3EEUA

Structure of the rna pyrophosphohydrolase bdrpph in complex with holmium
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
133
structure length
133
Chain Sequence
KGHWIPVVAGFLRKDGKILVGQRPENNSLAGQWEFPGGKIENGETPEEALARELNEELGIEAEVGELKLACTHSYGDVGILILFYEILYWKGEPRAKHHMMLEWIHPEELKHRNIPEANRKILHKIYKALGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Probable pyrophosphohydrolase
publication title Structure and Biological Function of the RNA Pyrophosphohydrolase BdRppH from Bdellovibrio bacteriovorus.
pubmed doi rcsb
source organism Bdellovibrio bacteriovorus
total genus 31
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 3.6.1.-:
pdb deposition date 2008-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14815 NUDIX_4 NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3eeuA00
4JZSA 5LPGA 1F3YA 3E57A 2I6KA 4ILQA 2A8RA 3ZR1A 3HHJA 5GHOA 1KHZA 2GT2A 3X0IA 5CFIA 3GWYA 3O61A 2QJOA 3R03A 5DD4A 1NFSA 4KG3A 3X0SA 2DSBA 2J8QA 1NFZA 4S2WA 3MDGA 1VRLA 4JZTA 1QVJA 3EESA 1X83A 2A8QA 5FSLA 4KTBA 3BM4A 1X51A 3F13A 3O8SA 4YPHA 4YPRA 2ICJA 1MQEA 5ANWA 3L85A 3Q2SA 2FKBA 1PPWA 2QKMB 3ID9A 3I7VA 4NFWA 5FSOA 3U53A 1Q33A 1SU2A 2KDWA 3MCFA 4NFXA 5ANTA 4DYWA 1G0SA 3I7UA 3O52A 5GHIA 5IW4A 1U20A 2RRKA 1VIUA 1HX3A 5FSNA 3X0RA 1RYAA 1V8MA 3I9XA 1VIQA 2G74A 2ICKA 2O5WA 3X0KA 4N1TA 2PNYA 2PQVA 3X0OA 1JRKA 2I8TA 5C7QA 4HVYA 1RRQA 3A6SA 2R5WA 1VCDA 1SOIA 3GG6A 4KYXA 1V8SA 5FSMA 1V8RA 4V14A 4MPOA 2AZWA 3DUPA 1XSCA 2YVMA 1V8VA 1MP2A 3FCMA 2Q9PA 2A6TA 1R67A 5FSIA 2YVPA 2VNPA 5GHQA 2A8TA 3ZR0A 5CFJA 1JKNA 1TUMA 5ANSA 1PVFA 3X0PA 4JZUA 5IW5A 3SMDA 2QJTA 4JZVA 5BONA 1MK1A 2FMLA 1PUQA 2CL3A 1SZ3A 3A6VA 3CNGA 3QSJA 1Q54A 2G73A 3X0QA 3DKUA 3N77A 1V8UA 2YVOA 3P6YA 3EXQA 2JVBA 4ICKA 1MUTA 2O5FA 1PPVA 1IRYA 3WHWA 1V8NA 3Q4IA 1K26A 3N9UA 5HZXA 3KVHA 3MDIA 2GT4A 2GB5A 3O6ZA 1VC9A 1V8LA 2B0VA 3EF5A 3F6AA 4IJXA 1K2EA 2KDVA 3Q93A 4KG4A 1V8TA 1NQYA 1XSBA 3G0QA 1KT9A 1NQZA 2YYHA 3ACAA 3MGMA 3SONA 4N1UA 3J7Ye 3FK9A 3GZ6A 2XSQA 3AC9A 5DPKA 2DUKA 1GA7A 1PUSA 3P5TA 3X0LA 1I9AA 2I8UA 1G9QA 1HZTA 1PPXA 5DEQA 3X0NA 3OGAA 3A6UA 4ZG0A 4S2YA 3A6TA 5ISYA 5ANVA 2FVVA 1SJYA 1VHGA 