3A6UA

Crystal structure of mutt-8-oxo-dgmp-mn(ii) complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
LQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mutator mutT protein
publication title Structural and dynamic features of the MutT protein in the recognition of nucleotides with the mutagenic 8-oxoguanine base
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Hydrolase
total genus 34
structure length 126
sequence length 126
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2009-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3a6uA00
3E57A 1SJYA 1PUQA 2DUKA 5GHIA 3X0RA 4K6EA 5GHPA 2J8QA 1V8NA 5FSNA 3O6ZA 3X0PA 2A8QA 3DUPA 1NQYA 3BHOA 3QSJA 2DSBA 3A6SA 3I9XA 3J7Ye 1PUSA 1X51A 2GT4A 1XSBA 4ICKA 5I8UA 5HZXA 2A8SA 3ZR1A 1IRYA 3ZR0A 3GZ5A 4C9XA 4HVYA 1VCDA 4YPRA 3Q4IA 3O52A 3AC9A 4KTBA 1NFZA 3GZ8A 2ICKA 1MR2A 3O61A 4JZSA 3KVHA 1OW2A 3X0KA 5DEQA 3X0MA 3RH7A 1Q54A 3Q91A 1VHGA 1XSAA 3P6YA 2G74A 1MUTA 1V8YA 4YPHA 3FSPA 3FK9A 3COUA 5BS6A 3FJYA 4N1TA 3SONA 3FFUA 4KYXA 1PPXA 2DHOA 1VHZA 2A8PA 2I8UA 4NFWA 5FSKA 3X0OA 1GA7A 3X0SA 3GZ6A 1RRQA 1JRKA 3A6VA 4ZG0A 2YVMA 1PPWA 1X83A 2CL3A 2GB5A 4S2VA 2PNYA 1PPVA 3H95A 2VNQA 1I9AA 4N1UA 5DD4A 5IW5A 5ANSA 3MGMA 3Q1PA 4JZVA 3DKUA 2RRKA 1VK6A 1V8VA 2YVNA 1TUMA 3GRNA 2Q9PA 3N77A 1Q33A 2O5WA 1MP2A 3U53A 4DYWA 3MDGA 1VRLA 5ANTA 4YOQA 3EF5A 2KDWA 5FSLA 2R5WA 2DSCA 3F13A 2O5FA 1G9QA 1R67A 1Q27A 3ACAA 2VNPA 1VIQA 3BAPA 3O69A 1V8WA 5GHOA 2O1CA 2YYHA 3OGAA 2YVOA 3CNGA 4IJXA 2XSQA 2FMLA 1X84A 1F3YA 5LPGA 1V8SA 1V8IA 2A6TA 4ILQA 1KT9A 1KHZA 4NFXA 1V8UA 5FSOA 4C9WA 3F6AA 5BONA 1XSCA 1V8MA 1QVJA 2B06A 3I7UA 4S2WA 2I6KA 2B0VA 1V8LA 3G0QA 4V14A 3EXQA 2JVBA 5ANWA 3X0IA 2DSDA 5ANVA 4S2YA 1SZ3A 1NQZA 5GHQA 1PUNA 3X0NA 5C7TA 2AZWA 3SHDA 4JZUA 2PQVA 3ID9A 1VIUA 2GT2A 3P5TA 5GHMA 3FCMA 1MK1A 5C8LA 1JKNA 1NFSA 2QJOA 1MQWA 3N9UA 2FVVA 3HYQA 5GHNA 5ANUA 5ISYA 1KTGA 3EESA 5DPKA 1U20A 2G73A 3EEUA 5C7QA 1K2EA 2QKMB 2QJTA 1SOIA 5GHJA 2B2KA 3Q2SA 3WHWA 