3WHWA

Mth1 in complex with ruthenium-based inhibitor
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
154
structure length
154
Chain Sequence
ASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 7,8-dihydro-8-oxoguanine triphosphatase
publication title An Organometallic Inhibitor for the Human Repair Enzyme 7,8-Dihydro-8-oxoguanosine Triphosphatase.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3whwA00
5ANSA 2A8SA 2I6KA 1NFZA 5DD4A 4K6EA 1KT9A 1XSCA 5GHOA 3ZR1A 3GZ6A 3EF5A 2A8RA 2KDWA 1PPWA 1KTGA 4KG3A 1PPXA 3N77A 3Q4IA 1SJYA 4JZTA 2ICJA 5FSOA 3X0JA 3O6ZA 1I9AA 3O52A 5FSMA 4DYWA 1V8NA 3ZR0A 5GHIA 3OGAA 1X84A 1G9QA 5LPGA 2W4EA 3J7Ye 1JKNA 2QJOA 3FCMA 2JVBA 1X83A 4KG4A 4HVYA 3A6UA 1G0SA 5ANUA 5GHMA 4C9WA 2FKBA 1JRKA 3A6TA 1Q27A 5C7TA 4YPHA 1VHGA 3X0RA 1V8LA 3AC9A 5FSKA 3X0OA 2FVVA 5I8UA 1NQZA 3R03A 3X0QA 2YVPA 4C9XA 3Q1PA 5DPKA 4YPRA 2O5FA 2AZWA 4ICKA 5GHQA 3Q2SA 3G0QA 5IW5A 1VRLA 1R67A 5ISYA 1VIQA 3BAPA 3E57A 1MQWA 3P6YA 1GA7A 2A8QA 3DKUA 4KTBA 1V8UA 4V14A 5ANVA 3F6AA 5GHJA 3X0NA 5ANTA 3X0LA 3CNGA 2VNQA 3HYQA 1OW2A 1PUNA 1PPVA 4KYXA 4S2YA 4JZSA 1KHZA 1SOIA 3I7UA 3EXQA 1XSAA 2DSCA 1V8RA 4JZVA 4NFXA 2PNYA 3N9UA 3P5TA 4ILQA 3X0SA 1V8VA 1NQYA 1MUTA 2R5WA 3X0PA 2PQVA 5HZXA 2A8TA 3EESA 1RRQA 2A6TA 3SMDA 1MQEA 3GZ8A 3COUA 3L85A 5FSLA 2VNPA 3HHJA 1TUMA 2YVNA 4ZG0A 2DSDA 3O61A 1K26A 1RYAA 3Q91A 3I7VA 3ID9A 3BM4A 2FMLA 1V8IA 2B06A 5GHPA 2O1CA 3WHWA 3FSPA 1U20A 3O8SA 3U53A 3X0MA 3DUPA 1V8MA 2G73A 5C7QA 1HX3A 4JZUA 2I8UA 3ACAA 1Q33A 1NFSA 3EEUA 1X51A 2YVMA 1V8WA 5CFIA 1VIUA 1PUQA 2YYHA 3I9XA 5ANWA 4S2WA 1QVJA 3F13A 3QSJA 5BS6A 1VCDA 5IW4A 1HZTA 3A6SA 3MGMA 4MPOA 1IRYA 5C8LA 5DEQA 3Q2TA 4YOQA 3A6VA 5FSNA 3X0IA 4HFQA 2QKMB 2XSQA 3X0KA 2DSBA 1PVFA 3FK9A 4IJXA 2Q9PA 1V8SA 2GB5A 3SHDA 1VK6A 2O5WA 2CL3A 1F3YA 3MCFA 1RRSA 5GHNA 1SU2A 1XSBA 2DUKA 1Q54A 1SZ3A 3BHOA 3FFUA 3GRNA 5CFJA 3MDIA 1VC8A 3GG6A 1VHZA 3O69A 3KVHA 3SONA 5DDGA 2GT2A 2I8TA 3RH7A 3GZ5A 3FJYA 4N1UA 5FSIA 5BONA 2G74A 1MK1A 1VC9A 2GT4A 1MP2A 4NFWA 3MDGA 2A8PA 1V8YA 1K2EA 2RRKA 1V8TA 2YVOA 3H95A 2ICKA 4N1TA 2B2KA 4S2VA 4S2XA 2B0VA 2J8QA 3GWYA 2DHOA 2KDVA 1MR2A 3Q93A 2QJTA 1PUSA
