3EEUA

Structure of the rna pyrophosphohydrolase bdrpph in complex with holmium
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
133
structure length
133
Chain Sequence
KGHWIPVVAGFLRKDGKILVGQRPENNSLAGQWEFPGGKIENGETPEEALARELNEELGIEAEVGELKLACTHSYGDVGILILFYEILYWKGEPRAKHHMMLEWIHPEELKHRNIPEANRKILHKIYKALGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable pyrophosphohydrolase
publication title Structure and Biological Function of the RNA Pyrophosphohydrolase BdRppH from Bdellovibrio bacteriovorus.
pubmed doi rcsb
source organism Bdellovibrio bacteriovorus
molecule tags Hydrolase
total genus 31
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 3.6.1.-:
pdb deposition date 2008-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14815 NUDIX_4 NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3eeuA00
3X0OA 2YVMA 1QVJA 3FK9A 3X0IA 5C7QA 3BHOA 2A8TA 1HZTA 1Q27A 2DHOA 2GB5A 1V8YA 2ICJA 3GZ8A 1RRSA 3O61A 1PPVA 4JZTA 1MQEA 1G0SA 2A8QA 3HHJA 3A6TA 3ACAA 5HZXA 5GHJA 3X0RA 3R03A 1PUSA 4KYXA 3SHDA 3EF5A 2A6TA 2AZWA 2A8RA 3O69A 5ANSA 3X0JA 2QJOA 1NFZA 4S2VA 5BONA 1F3YA 3DKUA 2FVVA 3O6ZA 1NQYA 2YVOA 2VNPA 5FSLA 3Q91A 3FFUA 3EXQA 5GHNA 3J7Ye 4NFWA 2QJTA 4JZUA 2I8UA 3X0SA 5DDGA 1V8UA 3A6VA 5DD4A 5ANTA 4ZG0A 3O52A 2R5WA 1U20A 2GT4A 5LPGA 3A6UA 4C9WA 2DSBA 5FSOA 3GG6A 4HVYA 1PUQA 2XSQA 1X83A 2GT2A 3Q1PA 1OW2A 2DSCA 3RH7A 1V8NA 3ZR1A 1PUNA 5ANWA 3I9XA 5C7TA 2FMLA 1VHGA 4N1TA 1X51A 2KDWA 4NFXA 2FKBA 2I6KA 4KG4A 1TUMA 5FSNA 3MGMA 3X0LA 3A6SA 2VNQA 4N1UA 3U53A 5ANVA 3WHWA 1G9QA 1I9AA 1VC9A 3BAPA 5BS6A 2A8SA 3X0QA 3GZ6A 2CL3A 1MR2A 4ICKA 3X0PA 4YPHA 1RYAA 1JRKA 1KT9A 2YVNA 4JZSA 2PNYA 5GHIA 3KVHA 3Q2TA 5FSIA 1RRQA 4K6EA 3Q93A 2YVPA 1VC8A 3L85A 1HX3A 5FSMA 2J8QA 5ISYA 5I8UA 1JKNA 3X0KA 3GRNA 5GHPA 1MUTA 2B2KA 2I8TA 2QKMB 1V8TA 4V14A 4DYWA 1V8IA 1X84A 2A8PA 3I7VA 1V8VA 3O8SA 5DEQA 3X0MA 2YYHA 5CFJA 3N77A 5GHOA 2G73A 1VRLA 4HFQA 3OGAA 5IW5A 1VHZA 1XSCA 3E57A 1Q54A 1MP2A 2O5FA 3BM4A 1VCDA 3P6YA 4ILQA 4KTBA 4KG3A 5C8LA 2B06A 