2ICJA

The crystal structure of human isopentenyl diphophate isomerase
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
219
structure length
219
Chain Sequence
LDKQQVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLFNTENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isopentenyl-diphosphate delta isomerase
publication title The crystal structure of human isopentenyl diphosphate isomerase at 1.7 A resolution reveals its catalytic mechanism in isoprenoid biosynthesis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 86
structure length 219
sequence length 219
ec nomenclature ec 5.3.3.2: Isopentenyl-diphosphate Delta-isomerase.
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2icjA00
3MCFA 3H95A 1V8UA 2O1CA 3COUA 1TUMA 3WHWA 2YVPA 3E57A 3EEUA 3FFUA 1V8TA 5ANVA 3ACAA 5DPKA 5BS6A 3Q2TA 1VK6A 1V8NA 2DSDA 5CFIA 1RRQA 4KG4A 5DD4A 2B0VA 3DKUA 5BONA 3GZ5A 1VCDA 2W4EA 2YVOA 3A6SA 4JZSA 5ANUA 1I9AA 1G0SA 1NFSA 4HVYA 3Q93A 2PNYA 4ICKA 4V14A 2G74A 4NFXA 1NQZA 1XSAA 2GT2A 2I8UA 1PVFA 3EESA 1VHGA 5GHJA 3SHDA 1VHZA 1NQYA 5FSNA 5GHQA 5C7QA 1MP2A 3BAPA 2YVMA 5DDGA 2A8TA 2O5FA 5ANTA 3GZ6A 3A6TA 1RRSA 5FSOA 1KTGA 4YOQA 1V8MA 1OW2A 1PUSA 3HHJA 4KG3A 2YYHA 2FMLA 1SZ3A 1X84A 3CNGA 3I7UA 1IRYA 1SU2A 3I7VA 3ZR1A 1JRKA 1PPVA 2KDVA 4NFWA 3FCMA 2A8QA 2I6KA 3F13A 1RYAA 1K26A 1GA7A 5GHOA 3AC9A 5GHNA 5GHMA 3ID9A 3X0OA 2A8SA 3Q1PA 4ILQA 5ISYA 2VNPA 3SONA 1Q54A 2QJOA 3SMDA 4MPOA 2FVVA 2J8QA 3A6VA 3X0MA 2QJTA 2A8RA 2B2KA 2G73A 2I8TA 3L85A 1PUNA 1R67A 1HZTA 3MGMA 3MDIA 1U20A 5DEQA 1F3YA 2DHOA 3O6ZA 2QKMB 4JZVA 1SJYA 3GZ8A 4YPRA 3QSJA 3N9UA 5CFJA 1X51A 1VIUA 1PUQA 3X0QA 3Q91A 2O5WA 3P6YA 3KVHA 2DSBA 3DUPA 5IW4A 1X83A 1VIQA 4YPHA 2Q9PA 3GWYA 3ZR0A 3X0NA 4S2VA 5C8LA 4JZUA 3EF5A 5HZXA 1V8LA 4DYWA 2A8PA 3X0PA 1V8WA 5IW5A 5FSKA 3O61A 1JKNA 5GHIA 3BHOA 1V8IA 1Q27A 3N77A 1VRLA 4KTBA 1V8SA 3FJYA 3MDGA 1G9QA 2DSCA 1KHZA 2VNQA 3R03A 4JZTA 1SOIA 1PPXA 2B06A 1HX3A 1K2EA 2PQVA 3FK9A 3O8SA 3GRNA 3X0SA 1MR2A 4S2XA 1MQEA 5FSIA 