chains in the Genus database with same CATH superfamily
5ANSA 2A8SA 2I6KA 1NFZA 5DD4A 4K6EA 1KT9A 1XSCA 5GHOA 3ZR1A 3GZ6A 3EF5A 2A8RA 2KDWA 1PPWA 1KTGA 4KG3A 1PPXA 3N77A 3Q4IA 1SJYA 4JZTA 2ICJA 5FSOA 3X0JA 3O6ZA 1I9AA 3O52A 5FSMA 4DYWA 1V8NA 3ZR0A 5GHIA 3OGAA 1X84A 1G9QA 5LPGA 2W4EA 3J7Ye 1JKNA 2QJOA 3FCMA 2JVBA 1X83A 4KG4A 4HVYA 3A6UA 1G0SA 5ANUA 5GHMA 4C9WA 2FKBA 1JRKA 3A6TA 1Q27A 5C7TA 2CZRA 4YPHA 1VHGA 3X0RA 1V8LA 3AC9A 5FSKA 3X0OA 2FVVA 5I8UA 1NQZA 3R03A 3X0QA 2YVPA 4C9XA 3Q1PA 5DPKA 4YPRA 2O5FA 2AZWA 4ICKA 5GHQA 3Q2SA 3G0QA 5IW5A 1VRLA 1R67A 5ISYA 1VIQA 3BAPA 3E57A 1MQWA 3P6YA 1GA7A 2A8QA 3DKUA 4KTBA 1V8UA 4V14A 5ANVA 3F6AA 5GHJA 3X0NA 5ANTA 3X0LA 3CNGA 2VNQA 3HYQA 1OW2A 1PUNA 1PPVA 4J7GA 4KYXA 4S2YA 4JZSA 1KHZA 1SOIA 3I7UA 3EXQA 1XSAA 2DSCA 1V8RA 4JZVA 4J7HA 4NFXA 2PNYA 3N9UA 3P5TA 4ILQA 3X0SA 1V8VA 1NQYA 1MUTA 2R5WA 3X0PA 2PQVA 5HZXA 2A8TA 3EESA 1RRQA 2A6TA 3SMDA 1MQEA 3GZ8A 3COUA 3L85A 5FSLA 2VNPA 3HHJA 1TUMA 2YVNA 4ZG0A 2DSDA 3O61A 1K26A 1RYAA 3Q91A 3I7VA 3ID9A 3BM4A 2FMLA 1V8IA 2B06A 5GHPA 2O1CA 3WHWA 3FSPA 1U20A 3O8SA 3U53A 3X0MA 3DUPA 1V8MA 2G73A 5C7QA 1HX3A 4JZUA 2I8UA 3ACAA 1Q33A 1NFSA 3EEUA 1X51A 2YVMA 1V8WA 5CFIA 1VIUA 1PUQA 2YYHA 3I9XA 5ANWA 4S2WA 1QVJA 3F13A 3QSJA 5BS6A 1VCDA 5IW4A 1HZTA 3A6SA 3MGMA 4MPOA 1IRYA 5C8LA 5DEQA 3Q2TA 4YOQA 3A6VA 5FSNA 3X0IA 4HFQA 2QKMB 2XSQA 3X0KA 2DSBA 1PVFA 3FK9A 4IJXA 2Q9PA 1V8SA 2GB5A 3SHDA 1VK6A 2O5WA 2CL3A 1F3YA 3MCFA 1RRSA 5GHNA 1SU2A 1XSBA 2DUKA 1Q54A 1SZ3A 3BHOA 3FFUA 3GRNA 5CFJA 3MDIA 1VC8A 3GG6A 1VHZA 3O69A 3KVHA 3SONA 5DDGA 2GT2A 2I8TA 3RH7A 3GZ5A 3FJYA 4N1UA 5FSIA 5BONA 2G74A 1MK1A 1VC9A 2GT4A 1MP2A 4NFWA 3MDGA 2A8PA 1V8YA 1K2EA 2RRKA 1V8TA 2YVOA 3H95A 2ICKA 4N1TA 2B2KA 4S2VA 4S2XA 2B0VA 2J8QA 3GWYA 2DHOA 2KDVA 1MR2A 3Q93A 2QJTA 1PUSA
