3WHWA

Mth1 in complex with ruthenium-based inhibitor
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
154
structure length
154
Chain Sequence
ASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7,8-dihydro-8-oxoguanine triphosphatase
publication title An Organometallic Inhibitor for the Human Repair Enzyme 7,8-Dihydro-8-oxoguanosine Triphosphatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 41
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3whwA00
4NFXA 3SMDA 1KT9A 1V8NA 2GT2A 1PPXA 4YPHA 1V8RA 1V8YA 3Q1PA 2W4EA 3GZ5A 3RH7A 1RRSA 1V8VA 1JKNA 5BONA 1G9QA 4S2WA 1V8WA 5ANVA 3X0IA 3X0PA 5CFIA 2VNQA 1R67A 1MUTA 1NQYA 4MPOA 4JZVA 3A6SA 1PUNA 3GWYA 3I9XA 1V8UA 5FSIA 1JRKA 2A8RA 4KYXA 5C7TA 1NQZA 2ICJA 4JZTA 3I7UA 5ANWA 1X84A 4ZG0A 1XSAA 2B0VA 5ANSA 3J7Ye 1V8LA 3SHDA 3U53A 5DEQA 3EXQA 1SOIA 4N1UA 3H95A 4C9WA 5CFJA 2GT4A 4YPRA 2O5FA 3EF5A 3SONA 2A8PA 1XSCA 1VHZA 1PVFA 1NFZA 3FK9A 4HFQA 3O6ZA 2FKBA 1XSBA 3ACAA 3FJYA 1V8TA 1KTGA 2A8QA 1HX3A 3BAPA 4HVYA 4V14A 3EEUA 2PQVA 3KVHA 2I8TA 1VRLA 3GRNA 1PUQA 1X51A 3HYQA 3X0NA 2A8TA 4JZUA 5GHOA 2GB5A 2O5WA 1VCDA 1I9AA 1RYAA 2FMLA 3FCMA 5FSLA 2DSDA 2YYHA 1NFSA 3MGMA 3QSJA 2YVNA 2JVBA 2YVOA 3A6TA 4ICKA 5IW4A 4S2XA 3O52A 3P6YA 3FFUA 3GZ6A 4JZSA 1MK1A 1SJYA 3G0QA 1VC9A 1F3YA 3MDGA 2A8SA 1PPVA 3EESA 3F6AA 4KG4A 3X0QA 1MQWA 5C8LA 1PPWA 4N1TA 1RRQA 3COUA 5DPKA 2O1CA 1V8MA 3FSPA 5GHQA 3BHOA 5DD4A 5FSMA 3ZR0A 5IW5A 3GG6A 2RRKA 2DUKA 3AC9A 1Q27A 3A6VA 3N77A 5ANUA 5GHJA 1Q33A 3ZR1A 5BS6A 1PUSA 1VIUA 3ID9A 1V8SA 5ISYA 2DSCA 3X0OA 1Q54A 2G74A 2YVMA 3CNGA 3HHJA 3X0LA 1MR2A 1TUMA 4YOQA 3Q2SA 2KDVA 1VIQA 2R5WA 5ANTA 1G0SA 2G73A 1U20A 1SZ3A 5GHPA 1GA7A 1SU2A 2AZWA 3R03A 4C9XA 3I7VA 2I6KA 1K2EA 5C7QA 5FSKA 2PNYA 2XSQA 1K26A 2B2KA 3DKUA 3F13A 5I8UA 3P5TA 4NFWA 1KHZA 1HZTA 5LPGA 5HZXA 2DSBA 3X0SA 1IRYA 5FSOA 3O8SA 3GZ8A 5FSNA 2FVVA 3MCFA 3X0RA 5DDGA 1VC8A 3N9UA 2I8UA 2QJOA 3DUPA 1OW2A 4ILQA 2CL3A 4S2VA 1VK6A 2Q9PA 3Q93A 3X0KA 4KTBA 1QVJA 1VHGA 2ICKA 3E57A 2QJTA 3X0JA 2VNPA 1X83A 2YVPA 3Q2TA 3O61A 3X0MA 3WHWA 3MDIA 3A6UA 5GHNA 3BM4A 1MP2A 3Q91A 3OGAA 5GHMA 5GHIA 2DHOA 1MQEA 4KG3A 2QKMB 2KDWA 3L85A 3Q4IA 1V8IA 2B06A 2J8QA 3O69A 4K6EA 4S2YA 2A6TA 4DYWA 4IJXA