3F13A 3SONA 4JZVA 1K26A 5IW4A 3AC9A 2ICKA 1R67A 1PVFA 3FJYA 3X0NA 3ZR0A 3H95A 1IRYA 1GA7A 1Q33A 5GHMA 1KTGA 2DUKA 2Q9PA 3Q2SA 4YOQA 3EEUA 3MDIA 3MCFA 5GHQA 4S2YA 2KDVA 1K2EA 1SOIA 1V8LA 1PPXA 3Q4IA 1V8SA 3N9UA 1NFSA 5DPKA 1NQZA 4MPOA 1SZ3A 1KHZA 2DSDA 2JVBA 2PQVA 3ID9A 3SMDA 3CNGA 5ANUA 4S2XA 1VIUA 4IJXA 3MDGA 2W4EA 3GWYA 3GZ5A 5CFIA 4C9XA 1MK1A 3HYQA 1SJYA 3G0QA 1SU2A 5FSKA 1VIQA 2B0VA 2G74A 3FCMA 3DUPA 3P5TA 1MQWA 3FSPA 1PPWA 1V8MA 3COUA 1V8WA 1XSAA 1XSBA 1VK6A 3I7UA 2RRKA 4YPRA 3QSJA 3EESA 4S2WA 2O5WA 1V8RA 2O1CA 3F6AA
chains in the Genus database with same CATH superfamily
3X0OA 2YVMA 1QVJA 3FK9A 3X0IA 5C7QA 3BHOA 2A8TA 1HZTA 1Q27A 2DHOA 2GB5A 1V8YA 2ICJA 3GZ8A 1RRSA 3O61A 1PPVA 4JZTA 1MQEA 1G0SA 2A8QA 3HHJA 3A6TA 3ACAA 5HZXA 5GHJA 3X0RA 3R03A 1PUSA 4KYXA 3SHDA 3EF5A 2A6TA 2AZWA 2A8RA 3O69A 5ANSA 3X0JA 2QJOA 1NFZA 4S2VA 5BONA 4J7HA 1F3YA 3DKUA 2FVVA 3O6ZA 1NQYA 2YVOA 2VNPA 5FSLA 3Q91A 3FFUA 3EXQA 5GHNA 3J7Ye 4NFWA 2QJTA 4J7GA 4JZUA 2I8UA 3X0SA 5DDGA 1V8UA 3A6VA 5DD4A 5ANTA 4ZG0A 3O52A 2R5WA 1U20A 2GT4A 5LPGA 3A6UA 4C9WA 2DSBA 5FSOA 3GG6A 4HVYA 1PUQA 2XSQA 1X83A 2GT2A 3Q1PA 1OW2A 2DSCA 3RH7A 1V8NA 3ZR1A 1PUNA 5ANWA 3I9XA 5C7TA 2FMLA 1VHGA 4N1TA 1X51A 2KDWA 4NFXA 2FKBA 2I6KA 4KG4A 1TUMA 5FSNA 3MGMA 3X0LA 3A6SA 2VNQA 4N1UA 3U53A 5ANVA 3WHWA 1G9QA 1I9AA 1VC9A 3BAPA 5BS6A 2A8SA 3X0QA 3GZ6A 2CL3A 1MR2A 4ICKA 3X0PA 4YPHA 1RYAA 1JRKA 1KT9A 2YVNA 4JZSA 2PNYA 5GHIA 3KVHA 3Q2TA 5FSIA 1RRQA 4K6EA 3Q93A 2YVPA 1VC8A 3L85A 1HX3A 5FSMA 2J8QA 5ISYA 5I8UA 1JKNA 3X0KA 3GRNA 5GHPA 1MUTA 2B2KA 2I8TA 2QKMB 1V8TA 4V14A 4DYWA 1V8IA 1X84A 2A8PA 3I7VA 1V8VA 3O8SA 5DEQA 3X0MA 2YYHA 5CFJA 3N77A 5GHOA 2G73A 1VRLA 4HFQA 3OGAA 5IW5A 1VHZA 1XSCA 3E57A 1Q54A 1MP2A 2O5FA 3BM4A 1VCDA 3P6YA 4ILQA 4KTBA 4KG3A 5C8LA 2B06A 3F13A 3SONA 4JZVA 1K26A 5IW4A 3AC9A 2ICKA 1R67A 1PVFA 3FJYA 3X0NA 3ZR0A 3H95A 1IRYA 1GA7A 1Q33A 5GHMA 1KTGA 2DUKA 2Q9PA 3Q2SA 4YOQA 3EEUA 3MDIA 3MCFA 5GHQA 4S2YA 2KDVA 1K2EA 1SOIA 1V8LA 1PPXA 3Q4IA 1V8SA 3N9UA 1NFSA 5DPKA 