3A6UA

Crystal structure of mutt-8-oxo-dgmp-mn(ii) complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
LQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Mutator mutT protein
publication title Structural and dynamic features of the MutT protein in the recognition of nucleotides with the mutagenic 8-oxoguanine base
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 34
structure length 126
sequence length 126
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2009-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3a6uA00
3EF5A 3H95A 2GT4A 3HYQA 5I8UA 3GWYA 1V8RA 1V8NA 2B2KA 1Q33A 1I9AA 3X0KA 2A8PA 2W4EA 3R03A 3O52A 1QVJA 1G0SA 3P5TA 2YYHA 3X0RA 1NQZA 3DKUA 1RRSA 3A6UA 2VNQA 3FFUA 3QSJA 2KDWA 3N77A 1VK6A 3ACAA 3O69A 1MR2A 3MGMA 2KDVA 1MUTA 2I6KA 5C8LA 1MP2A 1NFZA 1TUMA 5GHPA 4S2WA 3DUPA 4NFWA 3G0QA 4C9XA 4JZSA 3MDIA 4V14A 3L85A 2QJTA 2DUKA 1VIUA 3ID9A 1KHZA 2AZWA 1R67A 3CNGA 3FJYA 1V8SA 2DSCA 2O1CA 1PUNA 3KVHA 3OGAA 3X0QA 3EEUA 1X84A 3X0OA 5GHMA 5GHJA 3FSPA 5GHNA 4ILQA 4S2VA 4NFXA 5GHOA 1RRQA 1XSBA 3I9XA 1X51A 2A8TA 2QJOA 1HX3A 5IW5A 5FSNA 1IRYA 1SU2A 3RH7A 2B06A 1JRKA 3I7UA 5FSIA 4DYWA 3Q91A 1F3YA 3A6SA 1V8YA 2I8TA 3Q4IA 4KYXA 5ANUA 3F6AA 1VIQA 1RYAA 3U53A 3GZ8A 3MCFA 3GRNA 3A6TA 3FK9A 2A8SA 4YPHA 5DEQA 3ZR0A 2O5WA 2R5WA 4ZG0A 5LPGA 3Q2SA 4MPOA 3SONA 2YVPA 2A8QA 4HVYA 3N9UA 4ICKA 1V8TA 2PNYA 1V8IA 3BAPA 4JZVA 3X0NA 2XSQA 1K2EA 2ICKA 3Q2TA 3F13A 1PPWA 1VC8A 4N1TA 2J8QA 2DHOA 2O5FA 2Q9PA 2YVMA 5HZXA 5DD4A 2G73A 1PPXA 4S2XA 3X0MA 1VC9A 2FVVA 1XSAA 1Q54A 3O61A 4IJXA 5C7TA 1G9QA 2DSDA 1NFSA 3GZ6A 3Q1PA 2CL3A 2FMLA 1KT9A 4KG4A 2DSBA 2B0VA 3WHWA 3X0IA 4YPRA 5ANTA 3X0PA 1GA7A 1VCDA 1JKNA 3X0JA 1VRLA 3X0SA 2GT2A 3EXQA 4C9WA 2A6TA 1PUSA 3MDGA 1MK1A 3O6ZA 2ICJA 1MQEA 3SHDA 2A8RA 2VNPA 3COUA 3O8SA 3SMDA 1V8VA 4YOQA 4JZTA 1V8MA 2FKBA 1OW2A 3E57A 5DDGA 5CFIA 2RRKA 4HFQA 5ANVA 5BS6A 5GHQA 1X83A 3AC9A 3BM4A 1HZTA 1V8WA 4S2YA 1MQWA 1U20A 1VHZA 2YVNA 5FSOA 2I8UA 4JZUA 1PVFA 