5CFJA 3Q93A 1RRSA 2YVPA 3X0JA 2KDVA 1RYAA 3A6TA 3I7VA 1HX3A 1V8RA 3X0QA 4S2XA 3MDIA 5DDGA 2W4EA 1VC8A 1VC9A 2ICJA 3HHJA 3O8SA 2FKBA 5IW4A 1K26A 3Q2TA 3R03A 1MQEA 2A8TA 3A6UA 5CFIA 4MPOA 5FSMA 2I8TA 4HFQA 4KG3A 4KG4A 1SU2A 3GG6A 3X0LA 2A8RA 1V8TA 3BM4A 3L85A 3GWYA 3MCFA 5FSIA 1PVFA 1HZTA 4JZTA 3SMDA 1G0SA
chains in the Genus database with same CATH superfamily
3E57A 1SJYA 1PUQA 2DUKA 5GHIA 3X0RA 4K6EA 5GHPA 4J7HA 2J8QA 1V8NA 5FSNA 3O6ZA 3X0PA 2A8QA 3DUPA 1NQYA 3BHOA 3QSJA 2DSBA 3A6SA 3I9XA 3J7Ye 1PUSA 1X51A 2GT4A 1XSBA 4ICKA 5I8UA 5HZXA 2A8SA 3ZR1A 1IRYA 3ZR0A 3GZ5A 4C9XA 4HVYA 1VCDA 4YPRA 3Q4IA 3O52A 3AC9A 4KTBA 1NFZA 3GZ8A 2ICKA 1MR2A 3O61A 4JZSA 3KVHA 1OW2A 3X0KA 5DEQA 3X0MA 3RH7A 1Q54A 3Q91A 1VHGA 1XSAA 3P6YA 2G74A 1MUTA 1V8YA 4YPHA 3FSPA 3FK9A 3COUA 5BS6A 3FJYA 4N1TA 3SONA 3FFUA 4KYXA 1PPXA 2DHOA 1VHZA 2A8PA 2I8UA 4NFWA 5FSKA 3X0OA 1GA7A 3X0SA 3GZ6A 1RRQA 1JRKA 3A6VA 4ZG0A 2YVMA 1PPWA 1X83A 2CL3A 2GB5A 4S2VA 2PNYA 1PPVA 3H95A 2VNQA 1I9AA 4N1UA 5DD4A 5IW5A 5ANSA 3MGMA 3Q1PA 4JZVA 3DKUA 2RRKA 1VK6A 1V8VA 2YVNA 1TUMA 2CZRA 2Q9PA 3GRNA 1Q33A 2O5WA 1MP2A 3N77A 3U53A 4DYWA 1VRLA 5ANTA 4YOQA 3EF5A 2KDWA 5FSLA 2R5WA 2DSCA 3F13A 2O5FA 1G9QA 1R67A 1Q27A 3ACAA 2VNPA 1VIQA 3BAPA 3O69A 1V8WA 5GHOA 2O1CA 2YYHA 3OGAA 2YVOA 3CNGA 4IJXA 2XSQA 2FMLA 1X84A 1F3YA 5LPGA 1V8SA 1V8IA 2A6TA 4ILQA 1KT9A 1KHZA 4NFXA 1V8UA 5FSOA 4C9WA 3F6AA 5BONA 1XSCA 1V8MA 1QVJA 2B06A 3I7UA 4S2WA 2I6KA 2B0VA 1V8LA 3G0QA 4V14A 3EXQA 3MDGA 2JVBA 5ANWA 3X0IA 2DSDA 5ANVA 4S2YA 1SZ3A 1NQZA 5GHQA 1PUNA 3X0NA 5C7TA 2AZWA 3SHDA 4JZUA 2PQVA 3ID9A 1VIUA 2GT2A 3P5TA 5GHMA 3FCMA 1MK1A 5C8LA 1JKNA 1NFSA 2QJOA 1MQWA 3N9UA 2FVVA 3HYQA 5GHNA 5ANUA 5ISYA 1KTGA 3EESA 5DPKA 1U20A 2G73A 3EEUA 5C7QA 1K2EA 2QKMB 2QJTA 1SOIA 5GHJA 2B2KA 3Q2SA 3WHWA 5CFJA 3Q93A 1RRSA 2YVPA 3X0JA 2KDVA 1RYAA 3A6TA 3I7VA 1HX3A 1V8RA 3X0QA 4S2XA 3MDIA 5DDGA 2W4EA 1VC8A 1VC9A 2ICJA 3HHJA 3O8SA 2FKBA 5IW4A 1K26A 3Q2TA 3R03A 1MQEA 2A8TA 3A6UA 5CFIA 4MPOA 5FSMA 2I8TA 4HFQA 4KG3A 4KG4A 1SU2A 3GG6A 3X0LA 2A8RA 1V8TA 3BM4A 4J7GA 3L85A 3GWYA 3MCFA 5FSIA 1PVFA 1HZTA 4JZTA 3SMDA 1G0SA
