5FSIA

Mth1 substrate recognition: complex with 8-oxo-dgtp.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
154
structure length
154
Chain Sequence
ASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7,8-DIHYDRO-8-OXOGUANINE TRIPHOSPHATASE
publication title Mth1 Substrate Recognition--an Example of Specific Promiscuity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 39
structure length 154
sequence length 154
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5fsiA00
3G0QA 2B2KA 3BM4A 3J7Ye 2VNPA 1V8WA 2A8SA 4KG3A 5FSLA 4S2XA 2YYHA 3X0KA 2ICJA 3I7UA 3H95A 4C9WA 1VC8A 4NFWA 3GRNA 1PPWA 1PUSA 2FMLA 5FSKA 3L85A 3GZ5A 4MPOA 1JKNA 3KVHA 1XSBA 3X0MA 2FVVA 3QSJA 1V8LA 3HHJA 2ICKA 3FCMA 4V14A 3RH7A 5C8LA 2J8QA 3CNGA 5GHOA 5BS6A 5CFIA 1V8UA 3ID9A 2A8PA 2Q9PA 3MGMA 3Q4IA 1MR2A 1SZ3A 2KDVA 2W4EA 3A6TA 1SJYA 3X0PA 3F13A 3GZ6A 2B0VA 1MK1A 1V8MA 3HYQA 3WHWA 4HFQA 5ANSA 4S2VA 5C7TA 4IJXA 1NQYA 2A8QA 3I7VA 4KG4A 1HZTA 5HZXA 4S2YA 1SU2A 2QJOA 3DKUA 3O52A 5GHMA 4ICKA 1K26A 1PUNA 1G9QA 2DHOA 2FKBA 3R03A 1Q27A 4JZTA 5ISYA 2VNQA 1I9AA 5GHPA 4DYWA 4JZVA 1VCDA 2CL3A 2G74A 2I6KA 2GB5A 5DEQA 1NFSA 5GHNA 1V8VA 3BAPA 3X0JA 3ZR0A 3O69A 1RRQA 1MQEA 5CFJA 2YVMA 4K6EA 5ANUA 3U53A 1V8TA 4YOQA 1IRYA 2G73A 2PNYA 1VIUA 1RRSA 3Q91A 5FSNA 2YVNA 4C9XA 3Q2TA 3O6ZA 2AZWA 1V8NA 1VC9A 3EEUA 3N9UA 3SONA 5DDGA 5GHQA 1K2EA 3X0OA 2XSQA 3FFUA 3FSPA 3X0NA 3Q1PA 1VK6A 3A6SA 3O8SA 2PQVA 4KTBA 1PPVA 5DPKA 2JVBA 1MP2A 1VRLA 2KDWA 3F6AA 1V8YA 1U20A 2I8UA 3Q2SA 4JZUA 4HVYA 2O5FA 1Q33A 2A6TA 1PVFA 3Q93A 2YVPA 5I8UA 1MUTA 4KYXA 5DD4A 5ANTA 2I8TA 5BONA 1VHZA 4YPRA 5FSMA 3X0IA 3P6YA 3A6UA 3P5TA 3FK9A 4ILQA 5ANWA 1OW2A 2B06A 4ZG0A 2RRKA 1NFZA 1R67A 1X51A 1X84A 3EXQA 4S2WA 1PPXA 5FSOA 3X0SA 3O61A 3X0QA 3N77A 1VHGA 3OGAA 3X0LA 5C7QA 1KHZA 5LPGA 2A8RA 1QVJA 1V8SA 3A6VA 3FJYA 3X0RA 1GA7A 1XSAA 5ANVA 2GT4A 2R5WA 1G0SA 5IW5A 1MQWA 3SMDA 2DSBA 4N1TA 5IW4A 2DUKA 3COUA 3GG6A 1F3YA 3DUPA 4JZSA 1PUQA 2O1CA 3ACAA 2GT2A 4N1UA 4YPHA 1Q54A 3ZR1A 3EF5A 3MDIA 3MDGA 1X83A 1XSCA 3BHOA 5GHJA 1TUMA 2YVOA 2A8TA 1HX3A 1JRKA 1V8IA 3SHDA 4NFXA 1SOIA 1RYAA 2DSDA 2QKMB 1VIQA 1NQZA 5FSIA 1KT9A 2O5WA 2QJTA 3E57A 3GWYA 3GZ8A 5GHIA 3I9XA 3AC9A 1KTGA 3EESA 1V8RA 2DSCA 3MCFA
