JZS A;  5DPK A;  1PVF A;  1QVJ A;  4KTB A;  3FK9 A;  1KT9 A;  2W4E A;  4V14 A;  5GHI A;  1PPV A;  2GT2 A;  3GWY A;  1SZ3 A;  3BHO A;  1KHZ A;  5GHM A;  5DEQ A;  4YOQ A;  2FVV A;  1MP2 A;  3KVH A;  1VHZ A;  2QJT A;  1VHG A;  3DKU A;  3A6V A;  4IJX A;  1SJY A;  1VIU A;  1MR2 A;  2RRK A;  1IRY A;  1G9Q A;  2J8Q A;  1RRQ A;  2QKM B;  3FCM A;  3ID9 A;  3O52 A;  3O6Z A;  5BS6 A;  4YPH A;  4KG3 A;  4J7H A;  3F13 A;  2VNP A;  2XSQ A;  3HHJ A;  3MGM A;  3COU A;  5GHP A;  5FSK A;  1V8V A;  1PPW A;  4C9W A;  3P5T A;  5C7T A;  1NQZ A;  1VIQ A;  2AZW A;  2CL3 A;  2ICJ A;  3O8S A;  4HFQ A;  5ANV A;  2DSC A;  3A6U A;  3L85 A;  1NFS A;  3ACA A;  4DYW A;  2A6T A;  2KDV A;  2B0V A;  5ANS A;  3MDG A;  3O61 A;  4N1U A;  3BM4 A;  3O69 A;  3Q93 A;  1TUM A;  1X84 A;  2O5W A;  5GHO A;  1RRS A;  5GHN A;  2R5W A;  2I8T A;  4ILQ A;  2G74 A;  5C8L A;  3SON A;  5C7Q A;  3X0R A;  3EF5 A;  3ZR0 A;  5ANT A;  2B2K A;  1V8M A;  4HVY A;  2G73 A;  2O5F A;  3GG6 A;  2GB5 A;  5IW5 A;  2DSD A;  1X83 A;  1KTG A;  3X0M A;  5DD4 A;  2CZR A;  3RH7 A;  1RYA A;  3H95 A;  3X0Q A;  4YPR A;  1JRK A;  3J7Y e;  1VC9 A;  1MQE A;  3SMD A;  3X0K A;  1V8W A;  5HZX A;  5FSM A;  1V8L A;  5CFI A;  1F3Y A;  3FJY A;  3OGA A;  4KG4 A;  2Q9P A;  3EEU A;  2I6K A;  3QSJ A;  2A8T A;  5GHJ A;  2DUK A;  5ISY A;  1V8U A;  1PUS A;  2A8Q A;  4S2X A;  1Q33 A;  3BAP A;  5FSO A;  3SHD A;  5I8U A;  1Q54 A;  3FSP A;  1HZT A;  2B06 A;  4S2V A;  1VRL A;  1GA7 A;  1PUN A;  2A8R A;  1VC8 A;  5ANU A;  3WHW A;  3X0S A;  1HX3 A;  1PPX A;  1NQY A;  3E57 A;  1MUT A;  4NFW A;  3MDI A;  3GRN A;  3EES A;  5ANW A;  3AC9 A;  2ICK A;  3I7U A;  1SOI A;  2A8S A;  2GT4 A;  5FSL A;  1XSB A;  3G0Q A;  1VK6 A;  1PUQ A;  1SU2 A;  2O1C A;  2DSB A;  2PQV A;  5IW4 A;  4JZV A;  5GHQ A;  2YYH A;  1U20 A;  3DUP A;  5CFJ A;  1XSA A;  3HYQ A;  1Q27 A;  1K26 A;  2YVP A;  1G0S A;  3Q1P A;  2FKB A;  1VCD A;  3P6Y A;  1OW2 A;  3X0O A;  2A8P A;  2KDW A;  4S2W A;  3X0L A;  1R67 A;  2YVO A;  3GZ8 A;  3Q91 A;  4J7G A;  2JVB A;  1V8I A;  1K2E A;  3Q4I A;  3CNG A;  4NFX A;  2QJO A;  4KYX A;  3X0P A;  1MQW A;  3FFU A;  4S2Y A;  3EXQ A;  3Q2S A;  3U53 A;  5LPG A;  4ZG0 A;  3N77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...