1NQZA 4MPOA 1SZ3A 1KHZA 2DSDA 2JVBA 2PQVA 3ID9A 3SMDA 3CNGA 5ANUA 4S2XA 1VIUA 4IJXA 3MDGA 2W4EA 3GWYA 3GZ5A 5CFIA 4C9XA 1MK1A 3HYQA 1SJYA 3G0QA 1SU2A 5FSKA 1VIQA 2B0VA 2G74A 3FCMA 3DUPA 3P5TA 1MQWA 3FSPA 1PPWA 1V8MA 3COUA 1V8WA 1XSAA 1XSBA 1VK6A 3I7UA 2RRKA 2CZRA 4YPRA 3QSJA 3EESA 4S2WA 2O5WA 1V8RA 2O1CA 3F6AA
chains in the Genus database with same CATH topology
3X0OA 2YVMA 1QVJA 3FK9A 3X0IA 5C7QA 3BHOA 2A8TA 1HZTA 1Q27A 2DHOA 2GB5A 1V8YA 2ICJA 3GZ8A 1RRSA 3O61A 1PPVA 4JZTA 1MQEA 1G0SA 2A8QA 3HHJA 3A6TA 3ACAA 5HZXA 5GHJA 3X0RA 3R03A 1PUSA 4KYXA 3SHDA 3EF5A 2A6TA 2AZWA 2A8RA 3O69A 5ANSA 3X0JA 2QJOA 1NFZA 4S2VA 5BONA 4J7HA 1F3YA 3DKUA 2FVVA 3O6ZA 1NQYA 2YVOA 2VNPA 5FSLA 3Q91A 3FFUA 3EXQA 5GHNA 3J7Ye 4NFWA 2QJTA 4J7GA 4JZUA 2I8UA 3X0SA 5DDGA 1V8UA 3A6VA 5DD4A 5ANTA 4ZG0A 3O52A 2R5WA 1U20A 2GT4A 5LPGA 3A6UA 4C9WA 2DSBA 5FSOA 3GG6A 4HVYA 1PUQA 2XSQA 1X83A 2GT2A 3Q1PA 1OW2A 2DSCA 3RH7A 1V8NA 3ZR1A 1PUNA 5ANWA 3I9XA 5C7TA 2FMLA 1VHGA 4N1TA 1X51A 2KDWA 4NFXA 2FKBA 2I6KA 4KG4A 1TUMA 5FSNA 3MGMA 3X0LA 3A6SA 2VNQA 4N1UA 3U53A 5ANVA 3WHWA 1G9QA 1I9AA 1VC9A 3BAPA 5BS6A 2A8SA 3X0QA 3GZ6A 2CL3A 1MR2A 4ICKA 3X0PA 4YPHA 1RYAA 1JRKA 1KT9A 2YVNA 4JZSA 2PNYA 5GHIA 3KVHA 3Q2TA 5FSIA 1RRQA 4K6EA 3Q93A 2YVPA 1VC8A 3L85A 1HX3A 5FSMA 2J8QA 5ISYA 5I8UA 1JKNA 3X0KA 3GRNA 5GHPA 1MUTA 2B2KA 2I8TA 2QKMB 1V8TA 4V14A 4DYWA 1V8IA 1X84A 2A8PA 3I7VA 1V8VA 3O8SA 5DEQA 3X0MA 2YYHA 5CFJA 3N77A 5GHOA 2G73A 1VRLA 4HFQA 3OGAA 5IW5A 1VHZA 1XSCA 3E57A 1Q54A 1MP2A 2O5FA 3BM4A 1VCDA 3P6YA 4ILQA 4KTBA 4KG3A 5C8LA 2B06A 3F13A 3SONA 4JZVA 1K26A 5IW4A 3AC9A 2ICKA 1R67A 1PVFA 3FJYA 3X0NA 3ZR0A 3H95A 1IRYA 1GA7A 1Q33A 5GHMA 1KTGA 2DUKA 2Q9PA 3Q2SA 4YOQA 3EEUA 3MDIA 3MCFA 5GHQA 4S2YA 2KDVA 1K2EA 1SOIA 1V8LA 1PPXA 3Q4IA 1V8SA 3N9UA 1NFSA 5DPKA 1NQZA 4MPOA 1SZ3A 1KHZA 2DSDA 2JVBA 2PQVA 3ID9A 3SMDA 3CNGA 5ANUA 4S2XA 1VIUA 4IJXA 3MDGA 2W4EA 3GWYA 3GZ5A 5CFIA 4C9XA 1MK1A 3HYQA 1SJYA 3G0QA 1SU2A 5FSKA 1VIQA 2B0VA 2G74A 3FCMA 3DUPA 3P5TA 1MQWA 3FSPA 1PPWA 1V8MA 3COUA 1V8WA 