chains in the Genus database with same CATH superfamily
2CZRA 3G0QA 2B2KA 3BM4A 3J7Ye 2VNPA 1V8WA 2A8SA 4KG3A 5FSLA 4S2XA 2YYHA 3X0KA 2ICJA 3I7UA 3H95A 4J7GA 4C9WA 1VC8A 4NFWA 3GRNA 1PPWA 1PUSA 2FMLA 5FSKA 3L85A 3GZ5A 4MPOA 1JKNA 3KVHA 1XSBA 3X0MA 2FVVA 3QSJA 1V8LA 3HHJA 2ICKA 3FCMA 4V14A 3RH7A 5C8LA 2J8QA 3CNGA 5GHOA 5BS6A 5CFIA 1V8UA 3ID9A 2A8PA 2Q9PA 3MGMA 3Q4IA 1MR2A 1SZ3A 2KDVA 2W4EA 3A6TA 1SJYA 3X0PA 3F13A 3GZ6A 2B0VA 1MK1A 1V8MA 3HYQA 3WHWA 4HFQA 5ANSA 4S2VA 5C7TA 4IJXA 1NQYA 2A8QA 3I7VA 4KG4A 1HZTA 5HZXA 4S2YA 1SU2A 2QJOA 3DKUA 3O52A 5GHMA 4ICKA 1K26A 1PUNA 1G9QA 2DHOA 2FKBA 3R03A 1Q27A 4JZTA 5ISYA 2VNQA 1I9AA 5GHPA 4DYWA 4JZVA 1VCDA 2CL3A 2G74A 2I6KA 2GB5A 5DEQA 1NFSA 5GHNA 1V8VA 3BAPA 3X0JA 3ZR0A 3O69A 1RRQA 1MQEA 5CFJA 2YVMA 4K6EA 5ANUA 3U53A 1V8TA 4YOQA 1IRYA 2G73A 2PNYA 1VIUA 1RRSA 3Q91A 5FSNA 2YVNA 4C9XA 3Q2TA 3O6ZA 2AZWA 1V8NA 1VC9A 3EEUA 3N9UA 3SONA 5DDGA 5GHQA 4J7HA 1K2EA 3X0OA 2XSQA 3FFUA 3FSPA 3X0NA 3Q1PA 1VK6A 3A6SA 3O8SA 2PQVA 4KTBA 1PPVA 5DPKA 2JVBA 1MP2A 1VRLA 2KDWA 3F6AA 1V8YA 1U20A 2I8UA 3Q2SA 4JZUA 4HVYA 2O5FA 1Q33A 2A6TA 1PVFA 3Q93A 2YVPA 5I8UA 1MUTA 4KYXA 5DD4A 5ANTA 2I8TA 5BONA 1VHZA 4YPRA 5FSMA 3X0IA 3P6YA 3A6UA 3P5TA 3FK9A 4ILQA 5ANWA 1OW2A 2B06A 4ZG0A 2RRKA 1NFZA 1R67A 1X51A 1X84A 3EXQA 4S2WA 1PPXA 5FSOA 3X0SA 3O61A 3X0QA 3N77A 1VHGA 3OGAA 3X0LA 5C7QA 1KHZA 5LPGA 2A8RA 1QVJA 1V8SA 3A6VA 3FJYA 3X0RA 1GA7A 1XSAA 5ANVA 2GT4A 2R5WA 1G0SA 5IW5A 1MQWA 3SMDA 2DSBA 4N1TA 5IW4A 2DUKA 3COUA 3GG6A 1F3YA 3DUPA 4JZSA 1PUQA 2O1CA 3ACAA 2GT2A 4N1UA 4YPHA 1Q54A 3ZR1A 3EF5A 3MDIA 3MDGA 1X83A 1XSCA 3BHOA 5GHJA 1TUMA 2YVOA 2A8TA 1HX3A 1JRKA 1V8IA 3SHDA 4NFXA 1SOIA 1RYAA 2DSDA 2QKMB 1VIQA 1NQZA 5FSIA 1KT9A 2O5WA 2QJTA 3E57A 3GWYA 3GZ8A 5GHIA 3I9XA 3AC9A 1KTGA 3EESA 1V8RA 2DSCA 3MCFA