chains in the Genus database with same CATH superfamily
4NFXA 3SMDA 1KT9A 1V8NA 2GT2A 1PPXA 4YPHA 1V8RA 1V8YA 3Q1PA 2W4EA 3GZ5A 3RH7A 1RRSA 1V8VA 1JKNA 5BONA 1G9QA 4S2WA 1V8WA 5ANVA 3X0IA 3X0PA 5CFIA 2VNQA 1R67A 1MUTA 1NQYA 4MPOA 4JZVA 3A6SA 1PUNA 3GWYA 3I9XA 1V8UA 5FSIA 1JRKA 2A8RA 4KYXA 5C7TA 1NQZA 2ICJA 4JZTA 3I7UA 5ANWA 1X84A 4ZG0A 1XSAA 2B0VA 5ANSA 3J7Ye 1V8LA 3SHDA 3U53A 5DEQA 3EXQA 1SOIA 4N1UA 3H95A 4C9WA 5CFJA 2GT4A 4YPRA 2O5FA 3EF5A 3SONA 2A8PA 1XSCA 1VHZA 1PVFA 1NFZA 3FK9A 4HFQA 3O6ZA 2FKBA 1XSBA 3ACAA 3FJYA 1V8TA 1KTGA 2A8QA 1HX3A 3BAPA 4HVYA 4V14A 3EEUA 2PQVA 3KVHA 2I8TA 1VRLA 3GRNA 1PUQA 1X51A 3HYQA 3X0NA 2A8TA 4J7GA 4JZUA 5GHOA 2GB5A 2O5WA 1VCDA 1I9AA 1RYAA 2FMLA 3FCMA 5FSLA 2DSDA 2YYHA 1NFSA 3MGMA 3QSJA 2YVNA 2JVBA 2YVOA 3A6TA 4ICKA 5IW4A 4S2XA 3O52A 3P6YA 3FFUA 3GZ6A 4JZSA 1MK1A 1SJYA 3G0QA 1VC9A 1F3YA 3MDGA 2A8SA 1PPVA 3EESA 3F6AA 4KG4A 3X0QA 1MQWA 5C8LA 1PPWA 4N1TA 1RRQA 3COUA 5DPKA 2O1CA 1V8MA 3FSPA 5GHQA 3BHOA 5DD4A 5FSMA 3ZR0A 5IW5A 3GG6A 2RRKA 2DUKA 3AC9A 1Q27A 3A6VA 3N77A 5ANUA 5GHJA 1Q33A 3ZR1A 5BS6A 1PUSA 1VIUA 3ID9A 1V8SA 5ISYA 2DSCA 3X0OA 1Q54A 2G74A 2YVMA 3CNGA 3HHJA 3X0LA 1MR2A 1TUMA 4YOQA 3Q2SA 2KDVA 1VIQA 2R5WA 5ANTA 1G0SA 2G73A 1U20A 1SZ3A 5GHPA 1GA7A 1SU2A 2AZWA 3R03A 4C9XA 3I7VA 2I6KA 1K2EA 5C7QA 5FSKA 2PNYA 2XSQA 1K26A 2B2KA 3DKUA 3F13A 5I8UA 3P5TA 4NFWA 1KHZA 1HZTA 4J7HA 5LPGA 5HZXA 2DSBA 3X0SA 1IRYA 5FSOA 3O8SA 3GZ8A 5FSNA 2FVVA 3MCFA 3X0RA 5DDGA 1VC8A 3N9UA 2I8UA 2QJOA 3DUPA 1OW2A 4ILQA 2CL3A 4S2VA 1VK6A 2Q9PA 3Q93A 3X0KA 4KTBA 1QVJA 1VHGA 2ICKA 3E57A 2QJTA 3X0JA 2VNPA 1X83A 2YVPA 3Q2TA 3O61A 3X0MA 2CZRA 3WHWA 3A6UA 5GHNA 3MDIA 3BM4A 1MP2A 3Q91A 3OGAA 5GHMA 5GHIA 2DHOA 1MQEA 4KG3A 2QKMB 2KDWA 3L85A 3Q4IA 1V8IA 2B06A 2J8QA 3O69A 4K6EA 4S2YA 2A6TA 4DYWA 4IJXA