chains in the Genus database with same CATH topology
5ANSA 2A8SA 2I6KA 1NFZA 5DD4A 4K6EA 1KT9A 1XSCA 5GHOA 3ZR1A 3GZ6A 3EF5A 2A8RA 2KDWA 1PPWA 1KTGA 4KG3A 1PPXA 3N77A 3Q4IA 1SJYA 4JZTA 2ICJA 5FSOA 3X0JA 3O6ZA 1I9AA 3O52A 5FSMA 4DYWA 1V8NA 3ZR0A 5GHIA 3OGAA 1X84A 1G9QA 5LPGA 2W4EA 3J7Ye 1JKNA 2QJOA 3FCMA 2JVBA 1X83A 4KG4A 4HVYA 3A6UA 1G0SA 5ANUA 5GHMA 4C9WA 2FKBA 1JRKA 3A6TA 1Q27A 5C7TA 2CZRA 4YPHA 1VHGA 3X0RA 1V8LA 3AC9A 5FSKA 3X0OA 2FVVA 5I8UA 1NQZA 3R03A 3X0QA 2YVPA 4C9XA 3Q1PA 5DPKA 4YPRA 2O5FA 2AZWA 4ICKA 5GHQA 3Q2SA 3G0QA 5IW5A 1VRLA 1R67A 5ISYA 1VIQA 3BAPA 3E57A 1MQWA 3P6YA 1GA7A 2A8QA 3DKUA 4KTBA 1V8UA 4V14A 5ANVA 3F6AA 5GHJA 3X0NA 5ANTA 3X0LA 3CNGA 2VNQA 3HYQA 1OW2A 1PUNA 1PPVA 4J7GA 4KYXA 4S2YA 4JZSA 1KHZA 1SOIA 3I7UA 3EXQA 1XSAA 2DSCA 1V8RA 4JZVA 4J7HA 4NFXA 2PNYA 3N9UA 3P5TA 4ILQA 3X0SA 1V8VA 1NQYA 1MUTA 2R5WA 3X0PA 2PQVA 5HZXA 2A8TA 3EESA 1RRQA 2A6TA 3SMDA 1MQEA 3GZ8A 3COUA 3L85A 5FSLA 2VNPA 3HHJA 1TUMA 2YVNA 4ZG0A 2DSDA 3O61A 1K26A 1RYAA 3Q91A 3I7VA 3ID9A 3BM4A 2FMLA 1V8IA 2B06A 5GHPA 2O1CA 3WHWA 3FSPA 1U20A 3O8SA 3U53A 3X0MA 3DUPA 1V8MA 2G73A 5C7QA 1HX3A 4JZUA 2I8UA 3ACAA 1Q33A 1NFSA 3EEUA 1X51A 2YVMA 1V8WA 5CFIA 1VIUA 1PUQA 2YYHA 3I9XA 5ANWA 4S2WA 1QVJA 3F13A 3QSJA 5BS6A 1VCDA 5IW4A 1HZTA 3A6SA 3MGMA 4MPOA 1IRYA 5C8LA 5DEQA 3Q2TA 4YOQA 3A6VA 5FSNA 3X0IA 4HFQA 2QKMB 2XSQA 3X0KA 2DSBA 1PVFA 3FK9A 4IJXA 2Q9PA 1V8SA 2GB5A 3SHDA 1VK6A 2O5WA 2CL3A 1F3YA 3MCFA 1RRSA 5GHNA 1SU2A 1XSBA 2DUKA 1Q54A 1SZ3A 3BHOA 3FFUA 3GRNA 5CFJA 3MDIA 1VC8A 3GG6A 1VHZA 3O69A 3KVHA 3SONA 5DDGA 2GT2A 2I8TA 3RH7A 3GZ5A 3FJYA 4N1UA 5FSIA 5BONA 2G74A 1MK1A 1VC9A 2GT4A 1MP2A 4NFWA 3MDGA 2A8PA 1V8YA 1K2EA 2RRKA 1V8TA 2YVOA 3H95A 2ICKA 4N1TA 2B2KA 4S2VA 4S2XA 2B0VA 2J8QA 3GWYA 2DHOA 2KDVA 1MR2A 3Q93A 2QJTA 1PUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ANS A;  2A8S A;  2I6K A;  1NFZ A;  5DD4 A;  4K6E A;  1KT9 A;  1XSC A;  5GHO A;  3ZR1 A;  3GZ6 