2ICJA

The crystal structure of human isopentenyl diphophate isomerase
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
219
structure length
219
Chain Sequence
LDKQQVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLFNTENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Isopentenyl-diphosphate delta isomerase
publication title The crystal structure of human isopentenyl diphosphate isomerase at 1.7 A resolution reveals its catalytic mechanism in isoprenoid biosynthesis
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 219
sequence length 219
ec nomenclature ec 5.3.3.2: Isopentenyl-diphosphate Delta-isomerase.
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2icjA00
1MP2A 2DSCA 2YVNA 5ANTA 2GB5A 5DPKA 3F6AA 1SU2A 3F13A 3O8SA 2QJTA 3ZR1A 4C9WA 1V8VA 3FSPA 2RRKA 3A6UA 3DKUA 1MUTA 4KG3A 3SHDA 3A6TA 3ACAA 1VIUA 3DUPA 3HYQA 3E57A 3Q91A 4JZTA 4NFWA 5ANUA 1X84A 4KYXA 5ISYA 3MDIA 5DD4A 4ICKA 1XSAA 5FSLA 1VRLA 2I6KA 1MQWA 3CNGA 1VCDA 2Q9PA 3EESA 4N1TA 3FFUA 5FSNA 1V8MA 3J7Ye 2B0VA 5HZXA 2GT2A 4ILQA 5ANSA 2I8UA 5GHPA 3GWYA 2FKBA 3BM4A 3X0PA 3AC9A 1V8YA 1F3YA 3O6ZA 4S2XA 3GZ5A 4N1UA 5GHNA 3X0RA 4YPRA 1RYAA 3MCFA 1JKNA 5BONA 1XSCA 3EF5A 3BHOA 3I9XA 3Q1PA 1PVFA 2DHOA 4YPHA 2YVMA 1HZTA 4S2VA 3O69A 3X0MA 2YVPA 5DDGA 2KDWA 3MDGA 5GHMA 2FMLA 1SOIA 3WHWA 3RH7A 3X0OA 2FVVA 1SZ3A 2A8QA 3P5TA 5IW4A 1I9AA 5ANWA 3O61A 5GHQA 2J8QA 2A8TA 1HX3A 1NFZA 1SJYA 2O5FA 2R5WA 3X0LA 5CFJA 1PPVA 1VHGA 1U20A 3A6SA 1VHZA 4V14A 2CL3A 2XSQA 4JZUA 1KHZA 1KTGA 3I7UA 2GT4A 3GZ6A 3FCMA 1V8RA 1VIQA 5GHOA 2JVBA 1V8SA 3GG6A 1VC9A 3N9UA 3N77A 2W4EA 3O52A 4KTBA 2DSDA 4S2WA 5ANVA 3X0KA 3R03A 1Q33A 2A6TA 1K2EA 1PUQA 1V8IA 2YYHA 3FJYA 3Q4IA 4NFXA 1RRSA 1NQZA 1NFSA 1R67A 3HHJA 3BAPA 5FSMA 5LPGA 1V8UA 1MQEA 2VNQA 3G0QA 1MR2A 2A8PA 5GHJA 4JZSA 4DYWA 3FK9A 5FSOA 4HVYA 4S2YA 5C7QA 3SMDA 2DSBA 3ZR0A 5FSIA 1V8LA 3MGMA 1X51A 3GZ8A 1PPXA 2PNYA 4C9XA 1X83A 3GRNA 3KVHA 3OGAA 4KG4A 3X0QA 4JZVA 2DUKA 1VK6A 4IJXA 5I8UA 5C7TA 3QSJA 2YVOA 