chains in the Genus database with same CATH topology
2CZRA 3G0QA 2B2KA 3BM4A 3J7Ye 2VNPA 1V8WA 2A8SA 4KG3A 5FSLA 4S2XA 2YYHA 3X0KA 2ICJA 3I7UA 3H95A 4J7GA 4C9WA 1VC8A 4NFWA 3GRNA 1PPWA 1PUSA 2FMLA 5FSKA 3L85A 3GZ5A 4MPOA 1JKNA 3KVHA 1XSBA 3X0MA 2FVVA 3QSJA 1V8LA 3HHJA 2ICKA 3FCMA 4V14A 3RH7A 5C8LA 2J8QA 3CNGA 5GHOA 5BS6A 5CFIA 1V8UA 3ID9A 2A8PA 2Q9PA 3MGMA 3Q4IA 1MR2A 1SZ3A 2KDVA 2W4EA 3A6TA 1SJYA 3X0PA 3F13A 3GZ6A 2B0VA 1MK1A 1V8MA 3HYQA 3WHWA 4HFQA 5ANSA 4S2VA 5C7TA 4IJXA 1NQYA 2A8QA 3I7VA 4KG4A 1HZTA 5HZXA 4S2YA 1SU2A 2QJOA 3DKUA 3O52A 5GHMA 4ICKA 1K26A 1PUNA 1G9QA 2DHOA 2FKBA 3R03A 1Q27A 4JZTA 5ISYA 2VNQA 1I9AA 5GHPA 4DYWA 4JZVA 1VCDA 2CL3A 2G74A 2I6KA 2GB5A 5DEQA 1NFSA 5GHNA 1V8VA 3BAPA 3X0JA 3ZR0A 3O69A 1RRQA 1MQEA 5CFJA 2YVMA 4K6EA 5ANUA 3U53A 1V8TA 4YOQA 1IRYA 2G73A 2PNYA 1VIUA 1RRSA 3Q91A 5FSNA 2YVNA 4C9XA 3Q2TA 3O6ZA 2AZWA 1V8NA 1VC9A 3EEUA 3N9UA 3SONA 5DDGA 5GHQA 4J7HA 1K2EA 3X0OA 2XSQA 3FFUA 3FSPA 3X0NA 3Q1PA 1VK6A 3A6SA 3O8SA 2PQVA 4KTBA 1PPVA 5DPKA 2JVBA 1MP2A 1VRLA 2KDWA 3F6AA 1V8YA 1U20A 2I8UA 3Q2SA 4JZUA 4HVYA 2O5FA 1Q33A 2A6TA 1PVFA 3Q93A 2YVPA 5I8UA 1MUTA 4KYXA 5DD4A 5ANTA 2I8TA 5BONA 1VHZA 4YPRA 5FSMA 3X0IA 3P6YA 3A6UA 3P5TA 3FK9A 4ILQA 5ANWA 1OW2A 2B06A 4ZG0A 2RRKA 1NFZA 1R67A 1X51A 1X84A 3EXQA 4S2WA 1PPXA 5FSOA 3X0SA 3O61A 3X0QA 3N77A 1VHGA 3OGAA 3X0LA 5C7QA 1KHZA 5LPGA 2A8RA 1QVJA 1V8SA 3A6VA 3FJYA 3X0RA 1GA7A 1XSAA 5ANVA 2GT4A 2R5WA 1G0SA 5IW5A 1MQWA 3SMDA 2DSBA 4N1TA 5IW4A 2DUKA 3COUA 3GG6A 1F3YA 3DUPA 4JZSA 1PUQA 2O1CA 3ACAA 2GT2A 4N1UA 4YPHA 1Q54A 3ZR1A 3EF5A 3MDIA 3MDGA 1X83A 1XSCA 3BHOA 5GHJA 1TUMA 2YVOA 2A8TA 1HX3A 1JRKA 1V8IA 3SHDA 4NFXA 1SOIA 1RYAA 2DSDA 2QKMB 1VIQA 1NQZA 5FSIA 1KT9A 2O5WA 2QJTA 3E57A 3GWYA 3GZ8A 5GHIA 3I9XA 3AC9A 1KTGA 3EESA 1V8RA 2DSCA 3MCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G0Q A;  2B2K A;  3BM4 A;  3J7Y e;  2VNP A;  1V8W A;  