A;  3EF5 A;  2A8R A;  2KDW A;  1PPW A;  1KTG A;  4KG3 A;  1PPX A;  3N77 A;  3Q4I A;  1SJY A;  4JZT A;  2ICJ A;  5FSO A;  3X0J A;  3O6Z A;  1I9A A;  3O52 A;  5FSM A;  4DYW A;  1V8N A;  3ZR0 A;  5GHI A;  3OGA A;  1X84 A;  1G9Q A;  5LPG A;  2W4E A;  3J7Y e;  1JKN A;  2QJO A;  3FCM A;  2JVB A;  1X83 A;  4KG4 A;  4HVY A;  3A6U A;  1G0S A;  5ANU A;  5GHM A;  4C9W A;  2FKB A;  1JRK A;  3A6T A;  1Q27 A;  5C7T A;  4YPH A;  1VHG A;  3X0R A;  1V8L A;  3AC9 A;  5FSK A;  3X0O A;  2FVV A;  5I8U A;  1NQZ A;  3R03 A;  3X0Q A;  2YVP A;  4C9X A;  3Q1P A;  5DPK A;  4YPR A;  2O5F A;  2AZW A;  4ICK A;  5GHQ A;  3Q2S A;  3G0Q A;  5IW5 A;  1VRL A;  1R67 A;  5ISY A;  1VIQ A;  3BAP A;  3E57 A;  1MQW A;  3P6Y A;  1GA7 A;  2A8Q A;  3DKU A;  4KTB A;  1V8U A;  4V14 A;  5ANV A;  3F6A A;  5GHJ A;  3X0N A;  5ANT A;  3X0L A;  3CNG A;  2VNQ A;  3HYQ A;  1OW2 A;  1PUN A;  1PPV A;  4KYX A;  4S2Y A;  4JZS A;  1KHZ A;  1SOI A;  3I7U A;  3EXQ A;  1XSA A;  2DSC A;  1V8R A;  4JZV A;  4NFX A;  2PNY A;  3N9U A;  3P5T A;  4ILQ A;  3X0S A;  1V8V A;  1NQY A;  1MUT A;  2R5W A;  3X0P A;  2PQV A;  5HZX A;  2A8T A;  3EES A;  1RRQ A;  2A6T A;  3SMD A;  1MQE A;  3GZ8 A;  3COU A;  3L85 A;  5FSL A;  2VNP A;  3HHJ A;  1TUM A;  2YVN A;  4ZG0 A;  2DSD A;  3O61 A;  1K26 A;  1RYA A;  3Q91 A;  3I7V A;  3ID9 A;  3BM4 A;  2FML A;  1V8I A;  2B06 A;  5GHP A;  2O1C A;  3WHW A;  3FSP A;  1U20 A;  3O8S A;  3U53 A;  3X0M A;  3DUP A;  1V8M A;  2G73 A;  5C7Q A;  1HX3 A;  4JZU A;  2I8U A;  3ACA A;  1Q33 A;  1NFS A;  3EEU A;  1X51 A;  2YVM A;  1V8W A;  5CFI A;  1VIU A;  1PUQ A;  2YYH A;  3I9X A;  5ANW A;  4S2W A;  1QVJ A;  3F13 A;  3QSJ A;  5BS6 A;  1VCD A;  5IW4 A;  1HZT A;  3A6S A;  3MGM A;  4MPO A;  1IRY A;  5C8L A;  5DEQ A;  3Q2T A;  4YOQ A;  3A6V A;  5FSN A;  3X0I A;  4HFQ A;  2QKM B;  2XSQ A;  3X0K A;  2DSB A;  1PVF A;  3FK9 A;  4IJX A;  2Q9P A;  1V8S A;  2GB5 A;  3SHD A;  1VK6 A;  2O5W A;  2CL3 A;  1F3Y A;  3MCF A;  