1IRYA 3L85A 1MK1A 1PPWA 1XSBA 3Q2SA 5FSKA 5GHIA 5BS6A 3COUA 2ICKA 1QVJA 3U53A 3SONA 2G73A 2O5WA 2A8SA 2QKMB 1VC8A 1KT9A 4MPOA 2KDVA 2B2KA 2QJOA 3Q2TA 3H95A 1GA7A 1Q54A 4HFQA 1RRQA 2I8TA 3Q93A 1V8TA 2B06A 2G74A 2ICJA 1PUNA 4ZG0A 1NQYA 1Q27A 1TUMA 2A8RA 3I7VA 5C8LA 2AZWA 5DEQA 5CFIA 1V8WA 1JRKA 3A6VA 3EXQA 3X0IA 1G9QA 1V8NA 5IW5A 2PQVA 3ID9A 3EEUA 1G0SA 3P6YA 1K26A 1PUSA 3X0NA 1OW2A 3X0SA 2O1CA 4YOQA 4K6EA 2VNPA 3X0JA
chains in the Genus database with same CATH superfamily
1MP2A 2DSCA 2YVNA 5ANTA 2GB5A 5DPKA 3F6AA 1SU2A 3F13A 3O8SA 2QJTA 3ZR1A 4C9WA 1V8VA 3FSPA 2RRKA 3A6UA 3DKUA 1MUTA 4KG3A 3SHDA 3A6TA 3ACAA 1VIUA 3DUPA 3HYQA 3E57A 3Q91A 4JZTA 4NFWA 5ANUA 1X84A 4KYXA 5ISYA 3MDIA 5DD4A 4ICKA 1XSAA 5FSLA 1VRLA 2I6KA 1MQWA 3CNGA 1VCDA 2Q9PA 3EESA 4N1TA 3FFUA 5FSNA 1V8MA 3J7Ye 2B0VA 5HZXA 2CZRA 2GT2A 4ILQA 5ANSA 2I8UA 5GHPA 3GWYA 2FKBA 3BM4A 3X0PA 3AC9A 1V8YA 1F3YA 3O6ZA 4S2XA 3GZ5A 4N1UA 5GHNA 3X0RA 4YPRA 1RYAA 3MCFA 1JKNA 5BONA 1XSCA 3EF5A 3BHOA 3I9XA 3Q1PA 1PVFA 2DHOA 4YPHA 2YVMA 1HZTA 4S2VA 3O69A 3X0MA 2YVPA 5DDGA 2KDWA 3MDGA 5GHMA 2FMLA 1SOIA 3WHWA 3RH7A 3X0OA 2FVVA 1SZ3A 2A8QA 3P5TA 5IW4A 1I9AA 5ANWA 3O61A 5GHQA 2J8QA 2A8TA 1HX3A 1NFZA 1SJYA 2O5FA 2R5WA 3X0LA 5CFJA 1PPVA 1VHGA 1U20A 3A6SA 1VHZA 4V14A 2CL3A 2XSQA 4JZUA 1KHZA 1KTGA 3I7UA 2GT4A 3GZ6A 3FCMA 1V8RA 1VIQA 5GHOA 2JVBA 1V8SA 3GG6A 1VC9A 3N9UA 3N77A 2W4EA 3O52A 4KTBA 2DSDA 4S2WA 5ANVA 3X0KA 3R03A 1Q33A 2A6TA 1K2EA 1PUQA 1V8IA 2YYHA 3FJYA 3Q4IA 4NFXA 1RRSA 1NQZA 1NFSA 1R67A 3HHJA 3BAPA 5FSMA 5LPGA 1V8UA 1MQEA 2VNQA 3G0QA 1MR2A 2A8PA 5GHJA 4JZSA 4DYWA 3FK9A 5FSOA 4HVYA 4S2YA 5C7QA 3SMDA 2DSBA 3ZR0A 5FSIA 1V8LA 3MGMA 1X51A 3GZ8A 1PPXA 2PNYA 4C9XA 1X83A 3GRNA 3KVHA 3OGAA 4KG4A 3X0QA 4JZVA 2DUKA 1VK6A 4IJXA 5I8UA 5C7TA 3QSJA 2YVOA 4J7HA 3L85A 1IRYA 1MK1A 1PPWA 1XSBA 3Q2SA 5FSKA 5GHIA 5BS6A 3COUA 2ICKA 1QVJA 3U53A 3SONA 2G73A 2O5WA 2A8SA 2QKMB 1VC8A 1KT9A 4MPOA 2KDVA 2B2KA 2QJOA 3Q2TA 3H95A 1GA7A 1Q54A 4HFQA 1RRQA 2I8TA 3Q93A 1V8TA 2B06A 2G74A 2ICJA 4J7GA 1PUNA 4ZG0A 1NQYA 1Q27A 1TUMA 2A8RA 3I7VA 5C8LA 2AZWA 5DEQA 5CFIA 1V8WA 1JRKA 3A6VA 3EXQA 3X0IA 1G9QA 1V8NA 5IW5A 2PQVA 3ID9A 3EEUA 1G0SA 3P6YA 1K26A 1PUSA 3X0NA 1OW2A 3X0SA 2O1CA 4YOQA 4K6EA 2VNPA 3X0JA