chains in the Genus database with same CATH topology
3E57A 1SJYA 1PUQA 2DUKA 5GHIA 3X0RA 4K6EA 5GHPA 4J7HA 2J8QA 1V8NA 5FSNA 3O6ZA 3X0PA 2A8QA 3DUPA 1NQYA 3BHOA 3QSJA 2DSBA 3A6SA 3I9XA 3J7Ye 1PUSA 1X51A 2GT4A 1XSBA 4ICKA 5I8UA 5HZXA 2A8SA 3ZR1A 1IRYA 3ZR0A 3GZ5A 4C9XA 4HVYA 1VCDA 4YPRA 3Q4IA 3O52A 3AC9A 4KTBA 1NFZA 3GZ8A 2ICKA 1MR2A 3O61A 4JZSA 3KVHA 1OW2A 3X0KA 5DEQA 3X0MA 3RH7A 1Q54A 3Q91A 1VHGA 1XSAA 3P6YA 2G74A 1MUTA 1V8YA 4YPHA 3FSPA 3FK9A 3COUA 5BS6A 3FJYA 4N1TA 3SONA 3FFUA 4KYXA 1PPXA 2DHOA 1VHZA 2A8PA 2I8UA 4NFWA 5FSKA 3X0OA 1GA7A 3X0SA 3GZ6A 1RRQA 1JRKA 3A6VA 4ZG0A 2YVMA 1PPWA 1X83A 2CL3A 2GB5A 4S2VA 2PNYA 1PPVA 3H95A 2VNQA 1I9AA 4N1UA 5DD4A 5IW5A 5ANSA 3MGMA 3Q1PA 4JZVA 3DKUA 2RRKA 1VK6A 1V8VA 2YVNA 1TUMA 2CZRA 2Q9PA 3GRNA 1Q33A 2O5WA 1MP2A 3N77A 3U53A 4DYWA 1VRLA 5ANTA 4YOQA 3EF5A 2KDWA 5FSLA 2R5WA 2DSCA 3F13A 2O5FA 1G9QA 1R67A 1Q27A 3ACAA 2VNPA 1VIQA 3BAPA 3O69A 1V8WA 5GHOA 2O1CA 2YYHA 3OGAA 2YVOA 3CNGA 4IJXA 2XSQA 2FMLA 1X84A 1F3YA 5LPGA 1V8SA 1V8IA 2A6TA 4ILQA 1KT9A 1KHZA 4NFXA 1V8UA 5FSOA 4C9WA 3F6AA 5BONA 1XSCA 1V8MA 1QVJA 2B06A 3I7UA 4S2WA 2I6KA 2B0VA 1V8LA 3G0QA 4V14A 3EXQA 3MDGA 2JVBA 5ANWA 3X0IA 2DSDA 5ANVA 4S2YA 1SZ3A 1NQZA 5GHQA 1PUNA 3X0NA 5C7TA 2AZWA 3SHDA 4JZUA 2PQVA 3ID9A 1VIUA 2GT2A 3P5TA 5GHMA 3FCMA 1MK1A 5C8LA 1JKNA 1NFSA 2QJOA 1MQWA 3N9UA 2FVVA 3HYQA 5GHNA 5ANUA 5ISYA 1KTGA 3EESA 5DPKA 1U20A 2G73A 3EEUA 5C7QA 1K2EA 2QKMB 2QJTA 1SOIA 5GHJA 2B2KA 3Q2SA 3WHWA 5CFJA 3Q93A 1RRSA 2YVPA 3X0JA 2KDVA 1RYAA 3A6TA 3I7VA 1HX3A 1V8RA 3X0QA 4S2XA 3MDIA 5DDGA 2W4EA 1VC8A 1VC9A 2ICJA 3HHJA 3O8SA 2FKBA 5IW4A 1K26A 3Q2TA 3R03A 1MQEA 2A8TA 3A6UA 5CFIA 4MPOA 5FSMA 2I8TA 4HFQA 4KG3A 4KG4A 1SU2A 3GG6A 3X0LA 2A8RA 1V8TA 3BM4A 4J7GA 3L85A 3GWYA 3MCFA 5FSIA 1PVFA 1HZTA 4JZTA 3SMDA 1G0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E57 A;  1SJY