1RRS A;  5GHN A;  1SU2 A;  1XSB A;  2DUK A;  1Q54 A;  1SZ3 A;  3BHO A;  3FFU A;  3GRN A;  5CFJ A;  3MDI A;  1VC8 A;  3GG6 A;  1VHZ A;  3O69 A;  3KVH A;  3SON A;  5DDG A;  2GT2 A;  2I8T A;  3RH7 A;  3GZ5 A;  3FJY A;  4N1U A;  5FSI A;  5BON A;  2G74 A;  1MK1 A;  1VC9 A;  2GT4 A;  1MP2 A;  4NFW A;  3MDG A;  2A8P A;  1V8Y A;  1K2E A;  2RRK A;  1V8T A;  2YVO A;  3H95 A;  2ICK A;  4N1T A;  2B2K A;  4S2V A;  4S2X A;  2B0V A;  2J8Q A;  3GWY A;  2DHO A;  2KDV A;  1MR2 A;  3Q93 A;  2QJT A;  1PUS A; 
#chains in the Genus database with same CATH topology
 5ANS A;  2A8S A;  2I6K A;  1NFZ A;  5DD4 A;  4K6E A;  1KT9 A;  1XSC A;  5GHO A;  3ZR1 A;  3GZ6 A;  3EF5 A;  2A8R A;  2KDW A;  1PPW A;  1KTG A;  4KG3 A;  1PPX A;  3N77 A;  3Q4I A;  1SJY A;  4JZT A;  2ICJ A;  5FSO A;  3X0J A;  3O6Z A;  1I9A A;  3O52 A;  5FSM A;  4DYW A;  1V8N A;  3ZR0 A;  5GHI A;  3OGA A;  1X84 A;  1G9Q A;  5LPG A;  2W4E A;  3J7Y e;  1JKN A;  2QJO A;  3FCM A;  2JVB A;  1X83 A;  4KG4 A;  4HVY A;  3A6U A;  1G0S A;  5ANU A;  5GHM A;  4C9W A;  2FKB A;  1JRK A;  3A6T A;  1Q27 A;  5C7T A;  2CZR A;  4YPH A;  1VHG A;  3X0R A;  1V8L A;  3AC9 A;  5FSK A;  3X0O A;  2FVV A;  5I8U A;  1NQZ A;  3R03 A;  3X0Q A;  2YVP A;  4C9X A;  3Q1P A;  5DPK A;  4YPR A;  2O5F A;  2AZW A;  4ICK A;  5GHQ A;  3Q2S A;  3G0Q A;  5IW5 A;  1VRL A;  1R67 A;  5ISY A;  1VIQ A;  3BAP A;  3E57 A;  1MQW A;  3P6Y A;  1GA7 A;  2A8Q A;  3DKU A;  4KTB A;  1V8U A;  4V14 A;  5ANV A;  3F6A A;  5GHJ A;  3X0N A;  5ANT A;  3X0L A;  3CNG A;  2VNQ A;  3HYQ A;  1OW2 A;  1PUN A;  1PPV A;  4J7G A;  4KYX A;  4S2Y A;  4JZS A;  1KHZ A;  1SOI A;  3I7U A;  3EXQ A;  1XSA A;  2DSC A;  1V8R A;  4JZV A;  4J7H A;  4NFX A;  2PNY A;  3N9U A;  3P5T A;  4ILQ A;  3X0S A;  1V8V A;  1NQY A;  1MUT A;  2R5W A;  3X0P A;  2PQV A;  5HZX A;  2A8T A;  3EES A;  1RRQ A;  2A6T A;  3SMD A;  1MQE A;  3GZ8 A;  3COU A;  3L85 A;  5FSL A;  2VNP A;  3HHJ A;  1TUM A;  2YVN A;  4ZG0 A;  2DSD