chains in the Genus database with same CATH topology
1MP2A 2DSCA 2YVNA 5ANTA 2GB5A 5DPKA 3F6AA 1SU2A 3F13A 3O8SA 2QJTA 3ZR1A 4C9WA 1V8VA 3FSPA 2RRKA 3A6UA 3DKUA 1MUTA 4KG3A 3SHDA 3A6TA 3ACAA 1VIUA 3DUPA 3HYQA 3E57A 3Q91A 4JZTA 4NFWA 5ANUA 1X84A 4KYXA 5ISYA 3MDIA 5DD4A 4ICKA 1XSAA 5FSLA 1VRLA 2I6KA 1MQWA 3CNGA 1VCDA 2Q9PA 3EESA 4N1TA 3FFUA 5FSNA 1V8MA 3J7Ye 2B0VA 5HZXA 2CZRA 2GT2A 4ILQA 5ANSA 2I8UA 5GHPA 3GWYA 2FKBA 3BM4A 3X0PA 3AC9A 1V8YA 1F3YA 3O6ZA 4S2XA 3GZ5A 4N1UA 5GHNA 3X0RA 4YPRA 1RYAA 3MCFA 1JKNA 5BONA 1XSCA 3EF5A 3BHOA 3I9XA 3Q1PA 1PVFA 2DHOA 4YPHA 2YVMA 1HZTA 4S2VA 3O69A 3X0MA 2YVPA 5DDGA 2KDWA 3MDGA 5GHMA 2FMLA 1SOIA 3WHWA 3RH7A 3X0OA 2FVVA 1SZ3A 2A8QA 3P5TA 5IW4A 1I9AA 5ANWA 3O61A 5GHQA 2J8QA 2A8TA 1HX3A 1NFZA 1SJYA 2O5FA 2R5WA 3X0LA 5CFJA 1PPVA 1VHGA 1U20A 3A6SA 1VHZA 4V14A 2CL3A 2XSQA 4JZUA 1KHZA 1KTGA 3I7UA 2GT4A 3GZ6A 3FCMA 1V8RA 1VIQA 5GHOA 2JVBA 1V8SA 3GG6A 1VC9A 3N9UA 3N77A 2W4EA 3O52A 4KTBA 2DSDA 4S2WA 5ANVA 3X0KA 3R03A 1Q33A 2A6TA 1K2EA 1PUQA 1V8IA 2YYHA 3FJYA 3Q4IA 4NFXA 1RRSA 1NQZA 1NFSA 1R67A 3HHJA 3BAPA 5FSMA 5LPGA 1V8UA 1MQEA 2VNQA 3G0QA 1MR2A 2A8PA 5GHJA 4JZSA 4DYWA 3FK9A 5FSOA 4HVYA 4S2YA 5C7QA 3SMDA 2DSBA 3ZR0A 5FSIA 1V8LA 3MGMA 1X51A 3GZ8A 1PPXA 2PNYA 4C9XA 1X83A 3GRNA 3KVHA 3OGAA 4KG4A 3X0QA 4JZVA 2DUKA 1VK6A 4IJXA 5I8UA 5C7TA 3QSJA 2YVOA 4J7HA 3L85A 1IRYA 1MK1A 1PPWA 1XSBA 3Q2SA 5FSKA 5GHIA 5BS6A 3COUA 2ICKA 1QVJA 3U53A 3SONA 2G73A 2O5WA 2A8SA 2QKMB 1VC8A 1KT9A 4MPOA 2KDVA 2B2KA 2QJOA 3Q2TA 3H95A 1GA7A 1Q54A 4HFQA 1RRQA 2I8TA 3Q93A 1V8TA 2B06A 2G74A 2ICJA 4J7GA 1PUNA 4ZG0A 1NQYA 1Q27A 1TUMA 2A8RA 3I7VA 5C8LA 2AZWA 5DEQA 5CFIA 1V8WA 1JRKA 3A6VA 3EXQA 3X0IA 1G9QA 1V8NA 5IW5A 2PQVA 3ID9A 3EEUA 1G0SA 3P6YA 1K26A 1PUSA 3X0NA 1OW2A 3X0SA 2O1CA 4YOQA 4K6EA 