2W4EA 3EEUA 1VK6A 2DSDA 1X84A 1KTGA 1Q27A 1OW2A 2YVNA 4HFQA 4S2XA 5GHJA 4C9XA 4YOQA 5GHPA 3H95A 3GZ5A 3BAPA 3FJYA 5FSKA 4C9WA 1XSAA 1V8IA 2A8PA 3FFUA 3Q91A 3FSPA 5C7TA 4K6EA 3O69A 3X0JA 3RH7A 3BHOA 4S2VA 1MR2A 3GZ8A 1VHZA 2B2KA 2B06A 2DHOA 3COUA 3HYQA 1RRSA 5ANUA 1MQWA 1V8WA 5GHNA 5BS6A 2A8SA 3X0MA 3Q2TA 1V8YA 3GRNA 5I8UA 1VC8A 3SHDA 1PUNA 2DSCA 2VNQA 3Q1PA 5C8LA 2O1CA 5DDGA 5GHMA
chains in the Genus database with same CATH superfamily
4JZSA 5LPGA 1F3YA 3E57A 2I6KA 4ILQA 2A8RA 3ZR1A 3HHJA 5GHOA 1KHZA 2GT2A 3X0IA 5CFIA 3GWYA 3O61A 2QJOA 3R03A 5DD4A 1NFSA 4KG3A 3X0SA 2DSBA 2J8QA 1NFZA 4S2WA 3MDGA 1VRLA 4JZTA 1QVJA 3EESA 1X83A 2A8QA 5FSLA 4KTBA 3BM4A 1X51A 3F13A 3O8SA 4YPHA 4YPRA 2ICJA 1MQEA 5ANWA 3L85A 3Q2SA 2FKBA 1PPWA 2QKMB 3ID9A 3I7VA 4NFWA 5FSOA 3U53A 1Q33A 1SU2A 2KDWA 3MCFA 4NFXA 5ANTA 4DYWA 1G0SA 3I7UA 3O52A 5GHIA 5IW4A 1U20A 2RRKA 1VIUA 1HX3A 5FSNA 3X0RA 1RYAA 1V8MA 3I9XA 1VIQA 2G74A 2ICKA 2O5WA 3X0KA 4N1TA 2PNYA 2PQVA 3X0OA 1JRKA 2I8TA 5C7QA 4HVYA 1RRQA 3A6SA 2R5WA 1VCDA 1SOIA 3GG6A 4KYXA 1V8SA 5FSMA 1V8RA 4V14A 4MPOA 2AZWA 3DUPA 1XSCA 2YVMA 1V8VA 1MP2A 3FCMA 2Q9PA 2A6TA 1R67A 5FSIA 2YVPA 2VNPA 5GHQA 2A8TA 3ZR0A 5CFJA 1JKNA 1TUMA 5ANSA 1PVFA 3X0PA 4JZUA 5IW5A 3SMDA 2QJTA 4JZVA 5BONA 1MK1A 2FMLA 1PUQA 2CL3A 1SZ3A 3A6VA 3CNGA 3QSJA 1Q54A 2G73A 3X0QA 3DKUA 3N77A 1V8UA 2YVOA 3P6YA 3EXQA 2JVBA 4ICKA 1MUTA 2O5FA 1PPVA 1IRYA 3WHWA 1V8NA 3Q4IA 1K26A 3N9UA 5HZXA 3KVHA 3MDIA 2GT4A 2GB5A 3O6ZA 1VC9A 1V8LA 2B0VA 3EF5A 3F6AA 4IJXA 1K2EA 2KDVA 3Q93A 4KG4A 1V8TA 1NQYA 1XSBA 3G0QA 1KT9A 1NQZA 2YYHA 3ACAA 3MGMA 4J7GA 4N1UA 3SONA 3FK9A 3J7Ye 3GZ6A 2XSQA 3AC9A 5DPKA 2DUKA 1GA7A 1PUSA 3P5TA 3X0LA 1I9AA 2I8UA 1G9QA 1HZTA 1PPXA 5DEQA 3X0NA 3OGAA 3A6UA 4ZG0A 4S2YA 3A6TA 5ISYA 4J7HA 5ANVA 2FVVA 1SJYA 1VHGA 2W4EA 3EEUA 1VK6A 2DSDA 1X84A 1KTGA 1Q27A 1OW2A 2YVNA 4HFQA 4S2XA 5GHJA 4C9XA 4YOQA 5GHPA 3H95A 3GZ5A 3BAPA 3FJYA 5FSKA 4C9WA 1XSAA 1V8IA 2A8PA 3FFUA 3Q91A 3FSPA 5C7TA 4K6EA 3O69A 3X0JA 3RH7A 3BHOA 4S2VA 1MR2A 3GZ8A 1VHZA 2B2KA 2B06A 2DHOA 3COUA 3HYQA 1RRSA 5ANUA 1MQWA 1V8WA 5GHNA 5BS6A 2A8SA 3X0MA 3Q2TA 1V8YA 2CZRA 3GRNA 5I8UA 1VC8A 3SHDA 1PUNA 2DSCA 2VNQA 3Q1PA 5C8LA 2O1CA 5DDGA 5GHMA