1XSCA 2ICKA 4N1UA 4C9WA 2DUKA 3Q2SA 1NFZA 2JVBA 2ICJA 2XSQA 1V8VA 4KYXA 5ANSA 3G0QA 3OGAA 4HFQA 1VC8A 2A6TA 2YVNA 2GT4A 3Q4IA 1MQWA 3O52A 3J7Ye 3EXQA 1V8YA 4S2WA 3X0RA 5ANWA 3X0JA 3RH7A 2KDWA 1KT9A 2RRKA 3F6AA 4K6EA 5FSLA 5LPGA 1Q33A 1VC9A 2AZWA 3GG6A 2FKBA 3BM4A 3FSPA 1V8RA 3P5TA 1XSBA 3U53A 3X0KA 3HYQA 3X0IA 3I9XA 5FSMA 1QVJA 2GB5A 4C9XA 3A6UA 3O69A 4S2YA 5GHPA 3X0LA 2CL3A 5I8UA 4ZG0A 2R5WA 4IJXA 1PPWA 4N1TA 1MK1A 5C7TA 1MUTA
chains in the Genus database with same CATH superfamily
3MCFA 3H95A 1V8UA 2O1CA 3COUA 1TUMA 3WHWA 2YVPA 3E57A 3EEUA 3FFUA 1V8TA 5ANVA 3ACAA 5DPKA 5BS6A 3Q2TA 1VK6A 1V8NA 2DSDA 5CFIA 1RRQA 4KG4A 5DD4A 2B0VA 3DKUA 5BONA 3GZ5A 1VCDA 2W4EA 2YVOA 3A6SA 4JZSA 5ANUA 1I9AA 1G0SA 1NFSA 4HVYA 3Q93A 2PNYA 4ICKA 4V14A 2G74A 4NFXA 1NQZA 1XSAA 2GT2A 2I8UA 4J7HA 1PVFA 3EESA 1VHGA 5GHJA 3SHDA 1VHZA 1NQYA 5FSNA 5GHQA 5C7QA 1MP2A 3BAPA 2YVMA 5DDGA 2A8TA 2O5FA 5ANTA 3GZ6A 3A6TA 1RRSA 5FSOA 1KTGA 4YOQA 1V8MA 1OW2A 1PUSA 3HHJA 4KG3A 2YYHA 2FMLA 1SZ3A 1X84A 3CNGA 3I7UA 1IRYA 1SU2A 3I7VA 3ZR1A 1JRKA 1PPVA 2KDVA 4NFWA 3FCMA 2A8QA 2I6KA 3F13A 1RYAA 1K26A 1GA7A 5GHOA 3AC9A 5GHNA 5GHMA 3ID9A 3X0OA 2A8SA 3Q1PA 4ILQA 5ISYA 2VNPA 3SONA 1Q54A 2QJOA 3SMDA 2CZRA 4MPOA 2FVVA 2J8QA 3A6VA 3X0MA 2QJTA 2A8RA 2B2KA 2G73A 2I8TA 3L85A 4J7GA 1PUNA 1R67A 1HZTA 3MGMA 3MDIA 1U20A 5DEQA 1F3YA 2DHOA 3O6ZA 2QKMB 4JZVA 1SJYA 3GZ8A 4YPRA 3QSJA 3N9UA 5CFJA 1X51A 1VIUA 1PUQA 3X0QA 3Q91A 2O5WA 3P6YA 3KVHA 2DSBA 3DUPA 5IW4A 1X83A 1VIQA 4YPHA 2Q9PA 3GWYA 3ZR0A 3X0NA 4S2VA 5C8LA 4JZUA 3EF5A 5HZXA 1V8LA 4DYWA 2A8PA 3X0PA 1V8WA 5IW5A 5FSKA 3O61A 1JKNA 5GHIA 3BHOA 1V8IA 1Q27A 3N77A 1VRLA 4KTBA 1V8SA 3FJYA 3MDGA 1G9QA 2DSCA 1KHZA 2VNQA 3R03A 4JZTA 1SOIA 1PPXA 2B06A 1HX3A 1K2EA 2PQVA 3FK9A 3O8SA 3GRNA 3X0SA 1MR2A 4S2XA 1MQEA 5FSIA 1XSCA 2ICKA 4N1UA 4C9WA 2DUKA 3Q2SA 1NFZA 2JVBA 2ICJA 2XSQA 1V8VA 4KYXA 5ANSA 3G0QA 3OGAA 4HFQA 1VC8A 2A6TA 2YVNA 2GT4A 3Q4IA 1MQWA 3O52A 3J7Ye 3EXQA 1V8YA 4S2WA 3X0RA 5ANWA 3X0JA 3RH7A 2KDWA 1KT9A 2RRKA 3F6AA 4K6EA 5FSLA 5LPGA 1Q33A 1VC9A 2AZWA 3GG6A 2FKBA 3BM4A 3FSPA 1V8RA 3P5TA 1XSBA 3U53A 3X0KA 3HYQA 3X0IA 3I9XA 5FSMA 1QVJA 2GB5A 4C9XA 3A6UA 3O69A 4S2YA 5GHPA 3X0LA 2CL3A 5I8UA 4ZG0A 2R5WA 4IJXA 1PPWA 4N1TA 1MK1A 5C7TA 1MUTA