2VNPA 3X0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MP2 A;  2DSC A;  2YVN A;  5ANT A;  2GB5 A;  5DPK A;  3F6A A;  1SU2 A;  3F13 A;  3O8S A;  2QJT A;  3ZR1 A;  4C9W A;  1V8V A;  3FSP A;  2RRK A;  3A6U A;  3DKU A;  1MUT A;  4KG3 A;  3SHD A;  3A6T A;  3ACA A;  1VIU A;  3DUP A;  3HYQ A;  3E57 A;  3Q91 A;  4JZT A;  4NFW A;  5ANU A;  1X84 A;  4KYX A;  5ISY A;  3MDI A;  5DD4 A;  4ICK A;  1XSA A;  5FSL A;  1VRL A;  2I6K A;  1MQW A;  3CNG A;  1VCD A;  2Q9P A;  3EES A;  4N1T A;  3FFU A;  5FSN A;  1V8M A;  3J7Y e;  2B0V A;  5HZX A;  2GT2 A;  4ILQ A;  5ANS A;  2I8U A;  5GHP A;  3GWY A;  2FKB A;  3BM4 A;  3X0P A;  3AC9 A;  1V8Y A;  1F3Y A;  3O6Z A;  4S2X A;  3GZ5 A;  4N1U A;  5GHN A;  3X0R A;  4YPR A;  1RYA A;  3MCF A;  1JKN A;  5BON A;  1XSC A;  3EF5 A;  3BHO A;  3I9X A;  3Q1P A;  1PVF A;  2DHO A;  4YPH A;  2YVM A;  1HZT A;  4S2V A;  3O69 A;  3X0M A;  2YVP A;  5DDG A;  2KDW A;  3MDG A;  5GHM A;  2FML A;  1SOI A;  3WHW A;  3RH7 A;  3X0O A;  2FVV A;  1SZ3 A;  2A8Q A;  3P5T A;  5IW4 A;  1I9A A;  5ANW A;  3O61 A;  5GHQ A;  2J8Q A;  2A8T A;  1HX3 A;  1NFZ A;  1SJY A;  2O5F A;  2R5W A;  3X0L A;  5CFJ A;  1PPV A;  1VHG A;  1U20 A;  3A6S A;  1VHZ A;  4V14 A;  2CL3 A;  2XSQ A;  4JZU A;  1KHZ A;  1KTG A;  3I7U A;  2GT4 A;  3GZ6 A;  3FCM A;  1V8R A;  1VIQ A;  5GHO A;  2JVB A;  1V8S A;  3GG6 A;  1VC9 A;  3N9U A;  3N77 A;  2W4E A;  3O52 A;  4KTB A;  2DSD A;  4S2W A;  5ANV A;  3X0K A;  3R03 A;  1Q33 A;  2A6T A;  1K2E A;  1PUQ A;  1V8I A;  2YYH A;  3FJY A;  3Q4I A;  4NFX A;  1RRS A;  1NQZ A;  1NFS A;  1R67 A;  3HHJ A;  3BAP A;  5FSM A;  5LPG A;  1V8U A;  1MQE A;  2VNQ A;  3G0Q A;  1MR2 A;  2A8P A;  5GHJ A;  4JZS A;  4DYW A;  3FK9 A;  5FSO A;  4HVY A;  4S2Y A;  5C7Q A;  3SMD A;  2DSB A;  3ZR0 A;  5FSI A;  1V8L A;  3MGM A;  1X51 A;  3GZ8 A;  1PPX A;  2PNY A;  4C9X A;  1X83 A;  3GRN A;  3KVH A;  3OGA A;  4KG4 A;  3X0Q A;  4JZV A;  2DUK A;  1VK6 A;  4IJX A;  5I8U A;  5C7T A;  3QSJ A;  2YVO A;  1IRY A;  3L85 A;  