5FSIA

Mth1 substrate recognition: complex with 8-oxo-dgtp.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
154
structure length
154
Chain Sequence
b'ASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7,8-DIHYDRO-8-OXOGUANINE TRIPHOSPHATASE
publication title Mth1 Substrate Recognition--an Example of Specific Promiscuity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 39
structure length 154
sequence length 154
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5fsiA00
2DUKA 4KYXA 5ANTA 4S2VA 3L85A 4JZUA 3SHDA 1JKNA 3BAPA 3O8SA 1SJYA 4N1TA 2AZWA 3P6YA 5FSKA 1V8IA 3O61A 3X0NA 3GZ8A 4NFWA 2B2KA 1GA7A 1KHZA 1MQEA 2GB5A 2JVBA 3A6VA 1PPVA 4YPRA 5I8UA 2QJOA 3X0IA 5GHQA 2A8QA 5GHPA 3EXQA 2A8PA 5ANVA 3RH7A 1XSAA 4MPOA 1PUNA 5DDGA 5CFJA 3X0MA 2A8RA 4N1UA 5IW5A 3GWYA 5DEQA 3MGMA 3Q91A 1VHGA 3DKUA 3ZR0A 5C7TA 2ICJA 3MCFA 3X0OA 1VIQA 3F6AA 2PNYA 3DUPA 2DHOA 3FSPA 5FSOA 1PPWA 3ID9A 3O6ZA 1PPXA 3A6TA 3ACAA 3EEUA 4ZG0A 3X0PA 1V8MA 1F3YA 4YOQA 1KT9A 2B06A 3Q93A 1RYAA 3GZ5A 3KVHA 1K26A 4HFQA 3SONA 3P5TA 4KG3A 1V8WA 3E57A 1VHZA 2J8QA 3Q2TA 1MP2A 2KDVA 2QKMB 5LPGA 1IRYA 4ICKA 3Q4IA 2O5FA 4S2YA 4JZSA 2GT4A 5CFIA 4KTBA 1VK6A 5ISYA 2I6KA 3MDGA 1V8NA 4DYWA 2A8SA 1NQYA 1NFSA 1V8TA 2DSCA 1RRQA 3N77A 1X84A 4V14A 5BS6A 4NFXA 2VNQA 3BM4A 1XSCA 1VCDA 2ICKA 1MQWA 1VC8A 3O52A 3OGAA 2GT2A 2B0VA 2G74A 2W4EA 5GHOA 1PUQA 2XSQA 4C9XA 1NQZA 5FSNA 4S2WA 1G9QA 2R5WA 3X0JA 1Q54A 1PUSA 3EESA 1R67A 3F13A 1SU2A 1QVJA 1V8UA 2FVVA 2PQVA 1HX3A 2CL3A 1SOIA 4C9WA 1OW2A 3Q1PA 3MDIA 3EF5A 3FJYA 3I7UA 3U53A 1NFZA 1RRSA 3X0LA 3ZR1A 2I8TA 5BONA 3QSJA 5GHJA 5FSMA 1V8LA 3J7Ye 3HYQA 5ANWA 3FCMA 5C8LA 5DPKA 1V8VA 5DD4A 3A6UA 1K2EA 1PVFA 3X0RA 3WHWA 4JZTA 3GZ6A 2KDWA 4ILQA 1XSBA 1VIUA 1TUMA 2FKBA 2DSBA 3A6SA 1Q27A 3I7VA 4K6EA 5GHIA 5GHMA 2G73A 1SZ3A 2O1CA 3H95A 1V8YA 3X0KA 3R03A 1V8SA 2I8UA 2YVMA 2VNPA 2DSDA 2YVPA 3Q2SA 5C7QA 1V8RA 1X83A 4JZVA 5FSLA 5GHNA 2A6TA 1I9AA 5ANUA 3SMDA 4S2XA 2O5WA 5ANSA 1MK1A 3FK9A 3N9UA 1VRLA 3HHJA 2Q9PA 2YVNA 3I9XA 3X0SA 3X0QA 1JRKA 1MUTA 3AC9A 1Q33A 3FFUA 3O69A 2FMLA 2YYHA 3COUA 3CNGA 2QJTA 1VC9A 4KG4A 2YVOA 1KTGA 1MR2A 2A8TA 2RRKA 3BHOA 4IJXA 1X51A 3GG6A 5FSIA 4HVYA 5HZXA 4YPHA 1U20A 3G0QA 3GRNA 5IW4A 1HZTA 1G0SA