chains in the Genus database with same CATH topology
3MCFA 3H95A 1V8UA 2O1CA 3COUA 1TUMA 3WHWA 2YVPA 3E57A 3EEUA 3FFUA 1V8TA 5ANVA 3ACAA 5DPKA 5BS6A 3Q2TA 1VK6A 1V8NA 2DSDA 5CFIA 1RRQA 4KG4A 5DD4A 2B0VA 3DKUA 5BONA 3GZ5A 1VCDA 2W4EA 2YVOA 3A6SA 4JZSA 5ANUA 1I9AA 1G0SA 1NFSA 4HVYA 3Q93A 2PNYA 4ICKA 4V14A 2G74A 4NFXA 1NQZA 1XSAA 2GT2A 2I8UA 4J7HA 1PVFA 3EESA 1VHGA 5GHJA 3SHDA 1VHZA 1NQYA 5FSNA 5GHQA 5C7QA 1MP2A 3BAPA 2YVMA 5DDGA 2A8TA 2O5FA 5ANTA 3GZ6A 3A6TA 1RRSA 5FSOA 1KTGA 4YOQA 1V8MA 1OW2A 1PUSA 3HHJA 4KG3A 2YYHA 2FMLA 1SZ3A 1X84A 3CNGA 3I7UA 1IRYA 1SU2A 3I7VA 3ZR1A 1JRKA 1PPVA 2KDVA 4NFWA 3FCMA 2A8QA 2I6KA 3F13A 1RYAA 1K26A 1GA7A 5GHOA 3AC9A 5GHNA 5GHMA 3ID9A 3X0OA 2A8SA 3Q1PA 4ILQA 5ISYA 2VNPA 3SONA 1Q54A 2QJOA 3SMDA 2CZRA 4MPOA 2FVVA 2J8QA 3A6VA 3X0MA 2QJTA 2A8RA 2B2KA 2G73A 2I8TA 3L85A 4J7GA 1PUNA 1R67A 1HZTA 3MGMA 3MDIA 1U20A 5DEQA 1F3YA 2DHOA 3O6ZA 2QKMB 4JZVA 1SJYA 3GZ8A 4YPRA 3QSJA 3N9UA 5CFJA 1X51A 1VIUA 1PUQA 3X0QA 3Q91A 2O5WA 3P6YA 3KVHA 2DSBA 3DUPA 5IW4A 1X83A 1VIQA 4YPHA 2Q9PA 3GWYA 3ZR0A 3X0NA 4S2VA 5C8LA 4JZUA 3EF5A 5HZXA 1V8LA 4DYWA 2A8PA 3X0PA 1V8WA 5IW5A 5FSKA 3O61A 1JKNA 5GHIA 3BHOA 1V8IA 1Q27A 3N77A 1VRLA 4KTBA 1V8SA 3FJYA 3MDGA 1G9QA 2DSCA 1KHZA 2VNQA 3R03A 4JZTA 1SOIA 1PPXA 2B06A 1HX3A 1K2EA 2PQVA 3FK9A 3O8SA 3GRNA 3X0SA 1MR2A 4S2XA 1MQEA 5FSIA 1XSCA 2ICKA 4N1UA 4C9WA 2DUKA 3Q2SA 1NFZA 2JVBA 2ICJA 2XSQA 1V8VA 4KYXA 5ANSA 3G0QA 3OGAA 4HFQA 1VC8A 2A6TA 2YVNA 2GT4A 3Q4IA 1MQWA 3O52A 3J7Ye 3EXQA 1V8YA 4S2WA 3X0RA 5ANWA 3X0JA 3RH7A 2KDWA 1KT9A 2RRKA 3F6AA 4K6EA 5FSLA 5LPGA 1Q33A 1VC9A 2AZWA 3GG6A 2FKBA 3BM4A 3FSPA 1V8RA 3P5TA 1XSBA 3U53A 3X0KA 3HYQA 3X0IA 3I9XA 5FSMA 1QVJA 2GB5A 4C9XA 3A6UA 3O69A 4S2YA 5GHPA 3X0LA 2CL3A 5I8UA 4ZG0A 2R5WA 4IJXA 1PPWA 