1MK1 A;  1PPW A;  1XSB A;  3Q2S A;  5FSK A;  5GHI A;  5BS6 A;  3COU A;  2ICK A;  1QVJ A;  3U53 A;  3SON A;  2G73 A;  2O5W A;  2A8S A;  2QKM B;  1VC8 A;  1KT9 A;  4MPO A;  2KDV A;  2B2K A;  2QJO A;  3Q2T A;  3H95 A;  1GA7 A;  1Q54 A;  4HFQ A;  1RRQ A;  2I8T A;  3Q93 A;  1V8T A;  2B06 A;  2G74 A;  2ICJ A;  1PUN A;  4ZG0 A;  1NQY A;  1Q27 A;  1TUM A;  2A8R A;  3I7V A;  5C8L A;  2AZW A;  5DEQ A;  5CFI A;  1V8W A;  1JRK A;  3A6V A;  3EXQ A;  3X0I A;  1G9Q A;  1V8N A;  5IW5 A;  2PQV A;  3ID9 A;  3EEU A;  1G0S A;  3P6Y A;  1K26 A;  1PUS A;  3X0N A;  1OW2 A;  3X0S A;  2O1C A;  4YOQ A;  4K6E A;  2VNP A;  3X0J A; 
#chains in the Genus database with same CATH topology
 1MP2 A;  2DSC A;  2YVN A;  5ANT A;  2GB5 A;  5DPK A;  3F6A A;  1SU2 A;  3F13 A;  3O8S A;  2QJT A;  3ZR1 A;  4C9W A;  1V8V A;  3FSP A;  2RRK A;  3A6U A;  3DKU A;  1MUT A;  4KG3 A;  3SHD A;  3A6T A;  3ACA A;  1VIU A;  3DUP A;  3HYQ A;  3E57 A;  3Q91 A;  4JZT A;  4NFW A;  5ANU A;  1X84 A;  4KYX A;  5ISY A;  3MDI A;  5DD4 A;  4ICK A;  1XSA A;  5FSL A;  1VRL A;  2I6K A;  1MQW A;  3CNG A;  1VCD A;  2Q9P A;  3EES A;  4N1T A;  3FFU A;  5FSN A;  1V8M A;  3J7Y e;  2B0V A;  5HZX A;  2CZR A;  2GT2 A;  4ILQ A;  5ANS A;  2I8U A;  5GHP A;  3GWY A;  2FKB A;  3BM4 A;  3X0P A;  3AC9 A;  1V8Y A;  1F3Y A;  3O6Z A;  4S2X A;  3GZ5 A;  4N1U A;  5GHN A;  3X0R A;  4YPR A;  1RYA A;  3MCF A;  1JKN A;  5BON A;  1XSC A;  3EF5 A;  3BHO A;  3I9X A;  3Q1P A;  1PVF A;  2DHO A;  4YPH A;  2YVM A;  1HZT A;  4S2V A;  3O69 A;  3X0M A;  2YVP A;  5DDG A;  2KDW A;  3MDG A;  5GHM A;  2FML A;  1SOI A;  3WHW A;  3RH7 A;  3X0O A;  2FVV A;  1SZ3 A;  2A8Q A;  3P5T A;  5IW4 A;  1I9A A;  5ANW A;  3O61 A;  5GHQ A;  2J8Q A;  2A8T A;  1HX3 A;  1NFZ A;  1SJY A;  2O5F A;  2R5W A;  3X0L A;  5CFJ A;  1PPV A;  1VHG A;  1U20 A;  3A6S A;  1VHZ A;  4V14 A;  2CL3 A;  2XSQ A;  4JZU A;  1KHZ A;  1KTG A;  3I7U A;  2GT4 A;  3GZ6 A;  3FCM A;  1V8R A;  1VIQ A;  5GHO A;  2JVB A;  1V8S A;  3GG6 A;  1VC9 A;  