chains in the Genus database with same CATH superfamily
2DUKA 4KYXA 5ANTA 4S2VA 3L85A 4JZUA 3SHDA 1JKNA 3BAPA 3O8SA 1SJYA 4N1TA 2AZWA 3P6YA 5FSKA 1V8IA 3O61A 3X0NA 3GZ8A 4NFWA 2B2KA 1GA7A 1KHZA 1MQEA 2GB5A 2JVBA 3A6VA 1PPVA 4YPRA 5I8UA 2QJOA 3X0IA 5GHQA 2A8QA 5GHPA 3EXQA 2A8PA 5ANVA 3RH7A 1XSAA 4MPOA 1PUNA 5DDGA 5CFJA 3X0MA 2A8RA 4N1UA 5IW5A 3GWYA 5DEQA 3MGMA 3Q91A 1VHGA 3DKUA 3ZR0A 5C7TA 2ICJA 3MCFA 3X0OA 1VIQA 3F6AA 2PNYA 3DUPA 2CZRA 2DHOA 3FSPA 5FSOA 1PPWA 3ID9A 3O6ZA 1PPXA 3A6TA 3ACAA 3EEUA 4ZG0A 3X0PA 1V8MA 1F3YA 4YOQA 1KT9A 2B06A 3Q93A 1RYAA 3GZ5A 3KVHA 1K26A 4HFQA 4J7GA 3SONA 3P5TA 4KG3A 1V8WA 3E57A 1VHZA 2J8QA 3Q2TA 1MP2A 2KDVA 2QKMB 5LPGA 1IRYA 4ICKA 3Q4IA 2O5FA 4S2YA 4JZSA 2GT4A 5CFIA 4KTBA 1VK6A 5ISYA 2I6KA 3MDGA 1V8NA 4DYWA 2A8SA 1NQYA 1NFSA 1V8TA 2DSCA 1RRQA 3N77A 1X84A 4V14A 5BS6A 4NFXA 2VNQA 3BM4A 1XSCA 1VCDA 2ICKA 1MQWA 1VC8A 3O52A 3OGAA 2GT2A 2B0VA 2G74A 2W4EA 5GHOA 1PUQA 2XSQA 4C9XA 1NQZA 5FSNA 4S2WA 1G9QA 2R5WA 3X0JA 1Q54A 1PUSA 3EESA 1R67A 3F13A 1SU2A 1QVJA 1V8UA 2FVVA 2PQVA 1HX3A 2CL3A 1SOIA 4C9WA 1OW2A 3Q1PA 3MDIA 3EF5A 3FJYA 3I7UA 3U53A 1NFZA 1RRSA 3X0LA 3ZR1A 2I8TA 5BONA 3QSJA 5GHJA 5FSMA 1V8LA 3J7Ye 3HYQA 5ANWA 3FCMA 5C8LA 5DPKA 1V8VA 5DD4A 3A6UA 1K2EA 1PVFA 3X0RA 3WHWA 4JZTA 3GZ6A 2KDWA 4ILQA 1XSBA 1VIUA 1TUMA 2FKBA 2DSBA 3A6SA 1Q27A 3I7VA 4K6EA 5GHIA 5GHMA 2G73A 1SZ3A 2O1CA 3H95A 1V8YA 3X0KA 3R03A 1V8SA 2I8UA 2YVMA 2VNPA 2DSDA 2YVPA 3Q2SA 5C7QA 1V8RA 1X83A 4JZVA 5FSLA 5GHNA 2A6TA 1I9AA 5ANUA 3SMDA 4S2XA 2O5WA 5ANSA 1MK1A 3FK9A 3N9UA 1VRLA 3HHJA 2Q9PA 2YVNA 3I9XA 3X0SA 3X0QA 1JRKA 1MUTA 3AC9A 1Q33A 3FFUA 3O69A 2FMLA 2YYHA 3COUA 3CNGA 2QJTA 1VC9A 4J7HA 4KG4A 2YVOA 1KTGA 1MR2A 2A8TA 2RRKA 3BHOA 4IJXA 1X51A 3GG6A 5FSIA 4HVYA 5HZXA 4YPHA 1U20A 3G0QA 3GRNA 5IW4A 1HZTA 1G0SA