A;  1PUQ A;  2DUK A;  5GHI A;  3X0R A;  4K6E A;  5GHP A;  2J8Q A;  1V8N A;  5FSN A;  3O6Z A;  3X0P A;  2A8Q A;  3DUP A;  1NQY A;  3BHO A;  3QSJ A;  2DSB A;  3A6S A;  3I9X A;  3J7Y e;  1PUS A;  1X51 A;  2GT4 A;  1XSB A;  4ICK A;  5I8U A;  5HZX A;  2A8S A;  3ZR1 A;  1IRY A;  3ZR0 A;  3GZ5 A;  4C9X A;  4HVY A;  1VCD A;  4YPR A;  3Q4I A;  3O52 A;  3AC9 A;  4KTB A;  1NFZ A;  3GZ8 A;  2ICK A;  1MR2 A;  3O61 A;  4JZS A;  3KVH A;  1OW2 A;  3X0K A;  5DEQ A;  3X0M A;  3RH7 A;  1Q54 A;  3Q91 A;  1VHG A;  1XSA A;  3P6Y A;  2G74 A;  1MUT A;  1V8Y A;  4YPH A;  3FSP A;  3FK9 A;  3COU A;  5BS6 A;  3FJY A;  4N1T A;  3SON A;  3FFU A;  4KYX A;  1PPX A;  2DHO A;  1VHZ A;  2A8P A;  2I8U A;  4NFW A;  5FSK A;  3X0O A;  1GA7 A;  3X0S A;  3GZ6 A;  1RRQ A;  1JRK A;  3A6V A;  4ZG0 A;  2YVM A;  1PPW A;  1X83 A;  2CL3 A;  2GB5 A;  4S2V A;  2PNY A;  1PPV A;  3H95 A;  2VNQ A;  1I9A A;  4N1U A;  5DD4 A;  5IW5 A;  5ANS A;  3MGM A;  3Q1P A;  4JZV A;  3DKU A;  2RRK A;  1VK6 A;  1V8V A;  2YVN A;  1TUM A;  3GRN A;  2Q9P A;  3N77 A;  1Q33 A;  2O5W A;  1MP2 A;  3U53 A;  4DYW A;  3MDG A;  1VRL A;  5ANT A;  4YOQ A;  3EF5 A;  2KDW A;  5FSL A;  2R5W A;  2DSC A;  3F13 A;  2O5F A;  1G9Q A;  1R67 A;  1Q27 A;  3ACA A;  2VNP A;  1VIQ A;  3BAP A;  3O69 A;  1V8W A;  5GHO A;  2O1C A;  2YYH A;  3OGA A;  2YVO A;  3CNG A;  4IJX A;  2XSQ A;  2FML A;  1X84 A;  1F3Y A;  5LPG A;  1V8S A;  1V8I A;  2A6T A;  4ILQ A;  1KT9 A;  1KHZ A;  4NFX A;  1V8U A;  5FSO A;  4C9W A;  3F6A A;  5BON A;  1XSC A;  1V8M A;  1QVJ A;  2B06 A;  3I7U A;  4S2W A;  2I6K A;  2B0V A;  1V8L A;  3G0Q A;  4V14 A;  3EXQ A;  2JVB A;  5ANW A;  3X0I A;  2DSD A;  5ANV A;  4S2Y A;  1SZ3 A;  1NQZ A;  5GHQ A;  1PUN A;  3X0N A;  5C7T A;  2AZW A;  3SHD A;  4JZU A;  2PQV A;  3ID9 A;  1VIU A;  2GT2 A;  3P5T A;  5GHM A;  3FCM A;  1MK1 A;  5C8L A;  1JKN A;  1NFS A;  2QJO A;  1MQW A;  3N9U A;  2FVV A;  3HYQ A;  5GHN A;  5ANU A;  5ISY A;  1KTG A;  3EES A;  5DPK A;  1U20 A;  