4N1TA 1MK1A 5C7TA 1MUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MCF A;  3H95 A;  1V8U A;  2O1C A;  3COU A;  1TUM A;  3WHW A;  2YVP A;  3E57 A;  3EEU A;  3FFU A;  1V8T A;  5ANV A;  3ACA A;  5DPK A;  5BS6 A;  3Q2T A;  1VK6 A;  1V8N A;  2DSD A;  5CFI A;  1RRQ A;  4KG4 A;  5DD4 A;  2B0V A;  3DKU A;  5BON A;  3GZ5 A;  1VCD A;  2W4E A;  2YVO A;  3A6S A;  4JZS A;  5ANU A;  1I9A A;  1G0S A;  1NFS A;  4HVY A;  3Q93 A;  2PNY A;  4ICK A;  4V14 A;  2G74 A;  4NFX A;  1NQZ A;  1XSA A;  2GT2 A;  2I8U A;  1PVF A;  3EES A;  1VHG A;  5GHJ A;  3SHD A;  1VHZ A;  1NQY A;  5FSN A;  5GHQ A;  5C7Q A;  1MP2 A;  3BAP A;  2YVM A;  5DDG A;  2A8T A;  2O5F A;  5ANT A;  3GZ6 A;  3A6T A;  1RRS A;  5FSO A;  1KTG A;  4YOQ A;  1V8M A;  1OW2 A;  1PUS A;  3HHJ A;  4KG3 A;  2YYH A;  2FML A;  1SZ3 A;  1X84 A;  3CNG A;  3I7U A;  1IRY A;  1SU2 A;  3I7V A;  3ZR1 A;  1JRK A;  1PPV A;  2KDV A;  4NFW A;  3FCM A;  2A8Q A;  2I6K A;  3F13 A;  1RYA A;  1K26 A;  1GA7 A;  5GHO A;  3AC9 A;  5GHN A;  5GHM A;  3ID9 A;  3X0O A;  2A8S A;  3Q1P A;  4ILQ A;  5ISY A;  2VNP A;  3SON A;  1Q54 A;  2QJO A;  3SMD A;  4MPO A;  2FVV A;  2J8Q A;  3A6V A;  3X0M A;  2QJT A;  2A8R A;  2B2K A;  2G73 A;  2I8T A;  3L85 A;  1PUN A;  1R67 A;  1HZT A;  3MGM A;  3MDI A;  1U20 A;  5DEQ A;  1F3Y A;  2DHO A;  3O6Z A;  2QKM B;  4JZV A;  1SJY A;  3GZ8 A;  4YPR A;  3QSJ A;  3N9U A;  5CFJ A;  1X51 A;  1VIU A;  1PUQ A;  3X0Q A;  3Q91 A;  2O5W A;  3P6Y A;  3KVH A;  2DSB A;  3DUP A;  5IW4 A;  1X83 A;  1VIQ A;  4YPH A;  2Q9P A;  3GWY A;  3ZR0 A;  3X0N A;  4S2V A;  5C8L A;  4JZU A;  3EF5 A;  5HZX A;  1V8L A;  4DYW A;  2A8P A;  3X0P A;  1V8W A;  5IW5 A;  5FSK A;  3O61 A;  1JKN A;  5GHI A;  3BHO A;  1V8I A;  1Q27 A;  3N77 A;  1VRL A;  4KTB A;  1V8S A;  3FJY A;  3MDG A;  1G9Q A;  2DSC A;  1KHZ A;  2VNQ A;  3R03 A;  4JZT A;  1SOI A;  1PPX A;  2B06 A;  1HX3 A;  1K2E A;  2PQV A;  3FK9 A;  3O8S A;  3GRN A;  3X0S A;  1MR2 A;  4S2X A;  1MQE A;  5FSI A;  1XSC A;  2ICK A;  4N1U A;  