1XSAA 1XSBA 1VK6A 3I7UA 2RRKA 2CZRA 4YPRA 3QSJA 3EESA 4S2WA 2O5WA 1V8RA 2O1CA 3F6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X0O A;  2YVM A;  1QVJ A;  3FK9 A;  3X0I A;  5C7Q A;  3BHO A;  2A8T A;  1HZT A;  1Q27 A;  2DHO A;  2GB5 A;  1V8Y A;  2ICJ A;  3GZ8 A;  1RRS A;  3O61 A;  1PPV A;  4JZT A;  1MQE A;  1G0S A;  2A8Q A;  3HHJ A;  3A6T A;  3ACA A;  5HZX A;  5GHJ A;  3X0R A;  3R03 A;  1PUS A;  4KYX A;  3SHD A;  3EF5 A;  2A6T A;  2AZW A;  2A8R A;  3O69 A;  5ANS A;  3X0J A;  2QJO A;  1NFZ A;  4S2V A;  5BON A;  1F3Y A;  3DKU A;  2FVV A;  3O6Z A;  1NQY A;  2YVO A;  2VNP A;  5FSL A;  3Q91 A;  3FFU A;  3EXQ A;  5GHN A;  3J7Y e;  4NFW A;  2QJT A;  4JZU A;  2I8U A;  3X0S A;  5DDG A;  1V8U A;  3A6V A;  5DD4 A;  5ANT A;  4ZG0 A;  3O52 A;  2R5W A;  1U20 A;  2GT4 A;  5LPG A;  3A6U A;  4C9W A;  2DSB A;  5FSO A;  3GG6 A;  4HVY A;  1PUQ A;  2XSQ A;  1X83 A;  2GT2 A;  3Q1P A;  1OW2 A;  2DSC A;  3RH7 A;  1V8N A;  3ZR1 A;  1PUN A;  5ANW A;  3I9X A;  5C7T A;  2FML A;  1VHG A;  4N1T A;  1X51 A;  2KDW A;  4NFX A;  2FKB A;  2I6K A;  4KG4 A;  1TUM A;  5FSN A;  3MGM A;  3X0L A;  3A6S A;  2VNQ A;  4N1U A;  3U53 A;  5ANV A;  3WHW A;  1G9Q A;  1I9A A;  1VC9 A;  3BAP A;  5BS6 A;  2A8S A;  3X0Q A;  3GZ6 A;  2CL3 A;  1MR2 A;  4ICK A;  3X0P A;  4YPH A;  1RYA A;  1JRK A;  1KT9 A;  2YVN A;  4JZS A;  2PNY A;  5GHI A;  3KVH A;  3Q2T A;  5FSI A;  1RRQ A;  4K6E A;  3Q93 A;  2YVP A;  1VC8 A;  3L85 A;  1HX3 A;  5FSM A;  2J8Q A;  5ISY A;  5I8U A;  1JKN A;  3X0K A;  3GRN A;  5GHP A;  1MUT A;  2B2K A;  2I8T A;  2QKM B;  1V8T A;  4V14 A;  4DYW A;  1V8I A;  1X84 A;  2A8P A;  3I7V A;  1V8V A;  3O8S A;  5DEQ A;  3X0M A;  2YYH A;  5CFJ A;  3N77 A;  5GHO A;  2G73 A;  1VRL A;  4HFQ A;  3OGA A;  5IW5 A;  1VHZ A;  1XSC A;  3E57 A;  1Q54 A;  1MP2 A;  2O5F A;  3BM4 A;  1VCD A;  3P6Y A;  4ILQ A;  4KTB A;  4KG3 A;  5C8L A;  2B06 A;  3F13 A;  3SON A;  4JZV A;  1K26 A;  5IW4 A;  3AC9 A;  2ICK A;  1R67 A;  1PVF A;  3FJY A;  3X0N A;  3ZR0 A;  3H95 A;  1IRY A;  