chains in the Genus database with same CATH topology
4NFXA 3SMDA 1KT9A 1V8NA 2GT2A 1PPXA 4YPHA 1V8RA 1V8YA 3Q1PA 2W4EA 3GZ5A 3RH7A 1RRSA 1V8VA 1JKNA 5BONA 1G9QA 4S2WA 1V8WA 5ANVA 3X0IA 3X0PA 5CFIA 2VNQA 1R67A 1MUTA 1NQYA 4MPOA 4JZVA 3A6SA 1PUNA 3GWYA 3I9XA 1V8UA 5FSIA 1JRKA 2A8RA 4KYXA 5C7TA 1NQZA 2ICJA 4JZTA 3I7UA 5ANWA 1X84A 4ZG0A 1XSAA 2B0VA 5ANSA 3J7Ye 1V8LA 3SHDA 3U53A 5DEQA 3EXQA 1SOIA 4N1UA 3H95A 4C9WA 5CFJA 2GT4A 4YPRA 2O5FA 3EF5A 3SONA 2A8PA 1XSCA 1VHZA 1PVFA 1NFZA 3FK9A 4HFQA 3O6ZA 2FKBA 1XSBA 3ACAA 3FJYA 1V8TA 1KTGA 2A8QA 1HX3A 3BAPA 4HVYA 4V14A 3EEUA 2PQVA 3KVHA 2I8TA 1VRLA 3GRNA 1PUQA 1X51A 3HYQA 3X0NA 2A8TA 4J7GA 4JZUA 5GHOA 2GB5A 2O5WA 1VCDA 1I9AA 1RYAA 2FMLA 3FCMA 5FSLA 2DSDA 2YYHA 1NFSA 3MGMA 3QSJA 2YVNA 2JVBA 2YVOA 3A6TA 4ICKA 5IW4A 4S2XA 3O52A 3P6YA 3FFUA 3GZ6A 4JZSA 1MK1A 1SJYA 3G0QA 1VC9A 1F3YA 3MDGA 2A8SA 1PPVA 3EESA 3F6AA 4KG4A 3X0QA 1MQWA 5C8LA 1PPWA 4N1TA 1RRQA 3COUA 5DPKA 2O1CA 1V8MA 3FSPA 5GHQA 3BHOA 5DD4A 5FSMA 3ZR0A 5IW5A 3GG6A 2RRKA 2DUKA 3AC9A 1Q27A 3A6VA 3N77A 5ANUA 5GHJA 1Q33A 3ZR1A 5BS6A 1PUSA 1VIUA 3ID9A 1V8SA 5ISYA 2DSCA 3X0OA 1Q54A 2G74A 2YVMA 3CNGA 3HHJA 3X0LA 1MR2A 1TUMA 4YOQA 3Q2SA 2KDVA 1VIQA 2R5WA 5ANTA 1G0SA 2G73A 1U20A 1SZ3A 5GHPA 1GA7A 1SU2A 2AZWA 3R03A 4C9XA 3I7VA 2I6KA 1K2EA 5C7QA 5FSKA 2PNYA 2XSQA 1K26A 2B2KA 3DKUA 3F13A 5I8UA 3P5TA 4NFWA 1KHZA 1HZTA 4J7HA 5LPGA 5HZXA 2DSBA 3X0SA 1IRYA 5FSOA 3O8SA 3GZ8A 5FSNA 2FVVA 3MCFA 3X0RA 5DDGA 1VC8A 3N9UA 2I8UA 2QJOA 3DUPA 1OW2A 4ILQA 2CL3A 4S2VA 1VK6A 2Q9PA 3Q93A 3X0KA 4KTBA 1QVJA 1VHGA 2ICKA 3E57A 2QJTA 3X0JA 2VNPA 1X83A 2YVPA 3Q2TA 3O61A 3X0MA 2CZRA 3WHWA 3A6UA 5GHNA 3MDIA 3BM4A 1MP2A 3Q91A 3OGAA 5GHMA 5GHIA 2DHOA 1MQEA 4KG3A 2QKMB 2KDWA 3L85A 3Q4IA 1V8IA 2B06A 2J8QA 3O69A 4K6EA 4S2YA 2A6TA 4DYWA 4IJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NFX A;  3SMD A;  1KT9 A;  1V8N A;  2GT2 A;  1PPX A;  4YPH A;  