4C9W A;  2DUK A;  3Q2S A;  1NFZ A;  2JVB A;  2ICJ A;  2XSQ A;  1V8V A;  4KYX A;  5ANS A;  3G0Q A;  3OGA A;  4HFQ A;  1VC8 A;  2A6T A;  2YVN A;  2GT4 A;  3Q4I A;  1MQW A;  3O52 A;  3J7Y e;  3EXQ A;  1V8Y A;  4S2W A;  3X0R A;  5ANW A;  3X0J A;  3RH7 A;  2KDW A;  1KT9 A;  2RRK A;  3F6A A;  4K6E A;  5FSL A;  5LPG A;  1Q33 A;  1VC9 A;  2AZW A;  3GG6 A;  2FKB A;  3BM4 A;  3FSP A;  1V8R A;  3P5T A;  1XSB A;  3U53 A;  3X0K A;  3HYQ A;  3X0I A;  3I9X A;  5FSM A;  1QVJ A;  2GB5 A;  4C9X A;  3A6U A;  3O69 A;  4S2Y A;  5GHP A;  3X0L A;  2CL3 A;  5I8U A;  4ZG0 A;  2R5W A;  4IJX A;  1PPW A;  4N1T A;  1MK1 A;  5C7T A;  1MUT A; 
#chains in the Genus database with same CATH topology
 3MCF A;  3H95 A;  1V8U A;  2O1C A;  3COU A;  1TUM A;  3WHW A;  2YVP A;  3E57 A;  3EEU A;  3FFU A;  1V8T A;  5ANV A;  3ACA A;  5DPK A;  5BS6 A;  3Q2T A;  1VK6 A;  1V8N A;  2DSD A;  5CFI A;  1RRQ A;  4KG4 A;  5DD4 A;  2B0V A;  3DKU A;  5BON A;  3GZ5 A;  1VCD A;  2W4E A;  2YVO A;  3A6S A;  4JZS A;  5ANU A;  1I9A A;  1G0S A;  1NFS A;  4HVY A;  3Q93 A;  2PNY A;  4ICK A;  4V14 A;  2G74 A;  4NFX A;  1NQZ A;  1XSA A;  2GT2 A;  2I8U A;  4J7H A;  1PVF A;  3EES A;  1VHG A;  5GHJ A;  3SHD A;  1VHZ A;  1NQY A;  5FSN A;  5GHQ A;  5C7Q A;  1MP2 A;  3BAP A;  2YVM A;  5DDG A;  2A8T A;  2O5F A;  5ANT A;  3GZ6 A;  3A6T A;  1RRS A;  5FSO A;  1KTG A;  4YOQ A;  1V8M A;  1OW2 A;  1PUS A;  3HHJ A;  4KG3 A;  2YYH A;  2FML A;  1SZ3 A;  1X84 A;  3CNG A;  3I7U A;  1IRY A;  1SU2 A;  3I7V A;  3ZR1 A;  1JRK A;  1PPV A;  2KDV A;  4NFW A;  3FCM A;  2A8Q A;  2I6K A;  3F13 A;  1RYA A;  1K26 A;  1GA7 A;  5GHO A;  3AC9 A;  5GHN A;  5GHM A;  3ID9 A;  3X0O A;  2A8S A;  3Q1P A;  4ILQ A;  5ISY A;  2VNP A;  3SON A;  1Q54 A;  2QJO A;  3SMD A;  2CZR A;  4MPO A;  2FVV A;  2J8Q A;  3A6V A;  3X0M A;  2QJT A;  2A8R A;  2B2K A;  2G73 A;  2I8T A;  3L85 A;  4J7G A;  1PUN A;  1R67 A;  1HZT A;  3MGM A;  3MDI A;  1U20 A;  5DEQ A;  1F3Y A;  2DHO A;  3O6Z A;  2QKM B;  4JZV A;  1SJY A;  