3N9U A;  3N77 A;  2W4E A;  3O52 A;  4KTB A;  2DSD A;  4S2W A;  5ANV A;  3X0K A;  3R03 A;  1Q33 A;  2A6T A;  1K2E A;  1PUQ A;  1V8I A;  2YYH A;  3FJY A;  3Q4I A;  4NFX A;  1RRS A;  1NQZ A;  1NFS A;  1R67 A;  3HHJ A;  3BAP A;  5FSM A;  5LPG A;  1V8U A;  1MQE A;  2VNQ A;  3G0Q A;  1MR2 A;  2A8P A;  5GHJ A;  4JZS A;  4DYW A;  3FK9 A;  5FSO A;  4HVY A;  4S2Y A;  5C7Q A;  3SMD A;  2DSB A;  3ZR0 A;  5FSI A;  1V8L A;  3MGM A;  1X51 A;  3GZ8 A;  1PPX A;  2PNY A;  4C9X A;  1X83 A;  3GRN A;  3KVH A;  3OGA A;  4KG4 A;  3X0Q A;  4JZV A;  2DUK A;  1VK6 A;  4IJX A;  5I8U A;  5C7T A;  3QSJ A;  2YVO A;  4J7H A;  3L85 A;  1IRY A;  1MK1 A;  1PPW A;  1XSB A;  3Q2S A;  5FSK A;  5GHI A;  5BS6 A;  3COU A;  2ICK A;  1QVJ A;  3U53 A;  3SON A;  2G73 A;  2O5W A;  2A8S A;  2QKM B;  1VC8 A;  1KT9 A;  4MPO A;  2KDV A;  2B2K A;  2QJO A;  3Q2T A;  3H95 A;  1GA7 A;  1Q54 A;  4HFQ A;  1RRQ A;  2I8T A;  3Q93 A;  1V8T A;  2B06 A;  2G74 A;  2ICJ A;  4J7G A;  1PUN A;  4ZG0 A;  1NQY A;  1Q27 A;  1TUM A;  2A8R A;  3I7V A;  5C8L A;  2AZW A;  5DEQ A;  5CFI A;  1V8W A;  1JRK A;  3A6V A;  3EXQ A;  3X0I A;  1G9Q A;  1V8N A;  5IW5 A;  2PQV A;  3ID9 A;  3EEU A;  1G0S A;  3P6Y A;  1K26 A;  1PUS A;  3X0N A;  1OW2 A;  3X0S A;  2O1C A;  4YOQ A;  4K6E A;  2VNP A;  3X0J A; 
#chains in the Genus database with same CATH homology
 1MP2 A;  2DSC A;  2YVN A;  5ANT A;  2GB5 A;  5DPK A;  3F6A A;  1SU2 A;  3F13 A;  3O8S A;  2QJT A;  3ZR1 A;  4C9W A;  1V8V A;  3FSP A;  2RRK A;  3A6U A;  3DKU A;  1MUT A;  4KG3 A;  3SHD A;  3A6T A;  3ACA A;  1VIU A;  3DUP A;  3HYQ A;  3E57 A;  3Q91 A;  4JZT A;  4NFW A;  5ANU A;  1X84 A;  4KYX A;  5ISY A;  3MDI A;  5DD4 A;  4ICK A;  1XSA A;  5FSL A;  1VRL A;  2I6K A;  1MQW A;  3CNG A;  1VCD A;  2Q9P A;  3EES A;  4N1T A;  3FFU A;  5FSN A;  1V8M A;  3J7Y e;  2B0V A;  5HZX A;  2CZR A;  2GT2 A;  4ILQ A;  5ANS A;  2I8U A;  5GHP A;  3GWY A;  2FKB A;  3BM4 A;  3X0P A;  3AC9 A;  1V8Y A;  1F3Y A;  3O6Z A;  4S2X A;  3GZ5 A;  4N1U