1V8R A;  1V8Y A;  3Q1P A;  2W4E A;  3GZ5 A;  3RH7 A;  1RRS A;  1V8V A;  1JKN A;  5BON A;  1G9Q A;  4S2W A;  1V8W A;  5ANV A;  3X0I A;  3X0P A;  5CFI A;  2VNQ A;  1R67 A;  1MUT A;  1NQY A;  4MPO A;  4JZV A;  3A6S A;  1PUN A;  3GWY A;  3I9X A;  1V8U A;  5FSI A;  1JRK A;  2A8R A;  4KYX A;  5C7T A;  1NQZ A;  2ICJ A;  4JZT A;  3I7U A;  5ANW A;  1X84 A;  4ZG0 A;  1XSA A;  2B0V A;  5ANS A;  3J7Y e;  1V8L A;  3SHD A;  3U53 A;  5DEQ A;  3EXQ A;  1SOI A;  4N1U A;  3H95 A;  4C9W A;  5CFJ A;  2GT4 A;  4YPR A;  2O5F A;  3EF5 A;  3SON A;  2A8P A;  1XSC A;  1VHZ A;  1PVF A;  1NFZ A;  3FK9 A;  4HFQ A;  3O6Z A;  2FKB A;  1XSB A;  3ACA A;  3FJY A;  1V8T A;  1KTG A;  2A8Q A;  1HX3 A;  3BAP A;  4HVY A;  4V14 A;  3EEU A;  2PQV A;  3KVH A;  2I8T A;  1VRL A;  3GRN A;  1PUQ A;  1X51 A;  3HYQ A;  3X0N A;  2A8T A;  4JZU A;  5GHO A;  2GB5 A;  2O5W A;  1VCD A;  1I9A A;  1RYA A;  2FML A;  3FCM A;  5FSL A;  2DSD A;  2YYH A;  1NFS A;  3MGM A;  3QSJ A;  2YVN A;  2JVB A;  2YVO A;  3A6T A;  4ICK A;  5IW4 A;  4S2X A;  3O52 A;  3P6Y A;  3FFU A;  3GZ6 A;  4JZS A;  1MK1 A;  1SJY A;  3G0Q A;  1VC9 A;  1F3Y A;  3MDG A;  2A8S A;  1PPV A;  3EES A;  3F6A A;  4KG4 A;  3X0Q A;  1MQW A;  5C8L A;  1PPW A;  4N1T A;  1RRQ A;  3COU A;  5DPK A;  2O1C A;  1V8M A;  3FSP A;  5GHQ A;  3BHO A;  5DD4 A;  5FSM A;  3ZR0 A;  5IW5 A;  3GG6 A;  2RRK A;  2DUK A;  3AC9 A;  1Q27 A;  3A6V A;  3N77 A;  5ANU A;  5GHJ A;  1Q33 A;  3ZR1 A;  5BS6 A;  1PUS A;  1VIU A;  3ID9 A;  1V8S A;  5ISY A;  2DSC A;  3X0O A;  1Q54 A;  2G74 A;  2YVM A;  3CNG A;  3HHJ A;  3X0L A;  1MR2 A;  1TUM A;  4YOQ A;  3Q2S A;  2KDV A;  1VIQ A;  2R5W A;  5ANT A;  1G0S A;  2G73 A;  1U20 A;  1SZ3 A;  5GHP A;  1GA7 A;  1SU2 A;  2AZW A;  3R03 A;  4C9X A;  3I7V A;  2I6K A;  1K2E A;  5C7Q A;  5FSK A;  2PNY A;  2XSQ A;  1K26 A;  2B2K A;  3DKU A;  3F13 A;  5I8U A;  3P5T A;  4NFW A;  1KHZ A;  1HZT A;  5LPG A;  5HZX A;  2DSB A;  3X0S A;  1IRY A;  5FSO A;  3O8S A;  3GZ8 