3GZ8 A;  4YPR A;  3QSJ A;  3N9U A;  5CFJ A;  1X51 A;  1VIU A;  1PUQ A;  3X0Q A;  3Q91 A;  2O5W A;  3P6Y A;  3KVH A;  2DSB A;  3DUP A;  5IW4 A;  1X83 A;  1VIQ A;  4YPH A;  2Q9P A;  3GWY A;  3ZR0 A;  3X0N A;  4S2V A;  5C8L A;  4JZU A;  3EF5 A;  5HZX A;  1V8L A;  4DYW A;  2A8P A;  3X0P A;  1V8W A;  5IW5 A;  5FSK A;  3O61 A;  1JKN A;  5GHI A;  3BHO A;  1V8I A;  1Q27 A;  3N77 A;  1VRL A;  4KTB A;  1V8S A;  3FJY A;  3MDG A;  1G9Q A;  2DSC A;  1KHZ A;  2VNQ A;  3R03 A;  4JZT A;  1SOI A;  1PPX A;  2B06 A;  1HX3 A;  1K2E A;  2PQV A;  3FK9 A;  3O8S A;  3GRN A;  3X0S A;  1MR2 A;  4S2X A;  1MQE A;  5FSI A;  1XSC A;  2ICK A;  4N1U A;  4C9W A;  2DUK A;  3Q2S A;  1NFZ A;  2JVB A;  2ICJ A;  2XSQ A;  1V8V A;  4KYX A;  5ANS A;  3G0Q A;  3OGA A;  4HFQ A;  1VC8 A;  2A6T A;  2YVN A;  2GT4 A;  3Q4I A;  1MQW A;  3O52 A;  3J7Y e;  3EXQ A;  1V8Y A;  4S2W A;  3X0R A;  5ANW A;  3X0J A;  3RH7 A;  2KDW A;  1KT9 A;  2RRK A;  3F6A A;  4K6E A;  5FSL A;  5LPG A;  1Q33 A;  1VC9 A;  2AZW A;  3GG6 A;  2FKB A;  3BM4 A;  3FSP A;  1V8R A;  3P5T A;  1XSB A;  3U53 A;  3X0K A;  3HYQ A;  3X0I A;  3I9X A;  5FSM A;  1QVJ A;  2GB5 A;  4C9X A;  3A6U A;  3O69 A;  4S2Y A;  5GHP A;  3X0L A;  2CL3 A;  5I8U A;  4ZG0 A;  2R5W A;  4IJX A;  1PPW A;  4N1T A;  1MK1 A;  5C7T A;  1MUT A; 
#chains in the Genus database with same CATH homology
 3MCF A;  3H95 A;  1V8U A;  2O1C A;  3COU A;  1TUM A;  3WHW A;  2YVP A;  3E57 A;  3EEU A;  3FFU A;  1V8T A;  5ANV A;  3ACA A;  5DPK A;  5BS6 A;  3Q2T A;  1VK6 A;  1V8N A;  2DSD A;  5CFI A;  1RRQ A;  4KG4 A;  5DD4 A;  2B0V A;  3DKU A;  5BON A;  3GZ5 A;  1VCD A;  2W4E A;  2YVO A;  3A6S A;  4JZS A;  5ANU A;  1I9A A;  1G0S A;  1NFS A;  4HVY A;  3Q93 A;  2PNY A;  4ICK A;  4V14 A;  2G74 A;  4NFX A;  1NQZ A;  1XSA A;  2GT2 A;  2I8U A;  4J7H A;  1PVF A;  3EES A;  1VHG A;  5GHJ A;  3SHD A;  1VHZ A;  1NQY A;  5FSN A;  5GHQ A;  5C7Q A;  1MP2 A;  3BAP A;  2YVM A;  5DDG A;  2A8T A;  2O5F A;  5ANT A;  3GZ6 A;  3A6T A;  1RRS A;  5FSO