2A8S A;  4KG3 A;  5FSL A;  4S2X A;  2YYH A;  3X0K A;  2ICJ A;  3I7U A;  3H95 A;  4C9W A;  1VC8 A;  4NFW A;  3GRN A;  1PPW A;  1PUS A;  2FML A;  5FSK A;  3L85 A;  3GZ5 A;  4MPO A;  1JKN A;  3KVH A;  1XSB A;  3X0M A;  2FVV A;  3QSJ A;  1V8L A;  3HHJ A;  2ICK A;  3FCM A;  4V14 A;  3RH7 A;  5C8L A;  2J8Q A;  3CNG A;  5GHO A;  5BS6 A;  5CFI A;  1V8U A;  3ID9 A;  2A8P A;  2Q9P A;  3MGM A;  3Q4I A;  1MR2 A;  1SZ3 A;  2KDV A;  2W4E A;  3A6T A;  1SJY A;  3X0P A;  3F13 A;  3GZ6 A;  2B0V A;  1MK1 A;  1V8M A;  3HYQ A;  3WHW A;  4HFQ A;  5ANS A;  4S2V A;  5C7T A;  4IJX A;  1NQY A;  2A8Q A;  3I7V A;  4KG4 A;  1HZT A;  5HZX A;  4S2Y A;  1SU2 A;  2QJO A;  3DKU A;  3O52 A;  5GHM A;  4ICK A;  1K26 A;  1PUN A;  1G9Q A;  2DHO A;  2FKB A;  3R03 A;  1Q27 A;  4JZT A;  5ISY A;  2VNQ A;  1I9A A;  5GHP A;  4DYW A;  4JZV A;  1VCD A;  2CL3 A;  2G74 A;  2I6K A;  2GB5 A;  5DEQ A;  1NFS A;  5GHN A;  1V8V A;  3BAP A;  3X0J A;  3ZR0 A;  3O69 A;  1RRQ A;  1MQE A;  5CFJ A;  2YVM A;  4K6E A;  5ANU A;  3U53 A;  1V8T A;  4YOQ A;  1IRY A;  2G73 A;  2PNY A;  1VIU A;  1RRS A;  3Q91 A;  5FSN A;  2YVN A;  4C9X A;  3Q2T A;  3O6Z A;  2AZW A;  1V8N A;  1VC9 A;  3EEU A;  3N9U A;  3SON A;  5DDG A;  5GHQ A;  1K2E A;  3X0O A;  2XSQ A;  3FFU A;  3FSP A;  3X0N A;  3Q1P A;  1VK6 A;  3A6S A;  3O8S A;  2PQV A;  4KTB A;  1PPV A;  5DPK A;  2JVB A;  1MP2 A;  1VRL A;  2KDW A;  3F6A A;  1V8Y A;  1U20 A;  2I8U A;  3Q2S A;  4JZU A;  4HVY A;  2O5F A;  1Q33 A;  2A6T A;  1PVF A;  3Q93 A;  2YVP A;  5I8U A;  1MUT A;  4KYX A;  5DD4 A;  5ANT A;  2I8T A;  5BON A;  1VHZ A;  4YPR A;  5FSM A;  3X0I A;  3P6Y A;  3A6U A;  3P5T A;  3FK9 A;  4ILQ A;  5ANW A;  1OW2 A;  2B06 A;  4ZG0 A;  2RRK A;  1NFZ A;  1R67 A;  1X51 A;  1X84 A;  3EXQ A;  4S2W A;  1PPX A;  5FSO A;  3X0S A;  3O61 A;  3X0Q A;  3N77 A;  1VHG A;  3OGA A;  3X0L A;  5C7Q A;  1KHZ A;  5LPG A;  2A8R A;  1QVJ A;  1V8S A;  3A6V A;  3FJY A;  3X0R A;  1GA7 A;  1XSA A;  5ANV A;  2GT4 A;  