A;  3O61 A;  1K26 A;  1RYA A;  3Q91 A;  3I7V A;  3ID9 A;  3BM4 A;  2FML A;  1V8I A;  2B06 A;  5GHP A;  2O1C A;  3WHW A;  3FSP A;  1U20 A;  3O8S A;  3U53 A;  3X0M A;  3DUP A;  1V8M A;  2G73 A;  5C7Q A;  1HX3 A;  4JZU A;  2I8U A;  3ACA A;  1Q33 A;  1NFS A;  3EEU A;  1X51 A;  2YVM A;  1V8W A;  5CFI A;  1VIU A;  1PUQ A;  2YYH A;  3I9X A;  5ANW A;  4S2W A;  1QVJ A;  3F13 A;  3QSJ A;  5BS6 A;  1VCD A;  5IW4 A;  1HZT A;  3A6S A;  3MGM A;  4MPO A;  1IRY A;  5C8L A;  5DEQ A;  3Q2T A;  4YOQ A;  3A6V A;  5FSN A;  3X0I A;  4HFQ A;  2QKM B;  2XSQ A;  3X0K A;  2DSB A;  1PVF A;  3FK9 A;  4IJX A;  2Q9P A;  1V8S A;  2GB5 A;  3SHD A;  1VK6 A;  2O5W A;  2CL3 A;  1F3Y A;  3MCF A;  1RRS A;  5GHN A;  1SU2 A;  1XSB A;  2DUK A;  1Q54 A;  1SZ3 A;  3BHO A;  3FFU A;  3GRN A;  5CFJ A;  3MDI A;  1VC8 A;  3GG6 A;  1VHZ A;  3O69 A;  3KVH A;  3SON A;  5DDG A;  2GT2 A;  2I8T A;  3RH7 A;  3GZ5 A;  3FJY A;  4N1U A;  5FSI A;  5BON A;  2G74 A;  1MK1 A;  1VC9 A;  2GT4 A;  1MP2 A;  4NFW A;  3MDG A;  2A8P A;  1V8Y A;  1K2E A;  2RRK A;  1V8T A;  2YVO A;  3H95 A;  2ICK A;  4N1T A;  2B2K A;  4S2V A;  4S2X A;  2B0V A;  2J8Q A;  3GWY A;  2DHO A;  2KDV A;  1MR2 A;  3Q93 A;  2QJT A;  1PUS A; 
#chains in the Genus database with same CATH homology
 5ANS A;  2A8S A;  2I6K A;  1NFZ A;  5DD4 A;  4K6E A;  1KT9 A;  1XSC A;  5GHO A;  3ZR1 A;  3GZ6 A;  3EF5 A;  2A8R A;  2KDW A;  1PPW A;  1KTG A;  4KG3 A;  1PPX A;  3N77 A;  3Q4I A;  1SJY A;  4JZT A;  2ICJ A;  5FSO A;  3X0J A;  3O6Z A;  1I9A A;  3O52 A;  5FSM A;  4DYW A;  1V8N A;  3ZR0 A;  5GHI A;  3OGA A;  1X84 A;  1G9Q A;  5LPG A;  2W4E A;  3J7Y e;  1JKN A;  2QJO A;  3FCM A;  2JVB A;  1X83 A;  4KG4 A;  4HVY A;  3A6U A;  1G0S A;  5ANU A;  5GHM A;  4C9W A;  2FKB A;  1JRK A;  3A6T A;  1Q27 A;  5C7T A;  2CZR A;  4YPH A;  1VHG A;  3X0R A;  1V8L A;  3AC9 A;  5FSK A;  3X0O A;  2FVV A;  5I8U A;  1NQZ A;  3R03 A;  3X0Q A;  2YVP A;  4C9X A;  3Q1P A;  5DPK A;  4YPR A;  