1GA7 A;  1Q33 A;  5GHM A;  1KTG A;  2DUK A;  2Q9P A;  3Q2S A;  4YOQ A;  3EEU A;  3MDI A;  3MCF A;  5GHQ A;  4S2Y A;  2KDV A;  1K2E A;  1SOI A;  1V8L A;  1PPX A;  3Q4I A;  1V8S A;  3N9U A;  1NFS A;  5DPK A;  1NQZ A;  4MPO A;  1SZ3 A;  1KHZ A;  2DSD A;  2JVB A;  2PQV A;  3ID9 A;  3SMD A;  3CNG A;  5ANU A;  4S2X A;  1VIU A;  4IJX A;  3MDG A;  2W4E A;  3GWY A;  3GZ5 A;  5CFI A;  4C9X A;  1MK1 A;  3HYQ A;  1SJY A;  3G0Q A;  1SU2 A;  5FSK A;  1VIQ A;  2B0V A;  2G74 A;  3FCM A;  3DUP A;  3P5T A;  1MQW A;  3FSP A;  1PPW A;  1V8M A;  3COU A;  1V8W A;  1XSA A;  1XSB A;  1VK6 A;  3I7U A;  2RRK A;  4YPR A;  3QSJ A;  3EES A;  4S2W A;  2O5W A;  1V8R A;  2O1C A;  3F6A A; 
#chains in the Genus database with same CATH topology
 3X0O A;  2YVM A;  1QVJ A;  3FK9 A;  3X0I A;  5C7Q A;  3BHO A;  2A8T A;  1HZT A;  1Q27 A;  2DHO A;  2GB5 A;  1V8Y A;  2ICJ A;  3GZ8 A;  1RRS A;  3O61 A;  1PPV A;  4JZT A;  1MQE A;  1G0S A;  2A8Q A;  3HHJ A;  3A6T A;  3ACA A;  5HZX A;  5GHJ A;  3X0R A;  3R03 A;  1PUS A;  4KYX A;  3SHD A;  3EF5 A;  2A6T A;  2AZW A;  2A8R A;  3O69 A;  5ANS A;  3X0J A;  2QJO A;  1NFZ A;  4S2V A;  5BON A;  4J7H A;  1F3Y A;  3DKU A;  2FVV A;  3O6Z A;  1NQY A;  2YVO A;  2VNP A;  5FSL A;  3Q91 A;  3FFU A;  3EXQ A;  5GHN A;  3J7Y e;  4NFW A;  2QJT A;  4J7G A;  4JZU A;  2I8U A;  3X0S A;  5DDG A;  1V8U A;  3A6V A;  5DD4 A;  5ANT A;  4ZG0 A;  3O52 A;  2R5W A;  1U20 A;  2GT4 A;  5LPG A;  3A6U A;  4C9W A;  2DSB A;  5FSO A;  3GG6 A;  4HVY A;  1PUQ A;  2XSQ A;  1X83 A;  2GT2 A;  3Q1P A;  1OW2 A;  2DSC A;  3RH7 A;  1V8N A;  3ZR1 A;  1PUN A;  5ANW A;  3I9X A;  5C7T A;  2FML A;  1VHG A;  4N1T A;  1X51 A;  2KDW A;  4NFX A;  2FKB A;  2I6K A;  4KG4 A;  1TUM A;  5FSN A;  3MGM A;  3X0L A;  3A6S A;  2VNQ A;  4N1U A;  3U53 A;  5ANV A;  3WHW A;  1G9Q A;  1I9A A;  1VC9 A;  3BAP A;  5BS6 A;  2A8S A;  3X0Q A;  3GZ6 A;  2CL3 A;  1MR2 A;  4ICK A;  3X0P A;  4YPH A;  1RYA A;  1JRK A;  1KT9 A;  2YVN A;  4JZS A;  2PNY A;  5GHI A;  3KVH A;  3Q2T A;  5FSI