chains in the Genus database with same CATH topology
2DUKA 4KYXA 5ANTA 4S2VA 3L85A 4JZUA 3SHDA 1JKNA 3BAPA 3O8SA 1SJYA 4N1TA 2AZWA 3P6YA 5FSKA 1V8IA 3O61A 3X0NA 3GZ8A 4NFWA 2B2KA 1GA7A 1KHZA 1MQEA 2GB5A 2JVBA 3A6VA 1PPVA 4YPRA 5I8UA 2QJOA 3X0IA 5GHQA 2A8QA 5GHPA 3EXQA 2A8PA 5ANVA 3RH7A 1XSAA 4MPOA 1PUNA 5DDGA 5CFJA 3X0MA 2A8RA 4N1UA 5IW5A 3GWYA 5DEQA 3MGMA 3Q91A 1VHGA 3DKUA 3ZR0A 5C7TA 2ICJA 3MCFA 3X0OA 1VIQA 3F6AA 2PNYA 3DUPA 2CZRA 2DHOA 3FSPA 5FSOA 1PPWA 3ID9A 3O6ZA 1PPXA 3A6TA 3ACAA 3EEUA 4ZG0A 3X0PA 1V8MA 1F3YA 4YOQA 1KT9A 2B06A 3Q93A 1RYAA 3GZ5A 3KVHA 1K26A 4HFQA 4J7GA 3SONA 3P5TA 4KG3A 1V8WA 3E57A 1VHZA 2J8QA 3Q2TA 1MP2A 2KDVA 2QKMB 5LPGA 1IRYA 4ICKA 3Q4IA 2O5FA 4S2YA 4JZSA 2GT4A 5CFIA 4KTBA 1VK6A 5ISYA 2I6KA 3MDGA 1V8NA 4DYWA 2A8SA 1NQYA 1NFSA 1V8TA 2DSCA 1RRQA 3N77A 1X84A 4V14A 5BS6A 4NFXA 2VNQA 3BM4A 1XSCA 1VCDA 2ICKA 1MQWA 1VC8A 3O52A 3OGAA 2GT2A 2B0VA 2G74A 2W4EA 5GHOA 1PUQA 2XSQA 4C9XA 1NQZA 5FSNA 4S2WA 1G9QA 2R5WA 3X0JA 1Q54A 1PUSA 3EESA 1R67A 3F13A 1SU2A 1QVJA 1V8UA 2FVVA 2PQVA 1HX3A 2CL3A 1SOIA 4C9WA 1OW2A 3Q1PA 3MDIA 3EF5A 3FJYA 3I7UA 3U53A 1NFZA 1RRSA 3X0LA 3ZR1A 2I8TA 5BONA 3QSJA 5GHJA 5FSMA 1V8LA 3J7Ye 3HYQA 5ANWA 3FCMA 5C8LA 5DPKA 1V8VA 5DD4A 3A6UA 1K2EA 1PVFA 3X0RA 3WHWA 4JZTA 3GZ6A 2KDWA 4ILQA 1XSBA 1VIUA 1TUMA 2FKBA 2DSBA 3A6SA 1Q27A 3I7VA 4K6EA 5GHIA 5GHMA 2G73A 1SZ3A 2O1CA 3H95A 1V8YA 3X0KA 3R03A 1V8SA 2I8UA 2YVMA 2VNPA 2DSDA 2YVPA 3Q2SA 5C7QA 1V8RA 1X83A 4JZVA 5FSLA 5GHNA 2A6TA 1I9AA 5ANUA 3SMDA 4S2XA 2O5WA 5ANSA 1MK1A 3FK9A 3N9UA 1VRLA 3HHJA 2Q9PA 2YVNA 3I9XA 3X0SA 3X0QA 1JRKA 1MUTA 3AC9A 1Q33A 3FFUA 3O69A 2FMLA 2YYHA 3COUA 3CNGA 2QJTA 1VC9A 4J7HA 4KG4A 2YVOA 1KTGA 1MR2A 2A8TA 2RRKA 3BHOA 4IJXA 1X51A 3GG6A 5FSIA 4HVYA 5HZXA 4YPHA 1U20A 3G0QA 3GRNA 5IW4A 1HZTA 1G0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DUK A;  4KYX A;  5ANT A;  4S2V A;  3L85 A;  4JZU A;  