5GHIA 1V8LA 3I7VA 2YVOA 3GG6A 1NQYA 5ANSA 2PQVA 5FSMA 4KTBA 1V8UA 1XSCA 2G74A 4N1UA 5C7QA 3EESA 5FSLA 1SJYA 3ZR1A 5CFJA 2QKMB 5DPKA 5IW4A 3P6YA 3BHOA 2GB5A 3FCMA 5ANWA 3A6VA 1VHGA 1SOIA 1KTGA 3X0LA 1PPVA 3GZ5A 2JVBA 4KG3A 3HHJA 1PUQA 1SZ3A 5BONA 1Q27A 5FSKA 5ISYA 4K6EA 3J7Ye 1K26A 3Q93A
chains in the Genus database with same CATH superfamily
3EF5A 3H95A 2GT4A 3HYQA 5I8UA 3GWYA 1V8RA 1V8NA 2B2KA 1Q33A 1I9AA 3X0KA 2A8PA 2W4EA 3R03A 3O52A 1QVJA 1G0SA 3P5TA 2YYHA 3X0RA 1NQZA 3DKUA 1RRSA 3A6UA 2VNQA 3FFUA 3QSJA 2KDWA 3N77A 1VK6A 3ACAA 3O69A 1MR2A 3MGMA 2KDVA 1MUTA 2I6KA 4J7GA 1MP2A 1NFZA 1TUMA 5GHPA 4S2WA 3DUPA 4NFWA 3G0QA 4C9XA 4JZSA 3MDIA 4V14A 3L85A 2QJTA 2DUKA 1VIUA 3ID9A 1KHZA 2AZWA 1R67A 3CNGA 3FJYA 1V8SA 2DSCA 2O1CA 1PUNA 3KVHA 3OGAA 5C8LA 3EEUA 3X0QA 1X84A 3X0OA 5GHMA 5GHJA 3FSPA 5GHNA 4ILQA 4S2VA 4NFXA 5GHOA 1RRQA 1XSBA 3I9XA 1X51A 2A8TA 2QJOA 1HX3A 5IW5A 5FSNA 1IRYA 1SU2A 3RH7A 2B06A 1JRKA 3I7UA 5FSIA 4DYWA 3Q91A 1F3YA 3A6SA 1V8YA 2I8TA 3Q4IA 4KYXA 5ANUA 3F6AA 1VIQA 1RYAA 3U53A 3GZ8A 3MCFA 3GRNA 3A6TA 3FK9A 2A8SA 4YPHA 5DEQA 3ZR0A 2O5WA 2R5WA 4ZG0A 5LPGA 3Q2SA 4MPOA 3SONA 2YVPA 2A8QA 4HVYA 3N9UA 4ICKA 1V8TA 2PNYA 1V8IA 3BAPA 4JZVA 3X0NA 2XSQA 1K2EA 2ICKA 3Q2TA 3F13A 1PPWA 1VC8A 4N1TA 2J8QA 2DHOA 2O5FA 2Q9PA 2YVMA 5HZXA 5DD4A 2G73A 1PPXA 4S2XA 3X0MA 1VC9A 2FVVA 1XSAA 1Q54A 3O61A 4IJXA 5C7TA 1G9QA 2DSDA 1NFSA 3GZ6A 3Q1PA 2CL3A 2FMLA 1KT9A 4KG4A 2DSBA 2B0VA 3WHWA 3X0IA 4YPRA 5ANTA 3X0PA 1GA7A 1VCDA 1JKNA 3X0JA 1VRLA 3X0SA 2GT2A 3EXQA 4C9WA 2A6TA 1PUSA 3MDGA 1MK1A 3O6ZA 2CZRA 2ICJA 1MQEA 3SHDA 2A8RA 2VNPA 3COUA 3O8SA 3SMDA 1V8VA 4YOQA 4JZTA 1V8MA 2FKBA 1OW2A 3E57A 5DDGA 5CFIA 2RRKA 4HFQA 5ANVA 5BS6A 5GHQA 1X83A 3AC9A 3BM4A 1HZTA 1V8WA 4S2YA 1MQWA 1U20A 1VHZA 2YVNA 5FSOA 2I8UA 4JZUA 1PVFA 5GHIA 1V8LA 3I7VA 2YVOA 3GG6A 1NQYA 5ANSA 2PQVA 5FSMA 4KTBA 1V8UA 1XSCA 2G74A 4J7HA 4N1UA 5C7QA 3EESA 5FSLA 1SJYA 3ZR1A 5CFJA 2QKMB 5DPKA 5IW4A 3P6YA 3BHOA 2GB5A 3FCMA 5ANWA 3A6VA 1VHGA 1SOIA 1KTGA 3X0LA 1PPVA 3GZ5A 2JVBA 4KG3A 3HHJA 1PUQA 1SZ3A 5BONA 1Q27A 5FSKA 5ISYA 4K6EA 3J7Ye 1K26A 3Q93A