A;  1RRQ A;  4K6E A;  3Q93 A;  2YVP A;  1VC8 A;  3L85 A;  1HX3 A;  5FSM A;  2J8Q A;  5ISY A;  5I8U A;  1JKN A;  3X0K A;  3GRN A;  5GHP A;  1MUT A;  2B2K A;  2I8T A;  2QKM B;  1V8T A;  4V14 A;  4DYW A;  1V8I A;  1X84 A;  2A8P A;  3I7V A;  1V8V A;  3O8S A;  5DEQ A;  3X0M A;  2YYH A;  5CFJ A;  3N77 A;  5GHO A;  2G73 A;  1VRL A;  4HFQ A;  3OGA A;  5IW5 A;  1VHZ A;  1XSC A;  3E57 A;  1Q54 A;  1MP2 A;  2O5F A;  3BM4 A;  1VCD A;  3P6Y A;  4ILQ A;  4KTB A;  4KG3 A;  5C8L A;  2B06 A;  3F13 A;  3SON A;  4JZV A;  1K26 A;  5IW4 A;  3AC9 A;  2ICK A;  1R67 A;  1PVF A;  3FJY A;  3X0N A;  3ZR0 A;  3H95 A;  1IRY A;  1GA7 A;  1Q33 A;  5GHM A;  1KTG A;  2DUK A;  2Q9P A;  3Q2S A;  4YOQ A;  3EEU A;  3MDI A;  3MCF A;  5GHQ A;  4S2Y A;  2KDV A;  1K2E A;  1SOI A;  1V8L A;  1PPX A;  3Q4I A;  1V8S A;  3N9U A;  1NFS A;  5DPK A;  1NQZ A;  4MPO A;  1SZ3 A;  1KHZ A;  2DSD A;  2JVB A;  2PQV A;  3ID9 A;  3SMD A;  3CNG A;  5ANU A;  4S2X A;  1VIU A;  4IJX A;  3MDG A;  2W4E A;  3GWY A;  3GZ5 A;  5CFI A;  4C9X A;  1MK1 A;  3HYQ A;  1SJY A;  3G0Q A;  1SU2 A;  5FSK A;  1VIQ A;  2B0V A;  2G74 A;  3FCM A;  3DUP A;  3P5T A;  1MQW A;  3FSP A;  1PPW A;  1V8M A;  3COU A;  1V8W A;  1XSA A;  1XSB A;  1VK6 A;  3I7U A;  2RRK A;  2CZR A;  4YPR A;  3QSJ A;  3EES A;  4S2W A;  2O5W A;  1V8R A;  2O1C A;  3F6A A; 
#chains in the Genus database with same CATH homology
 3X0O A;  2YVM A;  1QVJ A;  3FK9 A;  3X0I A;  5C7Q A;  3BHO A;  2A8T A;  1HZT A;  1Q27 A;  2DHO A;  2GB5 A;  1V8Y A;  2ICJ A;  3GZ8 A;  1RRS A;  3O61 A;  1PPV A;  4JZT A;  1MQE A;  1G0S A;  2A8Q A;  3HHJ A;  3A6T A;  3ACA A;  5HZX A;  5GHJ A;  3X0R A;  3R03 A;  1PUS A;  4KYX A;  3SHD A;  3EF5 A;  2A6T A;  2AZW A;  2A8R A;  3O69 A;  5ANS A;  3X0J A;  2QJO A;  1NFZ A;  4S2V A;  5BON A;  4J7H A;  1F3Y A;  3DKU A;  2FVV A;  3O6Z A;  1NQY A;  2YVO A;  2VNP A;  5FSL A;  3Q91 A;  3FFU A;  3EXQ A;  5GHN A;  3J7Y e;  4NFW A;  2QJT A;  4J7G A;  4JZU A;  2I8U A;  3X0S A;  5DDG A;  1V8U A;  3A6V A;  5DD4 A;  5ANT