A;  5FSN A;  2FVV A;  3MCF A;  3X0R A;  5DDG A;  1VC8 A;  3N9U A;  2I8U A;  2QJO A;  3DUP A;  1OW2 A;  4ILQ A;  2CL3 A;  4S2V A;  1VK6 A;  2Q9P A;  3Q93 A;  3X0K A;  4KTB A;  1QVJ A;  1VHG A;  2ICK A;  3E57 A;  2QJT A;  3X0J A;  2VNP A;  1X83 A;  2YVP A;  3Q2T A;  3O61 A;  3X0M A;  3WHW A;  3MDI A;  3A6U A;  5GHN A;  3BM4 A;  1MP2 A;  3Q91 A;  3OGA A;  5GHM A;  5GHI A;  2DHO A;  1MQE A;  4KG3 A;  2QKM B;  2KDW A;  3L85 A;  3Q4I A;  1V8I A;  2B06 A;  2J8Q A;  3O69 A;  4K6E A;  4S2Y A;  2A6T A;  4DYW A;  4IJX A; 
#chains in the Genus database with same CATH topology
 4NFX A;  3SMD A;  1KT9 A;  1V8N A;  2GT2 A;  1PPX A;  4YPH A;  1V8R A;  1V8Y A;  3Q1P A;  2W4E A;  3GZ5 A;  3RH7 A;  1RRS A;  1V8V A;  1JKN A;  5BON A;  1G9Q A;  4S2W A;  1V8W A;  5ANV A;  3X0I A;  3X0P A;  5CFI A;  2VNQ A;  1R67 A;  1MUT A;  1NQY A;  4MPO A;  4JZV A;  3A6S A;  1PUN A;  3GWY A;  3I9X A;  1V8U A;  5FSI A;  1JRK A;  2A8R A;  4KYX A;  5C7T A;  1NQZ A;  2ICJ A;  4JZT A;  3I7U A;  5ANW A;  1X84 A;  4ZG0 A;  1XSA A;  2B0V A;  5ANS A;  3J7Y e;  1V8L A;  3SHD A;  3U53 A;  5DEQ A;  3EXQ A;  1SOI A;  4N1U A;  3H95 A;  4C9W A;  5CFJ A;  2GT4 A;  4YPR A;  2O5F A;  3EF5 A;  3SON A;  2A8P A;  1XSC A;  1VHZ A;  1PVF A;  1NFZ A;  3FK9 A;  4HFQ A;  3O6Z A;  2FKB A;  1XSB A;  3ACA A;  3FJY A;  1V8T A;  1KTG A;  2A8Q A;  1HX3 A;  3BAP A;  4HVY A;  4V14 A;  3EEU A;  2PQV A;  3KVH A;  2I8T A;  1VRL A;  3GRN A;  1PUQ A;  1X51 A;  3HYQ A;  3X0N A;  2A8T A;  4J7G A;  4JZU A;  5GHO A;  2GB5 A;  2O5W A;  1VCD A;  1I9A A;  1RYA A;  2FML A;  3FCM A;  5FSL A;  2DSD A;  2YYH A;  1NFS A;  3MGM A;  3QSJ A;  2YVN A;  2JVB A;  2YVO A;  3A6T A;  4ICK A;  5IW4 A;  4S2X A;  3O52 A;  3P6Y A;  3FFU A;  3GZ6 A;  4JZS A;  1MK1 A;  1SJY A;  3G0Q A;  1VC9 A;  1F3Y A;  3MDG A;  2A8S A;  1PPV A;  3EES A;  3F6A A;  4KG4 A;  3X0Q A;  1MQW A;  5C8L A;  1PPW A;  4N1T A;  1RRQ A;  3COU A;  5DPK A;  2O1C A;  1V8M A;  3FSP A;  5GHQ A;  