chains in the Genus database with same CATH topology
4JZSA 5LPGA 1F3YA 3E57A 2I6KA 4ILQA 2A8RA 3ZR1A 3HHJA 5GHOA 1KHZA 2GT2A 3X0IA 5CFIA 3GWYA 3O61A 2QJOA 3R03A 5DD4A 1NFSA 4KG3A 3X0SA 2DSBA 2J8QA 1NFZA 4S2WA 3MDGA 1VRLA 4JZTA 1QVJA 3EESA 1X83A 2A8QA 5FSLA 4KTBA 3BM4A 1X51A 3F13A 3O8SA 4YPHA 4YPRA 2ICJA 1MQEA 5ANWA 3L85A 3Q2SA 2FKBA 1PPWA 2QKMB 3ID9A 3I7VA 4NFWA 5FSOA 3U53A 1Q33A 1SU2A 2KDWA 3MCFA 4NFXA 5ANTA 4DYWA 1G0SA 3I7UA 3O52A 5GHIA 5IW4A 1U20A 2RRKA 1VIUA 1HX3A 5FSNA 3X0RA 1RYAA 1V8MA 3I9XA 1VIQA 2G74A 2ICKA 2O5WA 3X0KA 4N1TA 2PNYA 2PQVA 3X0OA 1JRKA 2I8TA 5C7QA 4HVYA 1RRQA 3A6SA 2R5WA 1VCDA 1SOIA 3GG6A 4KYXA 1V8SA 5FSMA 1V8RA 4V14A 4MPOA 2AZWA 3DUPA 1XSCA 2YVMA 1V8VA 1MP2A 3FCMA 2Q9PA 2A6TA 1R67A 5FSIA 2YVPA 2VNPA 5GHQA 2A8TA 3ZR0A 5CFJA 1JKNA 1TUMA 5ANSA 1PVFA 3X0PA 4JZUA 5IW5A 3SMDA 2QJTA 4JZVA 5BONA 1MK1A 2FMLA 1PUQA 2CL3A 1SZ3A 3A6VA 3CNGA 3QSJA 1Q54A 2G73A 3X0QA 3DKUA 3N77A 1V8UA 2YVOA 3P6YA 3EXQA 2JVBA 4ICKA 1MUTA 2O5FA 1PPVA 1IRYA 3WHWA 1V8NA 3Q4IA 1K26A 3N9UA 5HZXA 3KVHA 3MDIA 2GT4A 2GB5A 3O6ZA 1VC9A 1V8LA 2B0VA 3EF5A 3F6AA 4IJXA 1K2EA 2KDVA 3Q93A 4KG4A 1V8TA 1NQYA 1XSBA 3G0QA 1KT9A 1NQZA 2YYHA 3ACAA 3MGMA 4J7GA 4N1UA 3SONA 3FK9A 3J7Ye 3GZ6A 2XSQA 3AC9A 5DPKA 2DUKA 1GA7A 1PUSA 3P5TA 3X0LA 1I9AA 2I8UA 1G9QA 1HZTA 1PPXA 5DEQA 3X0NA 3OGAA 3A6UA 4ZG0A 4S2YA 3A6TA 5ISYA 4J7HA 5ANVA 2FVVA 1SJYA 1VHGA 2W4EA 3EEUA 1VK6A 2DSDA 1X84A 1KTGA 1Q27A 1OW2A 2YVNA 4HFQA 4S2XA 5GHJA 4C9XA 4YOQA 5GHPA 3H95A 3GZ5A 3BAPA 3FJYA 5FSKA 4C9WA 1XSAA 1V8IA 2A8PA 3FFUA 3Q91A 3FSPA 5C7TA 4K6EA 3O69A 3X0JA 3RH7A 3BHOA 4S2VA 1MR2A 3GZ8A 1VHZA 2B2KA 2B06A 2DHOA 3COUA 3HYQA 1RRSA 5ANUA 1MQWA 1V8WA 5GHNA 5BS6A 2A8SA 3X0MA 3Q2TA 1V8YA 2CZRA 3GRNA 5I8UA 1VC8A 3SHDA 1PUNA 2DSCA 2VNQA 3Q1PA 5C8LA 2O1CA 5DDGA 5GHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZS A;  5LPG A;  1F3Y A;  3E57 A;  2I6K A;  4ILQ A;  2A8R A;  3ZR1 A;  3HHJ A;  5GHO A;  1KHZ A;  2GT2 A;  3X0I A;  5CFI A;  3GWY A;  3O61 A;  2QJO A;  3R03 A;  5DD4 A;  1NFS A;  4KG3 A;  3X0S A;  2DSB A;  2J8Q A;  1NFZ A;  4S2W A;  3MDG A;  1VRL A;  4JZT A;  1QVJ A;  3EES A;  1X83 A;  2A8Q A;  5FSL A;  4KTB A;  3BM4 A;  1X51 A;  3F13 A;  3O8S A;  4YPH A;  4YPR A;  2ICJ A;  1MQE A;  5ANW A;  3L85 A;  3Q2S A;  2FKB A;  1PPW A;  2QKM B;  3ID9 A;  3I7V A;  4NFW A;  5FSO A;  3U53 A;  1Q33 A;  1SU2 A;  2KDW A;  3MCF A;  4NFX A;  5ANT A;  4DYW A;  1G0S A;  3I7U A;  3O52 A;  5GHI A;  5IW4 A;  1U20 A;  2RRK A;  1VIU A;  1HX3 A;  5FSN A;  3X0R A;  1RYA A;  1V8M A;  3I9X A;  1VIQ A;  2G74 A;  2ICK A;  2O5W A;  3X0K A;  4N1T A;  2PNY A;  2PQV A;  3X0O A;  1JRK A;  2I8T A;  5C7Q A;  4HVY A;  1RRQ A;  3A6S A;  2R5W A;  1VCD A;  1SOI A;  3GG6 A;  4KYX A;  1V8S A;  5FSM A;  1V8R A;  4V14 A;  4MPO A;  2AZW A;  3DUP A;  1XSC A;  2YVM A;  1V8V A;  1MP2 A;  3FCM A;  2Q9P A;  2A6T A;  1R67 A;  5FSI A;  2YVP A;  2VNP A;  5GHQ A;  2A8T A;  3ZR0 A;  5CFJ A;  1JKN A;  1TUM A;  5ANS A;  1PVF A;  3X0P A;  4JZU A;  5IW5 A;  3SMD A;  2QJT A;  4JZV A;  5BON A;  1MK1 A;  2FML A;  1PUQ A;  2CL3 A;  1SZ3 A;  3A6V A;  3CNG A;  3QSJ A;  1Q54 A;  2G73 A;  3X0Q A;  3DKU A;  3N77 A;  1V8U A;  2YVO A;  3P6Y A;  3EXQ A;  2JVB A;  4ICK A;  1MUT A;  2O5F A;  1PPV A;  1IRY A;  3WHW A;  1V8N A;  3Q4I A;  1K26 A;  3N9U A;  5HZX A;  3KVH A;  3MDI A;  2GT4 A;  2GB5 A;  3O6Z A;  1VC9 A;  1V8L A;  2B0V A;  3EF5 A;  3F6A A;  4IJX A;  1K2E A;  2KDV A;  3Q93 A;  4KG4 A;  1V8T A;  1NQY A;  1XSB A;  3G0Q A;  1KT9 A;  1NQZ A;  2YYH A;  3ACA A;  3MGM A;  3SON A;  4N1U A;  3J7Y e;  3FK9 A;  3GZ6 A;  2XSQ A;  3AC9 A;  5DPK A;  2DUK A;  1GA7 A;  1PUS A;  3P5T A;  3X0L A;  1I9A A;  2I8U A;  1G9Q A;  1HZT A;  1PPX A;  5DEQ A;  3X0N A;  3OGA A;  3A6U A;  4ZG0 A;  4S2Y A;  3A6T A;  5ISY A;  5ANV A;  2FVV A;  1SJY A;  1VHG A;  2W4E A;  3EEU A;  1VK6 A;  2DSD A;  1X84 A;  1KTG A;  1Q27 A;  1OW2 A;  2YVN A;  4HFQ A;  4S2X A;  5GHJ A;  4C9X A;  4YOQ A;  5GHP A;  3H95 A;  3GZ5 A;  3BAP A;  3FJY A;  5FSK A;  4C9W A;  1XSA A;  1V8I A;  2A8P A;  3FFU A;  3Q91 A;  3FSP A;  5C7T A;  4K6E A;  3O69 A;  3X0J A;  3RH7 A;  3BHO A;  4S2V A;  1MR2 A;  3GZ8 A;  1VHZ A;  2B2K A;  2B06 A;  2DHO A;  3COU A;  3HYQ A;  1RRS A;  5ANU A;  1MQW A;  1V8W A;  5GHN A;  5BS6 A;  2A8S A;  3X0M A;  3Q2T A;  1V8Y A;  3GRN A;  5I8U A;  1VC8 A;  3SHD A;  1PUN A;  2DSC A;  2VNQ A;  3Q1P A;  5C8L A;  2O1C A;  5DDG A;  5GHM A; 