A;  4ZG0 A;  3O52 A;  2R5W A;  1U20 A;  2GT4 A;  5LPG A;  3A6U A;  4C9W A;  2DSB A;  5FSO A;  3GG6 A;  4HVY A;  1PUQ A;  2XSQ A;  1X83 A;  2GT2 A;  3Q1P A;  1OW2 A;  2DSC A;  3RH7 A;  1V8N A;  3ZR1 A;  1PUN A;  5ANW A;  3I9X A;  5C7T A;  2FML A;  1VHG A;  4N1T A;  1X51 A;  2KDW A;  4NFX A;  2FKB A;  2I6K A;  4KG4 A;  1TUM A;  5FSN A;  3MGM A;  3X0L A;  3A6S A;  2VNQ A;  4N1U A;  3U53 A;  5ANV A;  3WHW A;  1G9Q A;  1I9A A;  1VC9 A;  3BAP A;  5BS6 A;  2A8S A;  3X0Q A;  3GZ6 A;  2CL3 A;  1MR2 A;  4ICK A;  3X0P A;  4YPH A;  1RYA A;  1JRK A;  1KT9 A;  2YVN A;  4JZS A;  2PNY A;  5GHI A;  3KVH A;  3Q2T A;  5FSI A;  1RRQ A;  4K6E A;  3Q93 A;  2YVP A;  1VC8 A;  3L85 A;  1HX3 A;  5FSM A;  2J8Q A;  5ISY A;  5I8U A;  1JKN A;  3X0K A;  3GRN A;  5GHP A;  1MUT A;  2B2K A;  2I8T A;  2QKM B;  1V8T A;  4V14 A;  4DYW A;  1V8I A;  1X84 A;  2A8P A;  3I7V A;  1V8V A;  3O8S A;  5DEQ A;  3X0M A;  2YYH A;  5CFJ A;  3N77 A;  5GHO A;  2G73 A;  1VRL A;  4HFQ A;  3OGA A;  5IW5 A;  1VHZ A;  1XSC A;  3E57 A;  1Q54 A;  1MP2 A;  2O5F A;  3BM4 A;  1VCD A;  3P6Y A;  4ILQ A;  4KTB A;  4KG3 A;  5C8L A;  2B06 A;  3F13 A;  3SON A;  4JZV A;  1K26 A;  5IW4 A;  3AC9 A;  2ICK A;  1R67 A;  1PVF A;  3FJY A;  3X0N A;  3ZR0 A;  3H95 A;  1IRY A;  1GA7 A;  1Q33 A;  5GHM A;  1KTG A;  2DUK A;  2Q9P A;  3Q2S A;  4YOQ A;  3EEU A;  3MDI A;  3MCF A;  5GHQ A;  4S2Y A;  2KDV A;  1K2E A;  1SOI A;  1V8L A;  1PPX A;  3Q4I A;  1V8S A;  3N9U A;  1NFS A;  5DPK A;  1NQZ A;  4MPO A;  1SZ3 A;  1KHZ A;  2DSD A;  2JVB A;  2PQV A;  3ID9 A;  3SMD A;  3CNG A;  5ANU A;  4S2X A;  1VIU A;  4IJX A;  3MDG A;  2W4E A;  3GWY A;  3GZ5 A;  5CFI A;  4C9X A;  1MK1 A;  3HYQ A;  1SJY A;  3G0Q A;  1SU2 A;  5FSK A;  1VIQ A;  2B0V A;  2G74 A;  3FCM A;  3DUP A;  3P5T A;  1MQW A;  3FSP A;  1PPW A;  1V8M A;  3COU A;  1V8W A;  1XSA A;  1XSB A;  1VK6 A;  3I7U A;  2RRK A;  2CZR A;  4YPR A;  3QSJ A;  3EES A;  4S2W A;  2O5W A;  1V8R A;  2O1C A;  3F6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...