2G73 A;  3EEU A;  5C7Q A;  1K2E A;  2QKM B;  2QJT A;  1SOI A;  5GHJ A;  2B2K A;  3Q2S A;  3WHW A;  5CFJ A;  3Q93 A;  1RRS A;  2YVP A;  3X0J A;  2KDV A;  1RYA A;  3A6T A;  3I7V A;  1HX3 A;  1V8R A;  3X0Q A;  4S2X A;  3MDI A;  5DDG A;  2W4E A;  1VC8 A;  1VC9 A;  2ICJ A;  3HHJ A;  3O8S A;  2FKB A;  5IW4 A;  1K26 A;  3Q2T A;  3R03 A;  1MQE A;  2A8T A;  3A6U A;  5CFI A;  4MPO A;  5FSM A;  2I8T A;  4HFQ A;  4KG3 A;  4KG4 A;  1SU2 A;  3GG6 A;  3X0L A;  2A8R A;  1V8T A;  3BM4 A;  3L85 A;  3GWY A;  3MCF A;  5FSI A;  1PVF A;  1HZT A;  4JZT A;  3SMD A;  1G0S A; 
#chains in the Genus database with same CATH topology
 3E57 A;  1SJY A;  1PUQ A;  2DUK A;  5GHI A;  3X0R A;  4K6E A;  5GHP A;  4J7H A;  2J8Q A;  1V8N A;  5FSN A;  3O6Z A;  3X0P A;  2A8Q A;  3DUP A;  1NQY A;  3BHO A;  3QSJ A;  2DSB A;  3A6S A;  3I9X A;  3J7Y e;  1PUS A;  1X51 A;  2GT4 A;  1XSB A;  4ICK A;  5I8U A;  5HZX A;  2A8S A;  3ZR1 A;  1IRY A;  3ZR0 A;  3GZ5 A;  4C9X A;  4HVY A;  1VCD A;  4YPR A;  3Q4I A;  3O52 A;  3AC9 A;  4KTB A;  1NFZ A;  3GZ8 A;  2ICK A;  1MR2 A;  3O61 A;  4JZS A;  3KVH A;  1OW2 A;  3X0K A;  5DEQ A;  3X0M A;  3RH7 A;  1Q54 A;  3Q91 A;  1VHG A;  1XSA A;  3P6Y A;  2G74 A;  1MUT A;  1V8Y A;  4YPH A;  3FSP A;  3FK9 A;  3COU A;  5BS6 A;  3FJY A;  4N1T A;  3SON A;  3FFU A;  4KYX A;  1PPX A;  2DHO A;  1VHZ A;  2A8P A;  2I8U A;  4NFW A;  5FSK A;  3X0O A;  1GA7 A;  3X0S A;  3GZ6 A;  1RRQ A;  1JRK A;  3A6V A;  4ZG0 A;  2YVM A;  1PPW A;  1X83 A;  2CL3 A;  2GB5 A;  4S2V A;  2PNY A;  1PPV A;  3H95 A;  2VNQ A;  1I9A A;  4N1U A;  5DD4 A;  5IW5 A;  5ANS A;  3MGM A;  3Q1P A;  4JZV A;  3DKU A;  2RRK A;  1VK6 A;  1V8V A;  2YVN A;  1TUM A;  2CZR A;  2Q9P A;  3GRN A;  1Q33 A;  2O5W A;  1MP2 A;  3N77 A;  3U53 A;  4DYW A;  1VRL A;  5ANT A;  4YOQ A;  3EF5 A;  2KDW A;  5FSL A;  2R5W A;  2DSC A;  3F13 A;  2O5F A;  1G9Q A;  1R67 A;  1Q27 A;  3ACA A;  2VNP A;  1VIQ A;  3BAP A;  3O69 A;  1V8W A;  5GHO A;  2O1C A;  2YYH A;  3OGA A;  