2R5W A;  1G0S A;  5IW5 A;  1MQW A;  3SMD A;  2DSB A;  4N1T A;  5IW4 A;  2DUK A;  3COU A;  3GG6 A;  1F3Y A;  3DUP A;  4JZS A;  1PUQ A;  2O1C A;  3ACA A;  2GT2 A;  4N1U A;  4YPH A;  1Q54 A;  3ZR1 A;  3EF5 A;  3MDI A;  3MDG A;  1X83 A;  1XSC A;  3BHO A;  5GHJ A;  1TUM A;  2YVO A;  2A8T A;  1HX3 A;  1JRK A;  1V8I A;  3SHD A;  4NFX A;  1SOI A;  1RYA A;  2DSD A;  2QKM B;  1VIQ A;  1NQZ A;  5FSI A;  1KT9 A;  2O5W A;  2QJT A;  3E57 A;  3GWY A;  3GZ8 A;  5GHI A;  3I9X A;  3AC9 A;  1KTG A;  3EES A;  1V8R A;  2DSC A;  3MCF A; 
#chains in the Genus database with same CATH topology
 2CZR A;  3G0Q A;  2B2K A;  3BM4 A;  3J7Y e;  2VNP A;  1V8W A;  2A8S A;  4KG3 A;  5FSL A;  4S2X A;  2YYH A;  3X0K A;  2ICJ A;  3I7U A;  3H95 A;  4J7G A;  4C9W A;  1VC8 A;  4NFW A;  3GRN A;  1PPW A;  1PUS A;  2FML A;  5FSK A;  3L85 A;  3GZ5 A;  4MPO A;  1JKN A;  3KVH A;  1XSB A;  3X0M A;  2FVV A;  3QSJ A;  1V8L A;  3HHJ A;  2ICK A;  3FCM A;  4V14 A;  3RH7 A;  5C8L A;  2J8Q A;  3CNG A;  5GHO A;  5BS6 A;  5CFI A;  1V8U A;  3ID9 A;  2A8P A;  2Q9P A;  3MGM A;  3Q4I A;  1MR2 A;  1SZ3 A;  2KDV A;  2W4E A;  3A6T A;  1SJY A;  3X0P A;  3F13 A;  3GZ6 A;  2B0V A;  1MK1 A;  1V8M A;  3HYQ A;  3WHW A;  4HFQ A;  5ANS A;  4S2V A;  5C7T A;  4IJX A;  1NQY A;  2A8Q A;  3I7V A;  4KG4 A;  1HZT A;  5HZX A;  4S2Y A;  1SU2 A;  2QJO A;  3DKU A;  3O52 A;  5GHM A;  4ICK A;  1K26 A;  1PUN A;  1G9Q A;  2DHO A;  2FKB A;  3R03 A;  1Q27 A;  4JZT A;  5ISY A;  2VNQ A;  1I9A A;  5GHP A;  4DYW A;  4JZV A;  1VCD A;  2CL3 A;  2G74 A;  2I6K A;  2GB5 A;  5DEQ A;  1NFS A;  5GHN A;  1V8V A;  3BAP A;  3X0J A;  3ZR0 A;  3O69 A;  1RRQ A;  1MQE A;  5CFJ A;  2YVM A;  4K6E A;  5ANU A;  3U53 A;  1V8T A;  4YOQ A;  1IRY A;  2G73 A;  2PNY A;  1VIU A;  1RRS A;  3Q91 A;  5FSN A;  2YVN A;  4C9X A;  3Q2T A;  3O6Z A;  2AZW A;  1V8N A;  1VC9 A;  3EEU A;  3N9U A;  3SON A;  5DDG A;  5GHQ A;  4J7H A;  1K2E A;  3X0O A;  2XSQ A;  3FFU A;  3FSP A;  3X0N A;  3Q1P