3SHD A;  1JKN A;  3BAP A;  3O8S A;  1SJY A;  4N1T A;  2AZW A;  3P6Y A;  5FSK A;  1V8I A;  3O61 A;  3X0N A;  3GZ8 A;  4NFW A;  2B2K A;  1GA7 A;  1KHZ A;  1MQE A;  2GB5 A;  2JVB A;  3A6V A;  1PPV A;  4YPR A;  5I8U A;  2QJO A;  3X0I A;  5GHQ A;  2A8Q A;  5GHP A;  3EXQ A;  2A8P A;  5ANV A;  3RH7 A;  1XSA A;  4MPO A;  1PUN A;  5DDG A;  5CFJ A;  3X0M A;  2A8R A;  4N1U A;  5IW5 A;  3GWY A;  5DEQ A;  3MGM A;  3Q91 A;  1VHG A;  3DKU A;  3ZR0 A;  5C7T A;  2ICJ A;  3MCF A;  3X0O A;  1VIQ A;  3F6A A;  2PNY A;  3DUP A;  2DHO A;  3FSP A;  5FSO A;  1PPW A;  3ID9 A;  3O6Z A;  1PPX A;  3A6T A;  3ACA A;  3EEU A;  4ZG0 A;  3X0P A;  1V8M A;  1F3Y A;  4YOQ A;  1KT9 A;  2B06 A;  3Q93 A;  1RYA A;  3GZ5 A;  3KVH A;  1K26 A;  4HFQ A;  3SON A;  3P5T A;  4KG3 A;  1V8W A;  3E57 A;  1VHZ A;  2J8Q A;  3Q2T A;  1MP2 A;  2KDV A;  2QKM B;  5LPG A;  1IRY A;  4ICK A;  3Q4I A;  2O5F A;  4S2Y A;  4JZS A;  2GT4 A;  5CFI A;  4KTB A;  1VK6 A;  5ISY A;  2I6K A;  3MDG A;  1V8N A;  4DYW A;  2A8S A;  1NQY A;  1NFS A;  1V8T A;  2DSC A;  1RRQ A;  3N77 A;  1X84 A;  4V14 A;  5BS6 A;  4NFX A;  2VNQ A;  3BM4 A;  1XSC A;  1VCD A;  2ICK A;  1MQW A;  1VC8 A;  3O52 A;  3OGA A;  2GT2 A;  2B0V A;  2G74 A;  2W4E A;  5GHO A;  1PUQ A;  2XSQ A;  4C9X A;  1NQZ A;  5FSN A;  4S2W A;  1G9Q A;  2R5W A;  3X0J A;  1Q54 A;  1PUS A;  3EES A;  1R67 A;  3F13 A;  1SU2 A;  1QVJ A;  1V8U A;  2FVV A;  2PQV A;  1HX3 A;  2CL3 A;  1SOI A;  4C9W A;  1OW2 A;  3Q1P A;  3MDI A;  3EF5 A;  3FJY A;  3I7U A;  3U53 A;  1NFZ A;  1RRS A;  3X0L A;  3ZR1 A;  2I8T A;  5BON A;  3QSJ A;  5GHJ A;  5FSM A;  1V8L A;  3J7Y e;  3HYQ A;  5ANW A;  3FCM A;  5C8L A;  5DPK A;  1V8V A;  5DD4 A;  3A6U A;  1K2E A;  1PVF A;  3X0R A;  3WHW A;  4JZT A;  3GZ6 A;  2KDW A;  4ILQ A;  1XSB A;  1VIU A;  1TUM A;  2FKB A;  2DSB A;  3A6S A;  1Q27 A;  3I7V A;  4K6E A;  5GHI A;  5GHM A;  2G73 A;  1SZ3 A;  2O1C A;  3H95 A;  1V8Y A;  3X0K A;  3R03 A;  1V8S A;  2I8U A;  2YVM A;  2VNP