A;  5GHN A;  3X0R A;  4YPR A;  1RYA A;  3MCF A;  1JKN A;  5BON A;  1XSC A;  3EF5 A;  3BHO A;  3I9X A;  3Q1P A;  1PVF A;  2DHO A;  4YPH A;  2YVM A;  1HZT A;  4S2V A;  3O69 A;  3X0M A;  2YVP A;  5DDG A;  2KDW A;  3MDG A;  5GHM A;  2FML A;  1SOI A;  3WHW A;  3RH7 A;  3X0O A;  2FVV A;  1SZ3 A;  2A8Q A;  3P5T A;  5IW4 A;  1I9A A;  5ANW A;  3O61 A;  5GHQ A;  2J8Q A;  2A8T A;  1HX3 A;  1NFZ A;  1SJY A;  2O5F A;  2R5W A;  3X0L A;  5CFJ A;  1PPV A;  1VHG A;  1U20 A;  3A6S A;  1VHZ A;  4V14 A;  2CL3 A;  2XSQ A;  4JZU A;  1KHZ A;  1KTG A;  3I7U A;  2GT4 A;  3GZ6 A;  3FCM A;  1V8R A;  1VIQ A;  5GHO A;  2JVB A;  1V8S A;  3GG6 A;  1VC9 A;  3N9U A;  3N77 A;  2W4E A;  3O52 A;  4KTB A;  2DSD A;  4S2W A;  5ANV A;  3X0K A;  3R03 A;  1Q33 A;  2A6T A;  1K2E A;  1PUQ A;  1V8I A;  2YYH A;  3FJY A;  3Q4I A;  4NFX A;  1RRS A;  1NQZ A;  1NFS A;  1R67 A;  3HHJ A;  3BAP A;  5FSM A;  5LPG A;  1V8U A;  1MQE A;  2VNQ A;  3G0Q A;  1MR2 A;  2A8P A;  5GHJ A;  4JZS A;  4DYW A;  3FK9 A;  5FSO A;  4HVY A;  4S2Y A;  5C7Q A;  3SMD A;  2DSB A;  3ZR0 A;  5FSI A;  1V8L A;  3MGM A;  1X51 A;  3GZ8 A;  1PPX A;  2PNY A;  4C9X A;  1X83 A;  3GRN A;  3KVH A;  3OGA A;  4KG4 A;  3X0Q A;  4JZV A;  2DUK A;  1VK6 A;  4IJX A;  5I8U A;  5C7T A;  3QSJ A;  2YVO A;  4J7H A;  3L85 A;  1IRY A;  1MK1 A;  1PPW A;  1XSB A;  3Q2S A;  5FSK A;  5GHI A;  5BS6 A;  3COU A;  2ICK A;  1QVJ A;  3U53 A;  3SON A;  2G73 A;  2O5W A;  2A8S A;  2QKM B;  1VC8 A;  1KT9 A;  4MPO A;  2KDV A;  2B2K A;  2QJO A;  3Q2T A;  3H95 A;  1GA7 A;  1Q54 A;  4HFQ A;  1RRQ A;  2I8T A;  3Q93 A;  1V8T A;  2B06 A;  2G74 A;  2ICJ A;  4J7G A;  1PUN A;  4ZG0 A;  1NQY A;  1Q27 A;  1TUM A;  2A8R A;  3I7V A;  5C8L A;  2AZW A;  5DEQ A;  5CFI A;  1V8W A;  1JRK A;  3A6V A;  3EXQ A;  3X0I A;  1G9Q A;  1V8N A;  5IW5 A;  2PQV A;  3ID9 A;  3EEU A;  1G0S A;  3P6Y A;  1K26 A;  1PUS A;  3X0N A;  1OW2 A;  3X0S A;  2O1C A;  4YOQ A;  4K6E A;  2VNP A;  3X0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...