A;  1VK6 A;  3A6S A;  3O8S A;  2PQV A;  4KTB A;  1PPV A;  5DPK A;  2JVB A;  1MP2 A;  1VRL A;  2KDW A;  3F6A A;  1V8Y A;  1U20 A;  2I8U A;  3Q2S A;  4JZU A;  4HVY A;  2O5F A;  1Q33 A;  2A6T A;  1PVF A;  3Q93 A;  2YVP A;  5I8U A;  1MUT A;  4KYX A;  5DD4 A;  5ANT A;  2I8T A;  5BON A;  1VHZ A;  4YPR A;  5FSM A;  3X0I A;  3P6Y A;  3A6U A;  3P5T A;  3FK9 A;  4ILQ A;  5ANW A;  1OW2 A;  2B06 A;  4ZG0 A;  2RRK A;  1NFZ A;  1R67 A;  1X51 A;  1X84 A;  3EXQ A;  4S2W A;  1PPX A;  5FSO A;  3X0S A;  3O61 A;  3X0Q A;  3N77 A;  1VHG A;  3OGA A;  3X0L A;  5C7Q A;  1KHZ A;  5LPG A;  2A8R A;  1QVJ A;  1V8S A;  3A6V A;  3FJY A;  3X0R A;  1GA7 A;  1XSA A;  5ANV A;  2GT4 A;  2R5W A;  1G0S A;  5IW5 A;  1MQW A;  3SMD A;  2DSB A;  4N1T A;  5IW4 A;  2DUK A;  3COU A;  3GG6 A;  1F3Y A;  3DUP A;  4JZS A;  1PUQ A;  2O1C A;  3ACA A;  2GT2 A;  4N1U A;  4YPH A;  1Q54 A;  3ZR1 A;  3EF5 A;  3MDI A;  3MDG A;  1X83 A;  1XSC A;  3BHO A;  5GHJ A;  1TUM A;  2YVO A;  2A8T A;  1HX3 A;  1JRK A;  1V8I A;  3SHD A;  4NFX A;  1SOI A;  1RYA A;  2DSD A;  2QKM B;  1VIQ A;  1NQZ A;  5FSI A;  1KT9 A;  2O5W A;  2QJT A;  3E57 A;  3GWY A;  3GZ8 A;  5GHI A;  3I9X A;  3AC9 A;  1KTG A;  3EES A;  1V8R A;  2DSC A;  3MCF A; 
#chains in the Genus database with same CATH homology
 2CZR A;  3G0Q A;  2B2K A;  3BM4 A;  3J7Y e;  2VNP A;  1V8W A;  2A8S A;  4KG3 A;  5FSL A;  4S2X A;  2YYH A;  3X0K A;  2ICJ A;  3I7U A;  3H95 A;  4J7G A;  4C9W A;  1VC8 A;  4NFW A;  3GRN A;  1PPW A;  1PUS A;  2FML A;  5FSK A;  3L85 A;  3GZ5 A;  4MPO A;  1JKN A;  3KVH A;  1XSB A;  3X0M A;  2FVV A;  3QSJ A;  1V8L A;  3HHJ A;  2ICK A;  3FCM A;  4V14 A;  3RH7 A;  5C8L A;  2J8Q A;  3CNG A;  5GHO A;  5BS6 A;  5CFI A;  1V8U A;  3ID9 A;  2A8P A;  2Q9P A;  3MGM A;  3Q4I A;  1MR2 A;  1SZ3 A;  2KDV A;  2W4E A;  3A6T A;  1SJY A;  3X0P A;  3F13 A;  3GZ6 A;  2B0V A;  1MK1 A;  1V8M A;  3HYQ A;  3WHW A;  4HFQ A;  5ANS A;  4S2V A;  5C7T A;  4IJX A;  1NQY A;  2A8Q A;  