A;  2DSD A;  2YVP A;  3Q2S A;  5C7Q A;  1V8R A;  1X83 A;  4JZV A;  5FSL A;  5GHN A;  2A6T A;  1I9A A;  5ANU A;  3SMD A;  4S2X A;  2O5W A;  5ANS A;  1MK1 A;  3FK9 A;  3N9U A;  1VRL A;  3HHJ A;  2Q9P A;  2YVN A;  3I9X A;  3X0S A;  3X0Q A;  1JRK A;  1MUT A;  3AC9 A;  1Q33 A;  3FFU A;  3O69 A;  2FML A;  2YYH A;  3COU A;  3CNG A;  2QJT A;  1VC9 A;  4KG4 A;  2YVO A;  1KTG A;  1MR2 A;  2A8T A;  2RRK A;  3BHO A;  4IJX A;  1X51 A;  3GG6 A;  5FSI A;  4HVY A;  5HZX A;  4YPH A;  1U20 A;  3G0Q A;  3GRN A;  5IW4 A;  1HZT A;  1G0S A; 
#chains in the Genus database with same CATH topology
 2DUK A;  4KYX A;  5ANT A;  4S2V A;  3L85 A;  4JZU A;  3SHD A;  1JKN A;  3BAP A;  3O8S A;  1SJY A;  4N1T A;  2AZW A;  3P6Y A;  5FSK A;  1V8I A;  3O61 A;  3X0N A;  3GZ8 A;  4NFW A;  2B2K A;  1GA7 A;  1KHZ A;  1MQE A;  2GB5 A;  2JVB A;  3A6V A;  1PPV A;  4YPR A;  5I8U A;  2QJO A;  3X0I A;  5GHQ A;  2A8Q A;  5GHP A;  3EXQ A;  2A8P A;  5ANV A;  3RH7 A;  1XSA A;  4MPO A;  1PUN A;  5DDG A;  5CFJ A;  3X0M A;  2A8R A;  4N1U A;  5IW5 A;  3GWY A;  5DEQ A;  3MGM A;  3Q91 A;  1VHG A;  3DKU A;  3ZR0 A;  5C7T A;  2ICJ A;  3MCF A;  3X0O A;  1VIQ A;  3F6A A;  2PNY A;  3DUP A;  2CZR A;  2DHO A;  3FSP A;  5FSO A;  1PPW A;  3ID9 A;  3O6Z A;  1PPX A;  3A6T A;  3ACA A;  3EEU A;  4ZG0 A;  3X0P A;  1V8M A;  1F3Y A;  4YOQ A;  1KT9 A;  2B06 A;  3Q93 A;  1RYA A;  3GZ5 A;  3KVH A;  1K26 A;  4HFQ A;  4J7G A;  3SON A;  3P5T A;  4KG3 A;  1V8W A;  3E57 A;  1VHZ A;  2J8Q A;  3Q2T A;  1MP2 A;  2KDV A;  2QKM B;  5LPG A;  1IRY A;  4ICK A;  3Q4I A;  2O5F A;  4S2Y A;  4JZS A;  2GT4 A;  5CFI A;  4KTB A;  1VK6 A;  5ISY A;  2I6K A;  3MDG A;  1V8N A;  4DYW A;  2A8S A;  1NQY A;  1NFS A;  1V8T A;  2DSC A;  1RRQ A;  3N77 A;  1X84 A;  4V14 A;  5BS6 A;  4NFX A;  2VNQ A;  3BM4 A;  1XSC A;  1VCD A;  2ICK A;  1MQW A;  1VC8 A;  3O52 A;  3OGA A;  2GT2 A;  2B0V A;  2G74 A;  2W4E A;  5GHO A;  1PUQ A;  2XSQ A;  4C9X A;  1NQZ A;  5FSN A;  4S2W A;  1G9Q