2YVO A;  3CNG A;  4IJX A;  2XSQ A;  2FML A;  1X84 A;  1F3Y A;  5LPG A;  1V8S A;  1V8I A;  2A6T A;  4ILQ A;  1KT9 A;  1KHZ A;  4NFX A;  1V8U A;  5FSO A;  4C9W A;  3F6A A;  5BON A;  1XSC A;  1V8M A;  1QVJ A;  2B06 A;  3I7U A;  4S2W A;  2I6K A;  2B0V A;  1V8L A;  3G0Q A;  4V14 A;  3EXQ A;  3MDG A;  2JVB A;  5ANW A;  3X0I A;  2DSD A;  5ANV A;  4S2Y A;  1SZ3 A;  1NQZ A;  5GHQ A;  1PUN A;  3X0N A;  5C7T A;  2AZW A;  3SHD A;  4JZU A;  2PQV A;  3ID9 A;  1VIU A;  2GT2 A;  3P5T A;  5GHM A;  3FCM A;  1MK1 A;  5C8L A;  1JKN A;  1NFS A;  2QJO A;  1MQW A;  3N9U A;  2FVV A;  3HYQ A;  5GHN A;  5ANU A;  5ISY A;  1KTG A;  3EES A;  5DPK A;  1U20 A;  2G73 A;  3EEU A;  5C7Q A;  1K2E A;  2QKM B;  2QJT A;  1SOI A;  5GHJ A;  2B2K A;  3Q2S A;  3WHW A;  5CFJ A;  3Q93 A;  1RRS A;  2YVP A;  3X0J A;  2KDV A;  1RYA A;  3A6T A;  3I7V A;  1HX3 A;  1V8R A;  3X0Q A;  4S2X A;  3MDI A;  5DDG A;  2W4E A;  1VC8 A;  1VC9 A;  2ICJ A;  3HHJ A;  3O8S A;  2FKB A;  5IW4 A;  1K26 A;  3Q2T A;  3R03 A;  1MQE A;  2A8T A;  3A6U A;  5CFI A;  4MPO A;  5FSM A;  2I8T A;  4HFQ A;  4KG3 A;  4KG4 A;  1SU2 A;  3GG6 A;  3X0L A;  2A8R A;  1V8T A;  3BM4 A;  4J7G A;  3L85 A;  3GWY A;  3MCF A;  5FSI A;  1PVF A;  1HZT A;  4JZT A;  3SMD A;  1G0S A; 
#chains in the Genus database with same CATH homology
 3E57 A;  1SJY A;  1PUQ A;  2DUK A;  5GHI A;  3X0R A;  4K6E A;  5GHP A;  4J7H A;  2J8Q A;  1V8N A;  5FSN A;  3O6Z A;  3X0P A;  2A8Q A;  3DUP A;  1NQY A;  3BHO A;  3QSJ A;  2DSB A;  3A6S A;  3I9X A;  3J7Y e;  1PUS A;  1X51 A;  2GT4 A;  1XSB A;  4ICK A;  5I8U A;  5HZX A;  2A8S A;  3ZR1 A;  1IRY A;  3ZR0 A;  3GZ5 A;  4C9X A;  4HVY A;  1VCD A;  4YPR A;  3Q4I A;  3O52 A;  3AC9 A;  4KTB A;  1NFZ A;  3GZ8 A;  2ICK A;  1MR2 A;  3O61 A;  4JZS A;  3KVH A;  1OW2 A;  3X0K A;  5DEQ A;  3X0M A;  3RH7 A;  1Q54 A;  3Q91 A;  1VHG A;  1XSA A;  3P6Y A;  2G74 A;  1MUT A;  1V8Y A;  4YPH A;  3FSP A;  3FK9 A;  3COU A;  5BS6 A;  3FJY A;  4N1T A;  3SON A;  3FFU