3BHO A;  5DD4 A;  5FSM A;  3ZR0 A;  5IW5 A;  3GG6 A;  2RRK A;  2DUK A;  3AC9 A;  1Q27 A;  3A6V A;  3N77 A;  5ANU A;  5GHJ A;  1Q33 A;  3ZR1 A;  5BS6 A;  1PUS A;  1VIU A;  3ID9 A;  1V8S A;  5ISY A;  2DSC A;  3X0O A;  1Q54 A;  2G74 A;  2YVM A;  3CNG A;  3HHJ A;  3X0L A;  1MR2 A;  1TUM A;  4YOQ A;  3Q2S A;  2KDV A;  1VIQ A;  2R5W A;  5ANT A;  1G0S A;  2G73 A;  1U20 A;  1SZ3 A;  5GHP A;  1GA7 A;  1SU2 A;  2AZW A;  3R03 A;  4C9X A;  3I7V A;  2I6K A;  1K2E A;  5C7Q A;  5FSK A;  2PNY A;  2XSQ A;  1K26 A;  2B2K A;  3DKU A;  3F13 A;  5I8U A;  3P5T A;  4NFW A;  1KHZ A;  1HZT A;  4J7H A;  5LPG A;  5HZX A;  2DSB A;  3X0S A;  1IRY A;  5FSO A;  3O8S A;  3GZ8 A;  5FSN A;  2FVV A;  3MCF A;  3X0R A;  5DDG A;  1VC8 A;  3N9U A;  2I8U A;  2QJO A;  3DUP A;  1OW2 A;  4ILQ A;  2CL3 A;  4S2V A;  1VK6 A;  2Q9P A;  3Q93 A;  3X0K A;  4KTB A;  1QVJ A;  1VHG A;  2ICK A;  3E57 A;  2QJT A;  3X0J A;  2VNP A;  1X83 A;  2YVP A;  3Q2T A;  3O61 A;  3X0M A;  2CZR A;  3WHW A;  3A6U A;  5GHN A;  3MDI A;  3BM4 A;  1MP2 A;  3Q91 A;  3OGA A;  5GHM A;  5GHI A;  2DHO A;  1MQE A;  4KG3 A;  2QKM B;  2KDW A;  3L85 A;  3Q4I A;  1V8I A;  2B06 A;  2J8Q A;  3O69 A;  4K6E A;  4S2Y A;  2A6T A;  4DYW A;  4IJX A; 
#chains in the Genus database with same CATH homology
 4NFX A;  3SMD A;  1KT9 A;  1V8N A;  2GT2 A;  1PPX A;  4YPH A;  1V8R A;  1V8Y A;  3Q1P A;  2W4E A;  3GZ5 A;  3RH7 A;  1RRS A;  1V8V A;  1JKN A;  5BON A;  1G9Q A;  4S2W A;  1V8W A;  5ANV A;  3X0I A;  3X0P A;  5CFI A;  2VNQ A;  1R67 A;  1MUT A;  1NQY A;  4MPO A;  4JZV A;  3A6S A;  1PUN A;  3GWY A;  3I9X A;  1V8U A;  5FSI A;  1JRK A;  2A8R A;  4KYX A;  5C7T A;  1NQZ A;  2ICJ A;  4JZT A;  3I7U A;  5ANW A;  1X84 A;  4ZG0 A;  1XSA A;  2B0V A;  5ANS A;  3J7Y e;  1V8L A;  3SHD A;  3U53 A;  5DEQ A;  3EXQ A;  1SOI A;  4N1U A;  3H95 A;  4C9W A;  5CFJ A;  2GT4 A;  4YPR A;  2O5F A;  3EF5 A;  3SON A;  2A8P A;  1XSC A;  1VHZ A;  1PVF A;  1NFZ A;  3FK9 A;  4HFQ A;  