A;  2R5W A;  3X0J A;  1Q54 A;  1PUS A;  3EES A;  1R67 A;  3F13 A;  1SU2 A;  1QVJ A;  1V8U A;  2FVV A;  2PQV A;  1HX3 A;  2CL3 A;  1SOI A;  4C9W A;  1OW2 A;  3Q1P A;  3MDI A;  3EF5 A;  3FJY A;  3I7U A;  3U53 A;  1NFZ A;  1RRS A;  3X0L A;  3ZR1 A;  2I8T A;  5BON A;  3QSJ A;  5GHJ A;  5FSM A;  1V8L A;  3J7Y e;  3HYQ A;  5ANW A;  3FCM A;  5C8L A;  5DPK A;  1V8V A;  5DD4 A;  3A6U A;  1K2E A;  1PVF A;  3X0R A;  3WHW A;  4JZT A;  3GZ6 A;  2KDW A;  4ILQ A;  1XSB A;  1VIU A;  1TUM A;  2FKB A;  2DSB A;  3A6S A;  1Q27 A;  3I7V A;  4K6E A;  5GHI A;  5GHM A;  2G73 A;  1SZ3 A;  2O1C A;  3H95 A;  1V8Y A;  3X0K A;  3R03 A;  1V8S A;  2I8U A;  2YVM A;  2VNP A;  2DSD A;  2YVP A;  3Q2S A;  5C7Q A;  1V8R A;  1X83 A;  4JZV A;  5FSL A;  5GHN A;  2A6T A;  1I9A A;  5ANU A;  3SMD A;  4S2X A;  2O5W A;  5ANS A;  1MK1 A;  3FK9 A;  3N9U A;  1VRL A;  3HHJ A;  2Q9P A;  2YVN A;  3I9X A;  3X0S A;  3X0Q A;  1JRK A;  1MUT A;  3AC9 A;  1Q33 A;  3FFU A;  3O69 A;  2FML A;  2YYH A;  3COU A;  3CNG A;  2QJT A;  1VC9 A;  4J7H A;  4KG4 A;  2YVO A;  1KTG A;  1MR2 A;  2A8T A;  2RRK A;  3BHO A;  4IJX A;  1X51 A;  3GG6 A;  5FSI A;  4HVY A;  5HZX A;  4YPH A;  1U20 A;  3G0Q A;  3GRN A;  5IW4 A;  1HZT A;  1G0S A; 
#chains in the Genus database with same CATH homology
 2DUK A;  4KYX A;  5ANT A;  4S2V A;  3L85 A;  4JZU A;  3SHD A;  1JKN A;  3BAP A;  3O8S A;  1SJY A;  4N1T A;  2AZW A;  3P6Y A;  5FSK A;  1V8I A;  3O61 A;  3X0N A;  3GZ8 A;  4NFW A;  2B2K A;  1GA7 A;  1KHZ A;  1MQE A;  2GB5 A;  2JVB A;  3A6V A;  1PPV A;  4YPR A;  5I8U A;  2QJO A;  3X0I A;  5GHQ A;  2A8Q A;  5GHP A;  3EXQ A;  2A8P A;  5ANV A;  3RH7 A;  1XSA A;  4MPO A;  1PUN A;  5DDG A;  5CFJ A;  3X0M A;  2A8R A;  4N1U A;  5IW5 A;  3GWY A;  5DEQ A;  3MGM A;  3Q91 A;  1VHG A;  3DKU A;  3ZR0 A;  5C7T A;  2ICJ A;  3MCF A;  3X0O A;  1VIQ A;  3F6A A;  2PNY A;  3DUP A;  2CZR A;  2DHO A;  3FSP A;  5FSO A;  1PPW A;  3ID9 A;  3O6Z A;  1PPX A;  3A6T A;  3ACA A;  