chains in the Genus database with same CATH topology
3EF5A 3H95A 2GT4A 3HYQA 5I8UA 3GWYA 1V8RA 1V8NA 2B2KA 1Q33A 1I9AA 3X0KA 2A8PA 2W4EA 3R03A 3O52A 1QVJA 1G0SA 3P5TA 2YYHA 3X0RA 1NQZA 3DKUA 1RRSA 3A6UA 2VNQA 3FFUA 3QSJA 2KDWA 3N77A 1VK6A 3ACAA 3O69A 1MR2A 3MGMA 2KDVA 1MUTA 2I6KA 4J7GA 1MP2A 1NFZA 1TUMA 5GHPA 4S2WA 3DUPA 4NFWA 3G0QA 4C9XA 4JZSA 3MDIA 4V14A 3L85A 2QJTA 2DUKA 1VIUA 3ID9A 1KHZA 2AZWA 1R67A 3CNGA 3FJYA 1V8SA 2DSCA 2O1CA 1PUNA 3KVHA 3OGAA 5C8LA 3EEUA 3X0QA 1X84A 3X0OA 5GHMA 5GHJA 3FSPA 5GHNA 4ILQA 4S2VA 4NFXA 5GHOA 1RRQA 1XSBA 3I9XA 1X51A 2A8TA 2QJOA 1HX3A 5IW5A 5FSNA 1IRYA 1SU2A 3RH7A 2B06A 1JRKA 3I7UA 5FSIA 4DYWA 3Q91A 1F3YA 3A6SA 1V8YA 2I8TA 3Q4IA 4KYXA 5ANUA 3F6AA 1VIQA 1RYAA 3U53A 3GZ8A 3MCFA 3GRNA 3A6TA 3FK9A 2A8SA 4YPHA 5DEQA 3ZR0A 2O5WA 2R5WA 4ZG0A 5LPGA 3Q2SA 4MPOA 3SONA 2YVPA 2A8QA 4HVYA 3N9UA 4ICKA 1V8TA 2PNYA 1V8IA 3BAPA 4JZVA 3X0NA 2XSQA 1K2EA 2ICKA 3Q2TA 3F13A 1PPWA 1VC8A 4N1TA 2J8QA 2DHOA 2O5FA 2Q9PA 2YVMA 5HZXA 5DD4A 2G73A 1PPXA 4S2XA 3X0MA 1VC9A 2FVVA 1XSAA 1Q54A 3O61A 4IJXA 5C7TA 1G9QA 2DSDA 1NFSA 3GZ6A 3Q1PA 2CL3A 2FMLA 1KT9A 4KG4A 2DSBA 2B0VA 3WHWA 3X0IA 4YPRA 5ANTA 3X0PA 1GA7A 1VCDA 1JKNA 3X0JA 1VRLA 3X0SA 2GT2A 3EXQA 4C9WA 2A6TA 1PUSA 3MDGA 1MK1A 3O6ZA 2CZRA 2ICJA 1MQEA 3SHDA 2A8RA 2VNPA 3COUA 3O8SA 3SMDA 1V8VA 4YOQA 4JZTA 1V8MA 2FKBA 1OW2A 3E57A 5DDGA 5CFIA 2RRKA 4HFQA 5ANVA 5BS6A 5GHQA 1X83A 3AC9A 3BM4A 1HZTA 1V8WA 4S2YA 1MQWA 1U20A 1VHZA 2YVNA 5FSOA 2I8UA 4JZUA 1PVFA 5GHIA 1V8LA 3I7VA 2YVOA 3GG6A 1NQYA 5ANSA 2PQVA 5FSMA 4KTBA 1V8UA 1XSCA 2G74A 4J7HA 4N1UA 5C7QA 3EESA 5FSLA 1SJYA 3ZR1A 5CFJA 2QKMB 5DPKA 5IW4A 3P6YA 3BHOA 2GB5A 3FCMA 5ANWA 3A6VA 1VHGA 1SOIA 1KTGA 3X0LA 1PPVA 3GZ5A 2JVBA 4KG3A 3HHJA 1PUQA 1SZ3A 5BONA 1Q27A 5FSKA 5ISYA 4K6EA 3J7Ye 1K26A 3Q93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EF5 A;  3H95 A;  2GT4 A;  3HYQ A;  5I8U A;  3GWY A;  1V8R A;  1V8N A;  2B2K A;  1Q33 A;  1I9A A;  3X0K A;  2A8P A;  2W4E A;  3R03 A;  3O52 A;  1QVJ A;  1G0S A;  3P5T A;  2YYH A;  3X0R A;  1NQZ A;  3DKU A;  1RRS A;  3A6U A;  2VNQ A;  3FFU A;  3QSJ A;  2KDW A;  3N77 A;  1VK6 A;  3ACA A;  3O69 A;  1MR2 A;  3MGM A;  2KDV A;  1MUT A;  2I6K A;  5C8L A;  1MP2 A;  1NFZ A;  1TUM A;  5GHP A;  4S2W A;  3DUP A;  4NFW A;  3G0Q A;  4C9X A;  4JZS A;  3MDI A;  4V14 A;  3L85 A;  2QJT A;  2DUK A;  1VIU A;  3ID9 A;  1KHZ A;  2AZW A;  1R67 A;  3CNG A;  3FJY A;  1V8S A;  2DSC A;  2O1C A;  1PUN A;  3KVH A;  3OGA A;  3X0Q A;  3EEU A;  1X84 A;  3X0O A;  5GHM A;  5GHJ A;  3FSP A;  5GHN A;  4ILQ A;  4S2V A;  4NFX A;  5GHO A;  1RRQ A;  1XSB A;  3I9X A;  1X51 A;  2A8T A;  2QJO A;  1HX3 A;  5IW5 A;  5FSN A;  1IRY A;  1SU2 A;  3RH7 A;  2B06 A;  1JRK A;  3I7U A;  5FSI A;  4DYW A;  3Q91 A;  1F3Y A;  3A6S A;  1V8Y A;  2I8T A;  3Q4I A;  4KYX A;  5ANU A;  3F6A A;  1VIQ A;  1RYA A;  3U53 A;  3GZ8 A;  3MCF A;  3GRN A;  3A6T A;  3FK9 A;  2A8S A;  4YPH A;  5DEQ A;  3ZR0 A;  2O5W A;  2R5W A;  4ZG0 A;  5LPG A;  3Q2S A;  4MPO A;  3SON A;  2YVP A;  2A8Q A;  4HVY A;  3N9U A;  4ICK A;  1V8T A;  2PNY A;  1V8I A;  3BAP A;  4JZV A;  3X0N A;  2XSQ A;  1K2E A;  2ICK A;  3Q2T A;  3F13 A;  1PPW A;  1VC8 A;  4N1T A;  2J8Q A;  2DHO A;  2O5F A;  2Q9P A;  2YVM A;  5HZX A;  5DD4 A;  2G73 A;  1PPX A;  4S2X A;  3X0M A;  1VC9 A;  2FVV A;  1XSA A;  1Q54 A;  3O61 A;  4IJX A;  5C7T A;  1G9Q A;  2DSD A;  1NFS A;  3GZ6 A;  3Q1P A;  2CL3 A;  2FML A;  1KT9 A;  4KG4 A;  2DSB A;  2B0V A;  3WHW A;  3X0I A;  4YPR A;  5ANT A;  3X0P A;  1GA7 A;  1VCD A;  1JKN A;  3X0J A;  1VRL A;  3X0S A;  2GT2 A;  3EXQ A;  4C9W A;  2A6T A;  1PUS A;  3MDG A;  1MK1 A;  3O6Z A;  2ICJ A;  1MQE A;  3SHD A;  2A8R A;  2VNP A;  3COU A;  3O8S A;  3SMD A;  1V8V A;  4YOQ A;  4JZT A;  1V8M A;  2FKB A;  1OW2 A;  3E57 A;  5DDG A;  5CFI A;  2RRK A;  4HFQ A;  5ANV A;  5BS6 A;  5GHQ A;  1X83 A;  