3O6Z A;  2FKB A;  1XSB A;  3ACA A;  3FJY A;  1V8T A;  1KTG A;  2A8Q A;  1HX3 A;  3BAP A;  4HVY A;  4V14 A;  3EEU A;  2PQV A;  3KVH A;  2I8T A;  1VRL A;  3GRN A;  1PUQ A;  1X51 A;  3HYQ A;  3X0N A;  2A8T A;  4J7G A;  4JZU A;  5GHO A;  2GB5 A;  2O5W A;  1VCD A;  1I9A A;  1RYA A;  2FML A;  3FCM A;  5FSL A;  2DSD A;  2YYH A;  1NFS A;  3MGM A;  3QSJ A;  2YVN A;  2JVB A;  2YVO A;  3A6T A;  4ICK A;  5IW4 A;  4S2X A;  3O52 A;  3P6Y A;  3FFU A;  3GZ6 A;  4JZS A;  1MK1 A;  1SJY A;  3G0Q A;  1VC9 A;  1F3Y A;  3MDG A;  2A8S A;  1PPV A;  3EES A;  3F6A A;  4KG4 A;  3X0Q A;  1MQW A;  5C8L A;  1PPW A;  4N1T A;  1RRQ A;  3COU A;  5DPK A;  2O1C A;  1V8M A;  3FSP A;  5GHQ A;  3BHO A;  5DD4 A;  5FSM A;  3ZR0 A;  5IW5 A;  3GG6 A;  2RRK A;  2DUK A;  3AC9 A;  1Q27 A;  3A6V A;  3N77 A;  5ANU A;  5GHJ A;  1Q33 A;  3ZR1 A;  5BS6 A;  1PUS A;  1VIU A;  3ID9 A;  1V8S A;  5ISY A;  2DSC A;  3X0O A;  1Q54 A;  2G74 A;  2YVM A;  3CNG A;  3HHJ A;  3X0L A;  1MR2 A;  1TUM A;  4YOQ A;  3Q2S A;  2KDV A;  1VIQ A;  2R5W A;  5ANT A;  1G0S A;  2G73 A;  1U20 A;  1SZ3 A;  5GHP A;  1GA7 A;  1SU2 A;  2AZW A;  3R03 A;  4C9X A;  3I7V A;  2I6K A;  1K2E A;  5C7Q A;  5FSK A;  2PNY A;  2XSQ A;  1K26 A;  2B2K A;  3DKU A;  3F13 A;  5I8U A;  3P5T A;  4NFW A;  1KHZ A;  1HZT A;  4J7H A;  5LPG A;  5HZX A;  2DSB A;  3X0S A;  1IRY A;  5FSO A;  3O8S A;  3GZ8 A;  5FSN A;  2FVV A;  3MCF A;  3X0R A;  5DDG A;  1VC8 A;  3N9U A;  2I8U A;  2QJO A;  3DUP A;  1OW2 A;  4ILQ A;  2CL3 A;  4S2V A;  1VK6 A;  2Q9P A;  3Q93 A;  3X0K A;  4KTB A;  1QVJ A;  1VHG A;  2ICK A;  3E57 A;  2QJT A;  3X0J A;  2VNP A;  1X83 A;  2YVP A;  3Q2T A;  3O61 A;  3X0M A;  2CZR A;  3WHW A;  3A6U A;  5GHN A;  3MDI A;  3BM4 A;  1MP2 A;  3Q91 A;  3OGA A;  5GHM A;  5GHI A;  2DHO A;  1MQE A;  4KG3 A;  2QKM B;  2KDW A;  3L85 A;  3Q4I A;  1V8I A;  2B06 A;  2J8Q A;  3O69 A;  4K6E A;  4S2Y A;  2A6T A;  4DYW A;  4IJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...