3EEU A;  4ZG0 A;  3X0P A;  1V8M A;  1F3Y A;  4YOQ A;  1KT9 A;  2B06 A;  3Q93 A;  1RYA A;  3GZ5 A;  3KVH A;  1K26 A;  4HFQ A;  4J7G A;  3SON A;  3P5T A;  4KG3 A;  1V8W A;  3E57 A;  1VHZ A;  2J8Q A;  3Q2T A;  1MP2 A;  2KDV A;  2QKM B;  5LPG A;  1IRY A;  4ICK A;  3Q4I A;  2O5F A;  4S2Y A;  4JZS A;  2GT4 A;  5CFI A;  4KTB A;  1VK6 A;  5ISY A;  2I6K A;  3MDG A;  1V8N A;  4DYW A;  2A8S A;  1NQY A;  1NFS A;  1V8T A;  2DSC A;  1RRQ A;  3N77 A;  1X84 A;  4V14 A;  5BS6 A;  4NFX A;  2VNQ A;  3BM4 A;  1XSC A;  1VCD A;  2ICK A;  1MQW A;  1VC8 A;  3O52 A;  3OGA A;  2GT2 A;  2B0V A;  2G74 A;  2W4E A;  5GHO A;  1PUQ A;  2XSQ A;  4C9X A;  1NQZ A;  5FSN A;  4S2W A;  1G9Q A;  2R5W A;  3X0J A;  1Q54 A;  1PUS A;  3EES A;  1R67 A;  3F13 A;  1SU2 A;  1QVJ A;  1V8U A;  2FVV A;  2PQV A;  1HX3 A;  2CL3 A;  1SOI A;  4C9W A;  1OW2 A;  3Q1P A;  3MDI A;  3EF5 A;  3FJY A;  3I7U A;  3U53 A;  1NFZ A;  1RRS A;  3X0L A;  3ZR1 A;  2I8T A;  5BON A;  3QSJ A;  5GHJ A;  5FSM A;  1V8L A;  3J7Y e;  3HYQ A;  5ANW A;  3FCM A;  5C8L A;  5DPK A;  1V8V A;  5DD4 A;  3A6U A;  1K2E A;  1PVF A;  3X0R A;  3WHW A;  4JZT A;  3GZ6 A;  2KDW A;  4ILQ A;  1XSB A;  1VIU A;  1TUM A;  2FKB A;  2DSB A;  3A6S A;  1Q27 A;  3I7V A;  4K6E A;  5GHI A;  5GHM A;  2G73 A;  1SZ3 A;  2O1C A;  3H95 A;  1V8Y A;  3X0K A;  3R03 A;  1V8S A;  2I8U A;  2YVM A;  2VNP A;  2DSD A;  2YVP A;  3Q2S A;  5C7Q A;  1V8R A;  1X83 A;  4JZV A;  5FSL A;  5GHN A;  2A6T A;  1I9A A;  5ANU A;  3SMD A;  4S2X A;  2O5W A;  5ANS A;  1MK1 A;  3FK9 A;  3N9U A;  1VRL A;  3HHJ A;  2Q9P A;  2YVN A;  3I9X A;  3X0S A;  3X0Q A;  1JRK A;  1MUT A;  3AC9 A;  1Q33 A;  3FFU A;  3O69 A;  2FML A;  2YYH A;  3COU A;  3CNG A;  2QJT A;  1VC9 A;  4J7H A;  4KG4 A;  2YVO A;  1KTG A;  1MR2 A;  2A8T A;  2RRK A;  3BHO A;  4IJX A;  1X51 A;  3GG6 A;  5FSI A;  4HVY A;  5HZX A;  4YPH A;  1U20 A;  3G0Q A;  3GRN A;  5IW4 A;  1HZT A;  1G0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...