3AC9 A;  3BM4 A;  1HZT A;  1V8W A;  4S2Y A;  1MQW A;  1U20 A;  1VHZ A;  2YVN A;  5FSO A;  2I8U A;  4JZU A;  1PVF A;  5GHI A;  1V8L A;  3I7V A;  2YVO A;  3GG6 A;  1NQY A;  5ANS A;  2PQV A;  5FSM A;  4KTB A;  1V8U A;  1XSC A;  2G74 A;  4N1U A;  5C7Q A;  3EES A;  5FSL A;  1SJY A;  3ZR1 A;  5CFJ A;  2QKM B;  5DPK A;  5IW4 A;  3P6Y A;  3BHO A;  2GB5 A;  3FCM A;  5ANW A;  3A6V A;  1VHG A;  1SOI A;  1KTG A;  3X0L A;  1PPV A;  3GZ5 A;  2JVB A;  4KG3 A;  3HHJ A;  1PUQ A;  1SZ3 A;  5BON A;  1Q27 A;  5FSK A;  5ISY A;  4K6E A;  3J7Y e;  1K26 A;  3Q93 A; 
#chains in the Genus database with same CATH topology
 3EF5 A;  3H95 A;  2GT4 A;  3HYQ A;  5I8U A;  3GWY A;  1V8R A;  1V8N A;  2B2K A;  1Q33 A;  1I9A A;  3X0K A;  2A8P A;  2W4E A;  3R03 A;  3O52 A;  1QVJ A;  1G0S A;  3P5T A;  2YYH A;  3X0R A;  1NQZ A;  3DKU A;  1RRS A;  3A6U A;  2VNQ A;  3FFU A;  3QSJ A;  2KDW A;  3N77 A;  1VK6 A;  3ACA A;  3O69 A;  1MR2 A;  3MGM A;  2KDV A;  1MUT A;  2I6K A;  4J7G A;  1MP2 A;  1NFZ A;  1TUM A;  5GHP A;  4S2W A;  3DUP A;  4NFW A;  3G0Q A;  4C9X A;  4JZS A;  3MDI A;  4V14 A;  3L85 A;  2QJT A;  2DUK A;  1VIU A;  3ID9 A;  1KHZ A;  2AZW A;  1R67 A;  3CNG A;  3FJY A;  1V8S A;  2DSC A;  2O1C A;  1PUN A;  3KVH A;  3OGA A;  5C8L A;  3EEU A;  3X0Q A;  1X84 A;  3X0O A;  5GHM A;  5GHJ A;  3FSP A;  5GHN A;  4ILQ A;  4S2V A;  4NFX A;  5GHO A;  1RRQ A;  1XSB A;  3I9X A;  1X51 A;  2A8T A;  2QJO A;  1HX3 A;  5IW5 A;  5FSN A;  1IRY A;  1SU2 A;  3RH7 A;  2B06 A;  1JRK A;  3I7U A;  5FSI A;  4DYW A;  3Q91 A;  1F3Y A;  3A6S A;  1V8Y A;  2I8T A;  3Q4I A;  4KYX A;  5ANU A;  3F6A A;  1VIQ A;  1RYA A;  3U53 A;  3GZ8 A;  3MCF A;  3GRN A;  3A6T A;  3FK9 A;  2A8S A;  4YPH A;  5DEQ A;  3ZR0 A;  2O5W A;  2R5W A;  4ZG0 A;  5LPG A;  3Q2S A;  4MPO A;  3SON A;  2YVP A;  2A8Q A;  4HVY A;  3N9U A;  4ICK A;  1V8T A;  2PNY A;  1V8I A;  3BAP A;  4JZV A;  3X0N A;  2XSQ A;  1K2E A;  2ICK A;  3Q2T A;  3F13 A;  1PPW A;  1VC8 A;  4N1T A;  2J8Q