2O5F A;  2AZW A;  4ICK A;  5GHQ A;  3Q2S A;  3G0Q A;  5IW5 A;  1VRL A;  1R67 A;  5ISY A;  1VIQ A;  3BAP A;  3E57 A;  1MQW A;  3P6Y A;  1GA7 A;  2A8Q A;  3DKU A;  4KTB A;  1V8U A;  4V14 A;  5ANV A;  3F6A A;  5GHJ A;  3X0N A;  5ANT A;  3X0L A;  3CNG A;  2VNQ A;  3HYQ A;  1OW2 A;  1PUN A;  1PPV A;  4J7G A;  4KYX A;  4S2Y A;  4JZS A;  1KHZ A;  1SOI A;  3I7U A;  3EXQ A;  1XSA A;  2DSC A;  1V8R A;  4JZV A;  4J7H A;  4NFX A;  2PNY A;  3N9U A;  3P5T A;  4ILQ A;  3X0S A;  1V8V A;  1NQY A;  1MUT A;  2R5W A;  3X0P A;  2PQV A;  5HZX A;  2A8T A;  3EES A;  1RRQ A;  2A6T A;  3SMD A;  1MQE A;  3GZ8 A;  3COU A;  3L85 A;  5FSL A;  2VNP A;  3HHJ A;  1TUM A;  2YVN A;  4ZG0 A;  2DSD A;  3O61 A;  1K26 A;  1RYA A;  3Q91 A;  3I7V A;  3ID9 A;  3BM4 A;  2FML A;  1V8I A;  2B06 A;  5GHP A;  2O1C A;  3WHW A;  3FSP A;  1U20 A;  3O8S A;  3U53 A;  3X0M A;  3DUP A;  1V8M A;  2G73 A;  5C7Q A;  1HX3 A;  4JZU A;  2I8U A;  3ACA A;  1Q33 A;  1NFS A;  3EEU A;  1X51 A;  2YVM A;  1V8W A;  5CFI A;  1VIU A;  1PUQ A;  2YYH A;  3I9X A;  5ANW A;  4S2W A;  1QVJ A;  3F13 A;  3QSJ A;  5BS6 A;  1VCD A;  5IW4 A;  1HZT A;  3A6S A;  3MGM A;  4MPO A;  1IRY A;  5C8L A;  5DEQ A;  3Q2T A;  4YOQ A;  3A6V A;  5FSN A;  3X0I A;  4HFQ A;  2QKM B;  2XSQ A;  3X0K A;  2DSB A;  1PVF A;  3FK9 A;  4IJX A;  2Q9P A;  1V8S A;  2GB5 A;  3SHD A;  1VK6 A;  2O5W A;  2CL3 A;  1F3Y A;  3MCF A;  1RRS A;  5GHN A;  1SU2 A;  1XSB A;  2DUK A;  1Q54 A;  1SZ3 A;  3BHO A;  3FFU A;  3GRN A;  5CFJ A;  3MDI A;  1VC8 A;  3GG6 A;  1VHZ A;  3O69 A;  3KVH A;  3SON A;  5DDG A;  2GT2 A;  2I8T A;  3RH7 A;  3GZ5 A;  3FJY A;  4N1U A;  5FSI A;  5BON A;  2G74 A;  1MK1 A;  1VC9 A;  2GT4 A;  1MP2 A;  4NFW A;  3MDG A;  2A8P A;  1V8Y A;  1K2E A;  2RRK A;  1V8T A;  2YVO A;  3H95 A;  2ICK A;  4N1T A;  2B2K A;  4S2V A;  4S2X A;  2B0V A;  2J8Q A;  3GWY A;  2DHO A;  2KDV A;  1MR2 A;  3Q93 A;  2QJT A;  1PUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...