A;  4KYX A;  1PPX A;  2DHO A;  1VHZ A;  2A8P A;  2I8U A;  4NFW A;  5FSK A;  3X0O A;  1GA7 A;  3X0S A;  3GZ6 A;  1RRQ A;  1JRK A;  3A6V A;  4ZG0 A;  2YVM A;  1PPW A;  1X83 A;  2CL3 A;  2GB5 A;  4S2V A;  2PNY A;  1PPV A;  3H95 A;  2VNQ A;  1I9A A;  4N1U A;  5DD4 A;  5IW5 A;  5ANS A;  3MGM A;  3Q1P A;  4JZV A;  3DKU A;  2RRK A;  1VK6 A;  1V8V A;  2YVN A;  1TUM A;  2CZR A;  2Q9P A;  3GRN A;  1Q33 A;  2O5W A;  1MP2 A;  3N77 A;  3U53 A;  4DYW A;  1VRL A;  5ANT A;  4YOQ A;  3EF5 A;  2KDW A;  5FSL A;  2R5W A;  2DSC A;  3F13 A;  2O5F A;  1G9Q A;  1R67 A;  1Q27 A;  3ACA A;  2VNP A;  1VIQ A;  3BAP A;  3O69 A;  1V8W A;  5GHO A;  2O1C A;  2YYH A;  3OGA A;  2YVO A;  3CNG A;  4IJX A;  2XSQ A;  2FML A;  1X84 A;  1F3Y A;  5LPG A;  1V8S A;  1V8I A;  2A6T A;  4ILQ A;  1KT9 A;  1KHZ A;  4NFX A;  1V8U A;  5FSO A;  4C9W A;  3F6A A;  5BON A;  1XSC A;  1V8M A;  1QVJ A;  2B06 A;  3I7U A;  4S2W A;  2I6K A;  2B0V A;  1V8L A;  3G0Q A;  4V14 A;  3EXQ A;  3MDG A;  2JVB A;  5ANW A;  3X0I A;  2DSD A;  5ANV A;  4S2Y A;  1SZ3 A;  1NQZ A;  5GHQ A;  1PUN A;  3X0N A;  5C7T A;  2AZW A;  3SHD A;  4JZU A;  2PQV A;  3ID9 A;  1VIU A;  2GT2 A;  3P5T A;  5GHM A;  3FCM A;  1MK1 A;  5C8L A;  1JKN A;  1NFS A;  2QJO A;  1MQW A;  3N9U A;  2FVV A;  3HYQ A;  5GHN A;  5ANU A;  5ISY A;  1KTG A;  3EES A;  5DPK A;  1U20 A;  2G73 A;  3EEU A;  5C7Q A;  1K2E A;  2QKM B;  2QJT A;  1SOI A;  5GHJ A;  2B2K A;  3Q2S A;  3WHW A;  5CFJ A;  3Q93 A;  1RRS A;  2YVP A;  3X0J A;  2KDV A;  1RYA A;  3A6T A;  3I7V A;  1HX3 A;  1V8R A;  3X0Q A;  4S2X A;  3MDI A;  5DDG A;  2W4E A;  1VC8 A;  1VC9 A;  2ICJ A;  3HHJ A;  3O8S A;  2FKB A;  5IW4 A;  1K26 A;  3Q2T A;  3R03 A;  1MQE A;  2A8T A;  3A6U A;  5CFI A;  4MPO A;  5FSM A;  2I8T A;  4HFQ A;  4KG3 A;  4KG4 A;  1SU2 A;  3GG6 A;  3X0L A;  2A8R A;  1V8T A;  3BM4 A;  4J7G A;  3L85 A;  3GWY A;  3MCF A;  5FSI A;  1PVF A;  1HZT A;  4JZT A;  3SMD A;  1G0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...