A;  2DHO A;  2O5F A;  2Q9P A;  2YVM A;  5HZX A;  5DD4 A;  2G73 A;  1PPX A;  4S2X A;  3X0M A;  1VC9 A;  2FVV A;  1XSA A;  1Q54 A;  3O61 A;  4IJX A;  5C7T A;  1G9Q A;  2DSD A;  1NFS A;  3GZ6 A;  3Q1P A;  2CL3 A;  2FML A;  1KT9 A;  4KG4 A;  2DSB A;  2B0V A;  3WHW A;  3X0I A;  4YPR A;  5ANT A;  3X0P A;  1GA7 A;  1VCD A;  1JKN A;  3X0J A;  1VRL A;  3X0S A;  2GT2 A;  3EXQ A;  4C9W A;  2A6T A;  1PUS A;  3MDG A;  1MK1 A;  3O6Z A;  2CZR A;  2ICJ A;  1MQE A;  3SHD A;  2A8R A;  2VNP A;  3COU A;  3O8S A;  3SMD A;  1V8V A;  4YOQ A;  4JZT A;  1V8M A;  2FKB A;  1OW2 A;  3E57 A;  5DDG A;  5CFI A;  2RRK A;  4HFQ A;  5ANV A;  5BS6 A;  5GHQ A;  1X83 A;  3AC9 A;  3BM4 A;  1HZT A;  1V8W A;  4S2Y A;  1MQW A;  1U20 A;  1VHZ A;  2YVN A;  5FSO A;  2I8U A;  4JZU A;  1PVF A;  5GHI A;  1V8L A;  3I7V A;  2YVO A;  3GG6 A;  1NQY A;  5ANS A;  2PQV A;  5FSM A;  4KTB A;  1V8U A;  1XSC A;  2G74 A;  4J7H A;  4N1U A;  5C7Q A;  3EES A;  5FSL A;  1SJY A;  3ZR1 A;  5CFJ A;  2QKM B;  5DPK A;  5IW4 A;  3P6Y A;  3BHO A;  2GB5 A;  3FCM A;  5ANW A;  3A6V A;  1VHG A;  1SOI A;  1KTG A;  3X0L A;  1PPV A;  3GZ5 A;  2JVB A;  4KG3 A;  3HHJ A;  1PUQ A;  1SZ3 A;  5BON A;  1Q27 A;  5FSK A;  5ISY A;  4K6E A;  3J7Y e;  1K26 A;  3Q93 A; 
#chains in the Genus database with same CATH homology
 3EF5 A;  3H95 A;  2GT4 A;  3HYQ A;  5I8U A;  3GWY A;  1V8R A;  1V8N A;  2B2K A;  1Q33 A;  1I9A A;  3X0K A;  2A8P A;  2W4E A;  3R03 A;  3O52 A;  1QVJ A;  1G0S A;  3P5T A;  2YYH A;  3X0R A;  1NQZ A;  3DKU A;  1RRS A;  3A6U A;  2VNQ A;  3FFU A;  3QSJ A;  2KDW A;  3N77 A;  1VK6 A;  3ACA A;  3O69 A;  1MR2 A;  3MGM A;  2KDV A;  1MUT A;  2I6K A;  4J7G A;  1MP2 A;  1NFZ A;  1TUM A;  5GHP A;  4S2W A;  3DUP A;  4NFW A;  3G0Q A;  4C9X A;  4JZS A;  3MDI A;  4V14 A;  3L85 A;  2QJT A;  2DUK A;  1VIU A;  3ID9 A;  1KHZ A;  2AZW A;  1R67 A;  3CNG A;  3FJY A;  1V8S A;  2DSC A;  2O1C A;  1PUN A;  3KVH A;  3OGA A;  5C8L A;  3EEU A;  3X0Q A;  1X84 A;  3X0O A;  