A;  1KTG A;  4YOQ A;  1V8M A;  1OW2 A;  1PUS A;  3HHJ A;  4KG3 A;  2YYH A;  2FML A;  1SZ3 A;  1X84 A;  3CNG A;  3I7U A;  1IRY A;  1SU2 A;  3I7V A;  3ZR1 A;  1JRK A;  1PPV A;  2KDV A;  4NFW A;  3FCM A;  2A8Q A;  2I6K A;  3F13 A;  1RYA A;  1K26 A;  1GA7 A;  5GHO A;  3AC9 A;  5GHN A;  5GHM A;  3ID9 A;  3X0O A;  2A8S A;  3Q1P A;  4ILQ A;  5ISY A;  2VNP A;  3SON A;  1Q54 A;  2QJO A;  3SMD A;  2CZR A;  4MPO A;  2FVV A;  2J8Q A;  3A6V A;  3X0M A;  2QJT A;  2A8R A;  2B2K A;  2G73 A;  2I8T A;  3L85 A;  4J7G A;  1PUN A;  1R67 A;  1HZT A;  3MGM A;  3MDI A;  1U20 A;  5DEQ A;  1F3Y A;  2DHO A;  3O6Z A;  2QKM B;  4JZV A;  1SJY A;  3GZ8 A;  4YPR A;  3QSJ A;  3N9U A;  5CFJ A;  1X51 A;  1VIU A;  1PUQ A;  3X0Q A;  3Q91 A;  2O5W A;  3P6Y A;  3KVH A;  2DSB A;  3DUP A;  5IW4 A;  1X83 A;  1VIQ A;  4YPH A;  2Q9P A;  3GWY A;  3ZR0 A;  3X0N A;  4S2V A;  5C8L A;  4JZU A;  3EF5 A;  5HZX A;  1V8L A;  4DYW A;  2A8P A;  3X0P A;  1V8W A;  5IW5 A;  5FSK A;  3O61 A;  1JKN A;  5GHI A;  3BHO A;  1V8I A;  1Q27 A;  3N77 A;  1VRL A;  4KTB A;  1V8S A;  3FJY A;  3MDG A;  1G9Q A;  2DSC A;  1KHZ A;  2VNQ A;  3R03 A;  4JZT A;  1SOI A;  1PPX A;  2B06 A;  1HX3 A;  1K2E A;  2PQV A;  3FK9 A;  3O8S A;  3GRN A;  3X0S A;  1MR2 A;  4S2X A;  1MQE A;  5FSI A;  1XSC A;  2ICK A;  4N1U A;  4C9W A;  2DUK A;  3Q2S A;  1NFZ A;  2JVB A;  2ICJ A;  2XSQ A;  1V8V A;  4KYX A;  5ANS A;  3G0Q A;  3OGA A;  4HFQ A;  1VC8 A;  2A6T A;  2YVN A;  2GT4 A;  3Q4I A;  1MQW A;  3O52 A;  3J7Y e;  3EXQ A;  1V8Y A;  4S2W A;  3X0R A;  5ANW A;  3X0J A;  3RH7 A;  2KDW A;  1KT9 A;  2RRK A;  3F6A A;  4K6E A;  5FSL A;  5LPG A;  1Q33 A;  1VC9 A;  2AZW A;  3GG6 A;  2FKB A;  3BM4 A;  3FSP A;  1V8R A;  3P5T A;  1XSB A;  3U53 A;  3X0K A;  3HYQ A;  3X0I A;  3I9X A;  5FSM A;  1QVJ A;  2GB5 A;  4C9X A;  3A6U A;  3O69 A;  4S2Y A;  5GHP A;  3X0L A;  2CL3 A;  5I8U A;  4ZG0 A;  2R5W A;  4IJX A;  1PPW A;  4N1T A;  1MK1 A;  5C7T A;  1MUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...