3I7V A;  4KG4 A;  1HZT A;  5HZX A;  4S2Y A;  1SU2 A;  2QJO A;  3DKU A;  3O52 A;  5GHM A;  4ICK A;  1K26 A;  1PUN A;  1G9Q A;  2DHO A;  2FKB A;  3R03 A;  1Q27 A;  4JZT A;  5ISY A;  2VNQ A;  1I9A A;  5GHP A;  4DYW A;  4JZV A;  1VCD A;  2CL3 A;  2G74 A;  2I6K A;  2GB5 A;  5DEQ A;  1NFS A;  5GHN A;  1V8V A;  3BAP A;  3X0J A;  3ZR0 A;  3O69 A;  1RRQ A;  1MQE A;  5CFJ A;  2YVM A;  4K6E A;  5ANU A;  3U53 A;  1V8T A;  4YOQ A;  1IRY A;  2G73 A;  2PNY A;  1VIU A;  1RRS A;  3Q91 A;  5FSN A;  2YVN A;  4C9X A;  3Q2T A;  3O6Z A;  2AZW A;  1V8N A;  1VC9 A;  3EEU A;  3N9U A;  3SON A;  5DDG A;  5GHQ A;  4J7H A;  1K2E A;  3X0O A;  2XSQ A;  3FFU A;  3FSP A;  3X0N A;  3Q1P A;  1VK6 A;  3A6S A;  3O8S A;  2PQV A;  4KTB A;  1PPV A;  5DPK A;  2JVB A;  1MP2 A;  1VRL A;  2KDW A;  3F6A A;  1V8Y A;  1U20 A;  2I8U A;  3Q2S A;  4JZU A;  4HVY A;  2O5F A;  1Q33 A;  2A6T A;  1PVF A;  3Q93 A;  2YVP A;  5I8U A;  1MUT A;  4KYX A;  5DD4 A;  5ANT A;  2I8T A;  5BON A;  1VHZ A;  4YPR A;  5FSM A;  3X0I A;  3P6Y A;  3A6U A;  3P5T A;  3FK9 A;  4ILQ A;  5ANW A;  1OW2 A;  2B06 A;  4ZG0 A;  2RRK A;  1NFZ A;  1R67 A;  1X51 A;  1X84 A;  3EXQ A;  4S2W A;  1PPX A;  5FSO A;  3X0S A;  3O61 A;  3X0Q A;  3N77 A;  1VHG A;  3OGA A;  3X0L A;  5C7Q A;  1KHZ A;  5LPG A;  2A8R A;  1QVJ A;  1V8S A;  3A6V A;  3FJY A;  3X0R A;  1GA7 A;  1XSA A;  5ANV A;  2GT4 A;  2R5W A;  1G0S A;  5IW5 A;  1MQW A;  3SMD A;  2DSB A;  4N1T A;  5IW4 A;  2DUK A;  3COU A;  3GG6 A;  1F3Y A;  3DUP A;  4JZS A;  1PUQ A;  2O1C A;  3ACA A;  2GT2 A;  4N1U A;  4YPH A;  1Q54 A;  3ZR1 A;  3EF5 A;  3MDI A;  3MDG A;  1X83 A;  1XSC A;  3BHO A;  5GHJ A;  1TUM A;  2YVO A;  2A8T A;  1HX3 A;  1JRK A;  1V8I A;  3SHD A;  4NFX A;  1SOI A;  1RYA A;  2DSD A;  2QKM B;  1VIQ A;  1NQZ A;  5FSI A;  1KT9 A;  2O5W A;  2QJT A;  3E57 A;  3GWY A;  3GZ8 A;  5GHI A;  3I9X A;  3AC9 A;  1KTG A;  3EES A;  1V8R A;  2DSC A;  3MCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...