5GHM A;  5GHJ A;  3FSP A;  5GHN A;  4ILQ A;  4S2V A;  4NFX A;  5GHO A;  1RRQ A;  1XSB A;  3I9X A;  1X51 A;  2A8T A;  2QJO A;  1HX3 A;  5IW5 A;  5FSN A;  1IRY A;  1SU2 A;  3RH7 A;  2B06 A;  1JRK A;  3I7U A;  5FSI A;  4DYW A;  3Q91 A;  1F3Y A;  3A6S A;  1V8Y A;  2I8T A;  3Q4I A;  4KYX A;  5ANU A;  3F6A A;  1VIQ A;  1RYA A;  3U53 A;  3GZ8 A;  3MCF A;  3GRN A;  3A6T A;  3FK9 A;  2A8S A;  4YPH A;  5DEQ A;  3ZR0 A;  2O5W A;  2R5W A;  4ZG0 A;  5LPG A;  3Q2S A;  4MPO A;  3SON A;  2YVP A;  2A8Q A;  4HVY A;  3N9U A;  4ICK A;  1V8T A;  2PNY A;  1V8I A;  3BAP A;  4JZV A;  3X0N A;  2XSQ A;  1K2E A;  2ICK A;  3Q2T A;  3F13 A;  1PPW A;  1VC8 A;  4N1T A;  2J8Q A;  2DHO A;  2O5F A;  2Q9P A;  2YVM A;  5HZX A;  5DD4 A;  2G73 A;  1PPX A;  4S2X A;  3X0M A;  1VC9 A;  2FVV A;  1XSA A;  1Q54 A;  3O61 A;  4IJX A;  5C7T A;  1G9Q A;  2DSD A;  1NFS A;  3GZ6 A;  3Q1P A;  2CL3 A;  2FML A;  1KT9 A;  4KG4 A;  2DSB A;  2B0V A;  3WHW A;  3X0I A;  4YPR A;  5ANT A;  3X0P A;  1GA7 A;  1VCD A;  1JKN A;  3X0J A;  1VRL A;  3X0S A;  2GT2 A;  3EXQ A;  4C9W A;  2A6T A;  1PUS A;  3MDG A;  1MK1 A;  3O6Z A;  2CZR A;  2ICJ A;  1MQE A;  3SHD A;  2A8R A;  2VNP A;  3COU A;  3O8S A;  3SMD A;  1V8V A;  4YOQ A;  4JZT A;  1V8M A;  2FKB A;  1OW2 A;  3E57 A;  5DDG A;  5CFI A;  2RRK A;  4HFQ A;  5ANV A;  5BS6 A;  5GHQ A;  1X83 A;  3AC9 A;  3BM4 A;  1HZT A;  1V8W A;  4S2Y A;  1MQW A;  1U20 A;  1VHZ A;  2YVN A;  5FSO A;  2I8U A;  4JZU A;  1PVF A;  5GHI A;  1V8L A;  3I7V A;  2YVO A;  3GG6 A;  1NQY A;  5ANS A;  2PQV A;  5FSM A;  4KTB A;  1V8U A;  1XSC A;  2G74 A;  4J7H A;  4N1U A;  5C7Q A;  3EES A;  5FSL A;  1SJY A;  3ZR1 A;  5CFJ A;  2QKM B;  5DPK A;  5IW4 A;  3P6Y A;  3BHO A;  2GB5 A;  3FCM A;  5ANW A;  3A6V A;  1VHG A;  1SOI A;  1KTG A;  3X0L A;  1PPV A;  3GZ5 A;  2JVB A;  4KG3 A;  3HHJ A;  1PUQ A;  1SZ3 A;  5BON A;  1Q27 A;  5FSK A;  5ISY A;  4K6E A;  3J7Y e;  1K26 A;  3Q93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...