#chains in the Genus database with same CATH topology
 4JZS A;  5LPG A;  1F3Y A;  3E57 A;  2I6K A;  4ILQ A;  2A8R A;  3ZR1 A;  3HHJ A;  5GHO A;  1KHZ A;  2GT2 A;  3X0I A;  5CFI A;  3GWY A;  3O61 A;  2QJO A;  3R03 A;  5DD4 A;  1NFS A;  4KG3 A;  3X0S A;  2DSB A;  2J8Q A;  1NFZ A;  4S2W A;  3MDG A;  1VRL A;  4JZT A;  1QVJ A;  3EES A;  1X83 A;  2A8Q A;  5FSL A;  4KTB A;  3BM4 A;  1X51 A;  3F13 A;  3O8S A;  4YPH A;  4YPR A;  2ICJ A;  1MQE A;  5ANW A;  3L85 A;  3Q2S A;  2FKB A;  1PPW A;  2QKM B;  3ID9 A;  3I7V A;  4NFW A;  5FSO A;  3U53 A;  1Q33 A;  1SU2 A;  2KDW A;  3MCF A;  4NFX A;  5ANT A;  4DYW A;  1G0S A;  3I7U A;  3O52 A;  5GHI A;  5IW4 A;  1U20 A;  2RRK A;  1VIU A;  1HX3 A;  5FSN A;  3X0R A;  1RYA A;  1V8M A;  3I9X A;  1VIQ A;  2G74 A;  2ICK A;  2O5W A;  3X0K A;  4N1T A;  2PNY A;  2PQV A;  3X0O A;  1JRK A;  2I8T A;  5C7Q A;  4HVY A;  1RRQ A;  3A6S A;  2R5W A;  1VCD A;  1SOI A;  3GG6 A;  4KYX A;  1V8S A;  5FSM A;  1V8R A;  4V14 A;  4MPO A;  2AZW A;  3DUP A;  1XSC A;  2YVM A;  1V8V A;  1MP2 A;  3FCM A;  2Q9P A;  2A6T A;  1R67 A;  5FSI A;  2YVP A;  2VNP A;  5GHQ A;  2A8T A;  3ZR0 A;  5CFJ A;  1JKN A;  1TUM A;  5ANS A;  1PVF A;  3X0P A;  4JZU A;  5IW5 A;  3SMD A;  2QJT A;  4JZV A;  5BON A;  1MK1 A;  2FML A;  1PUQ A;  2CL3 A;  1SZ3 A;  3A6V A;  3CNG A;  3QSJ A;  1Q54 A;  2G73 A;  3X0Q A;  3DKU A;  3N77 A;  1V8U A;  2YVO A;  3P6Y A;  3EXQ A;  2JVB A;  4ICK A;  1MUT A;  2O5F A;  1PPV A;  1IRY A;  3WHW A;  1V8N A;  3Q4I A;  1K26 A;  3N9U A;  5HZX A;  3KVH A;  3MDI A;  2GT4 A;  2GB5 A;  3O6Z A;  1VC9 A;  1V8L A;  2B0V A;  3EF5 A;  3F6A A;  4IJX A;  1K2E A;  2KDV A;  3Q93 A;  4KG4 A;  1V8T A;  1NQY A;  1XSB A;  3G0Q A;  1KT9 A;  1NQZ A;  2YYH A;  3ACA A;  3MGM A;  4J7G A;  4N1U A;  3SON A;  3FK9 A;  3J7Y e;  3GZ6 A;  2XSQ A;  3AC9 A;  5DPK A;  2DUK A;  1GA7 A;  1PUS A;  3P5T A;  3X0L A;  1I9A A;  2I8U A;  1G9Q A;  1HZT A;  1PPX A;  5DEQ A;  3X0N A;  3OGA A;  3A6U A;  4ZG0 A;  4S2Y A;  3A6T A;  5ISY A;  4J7H A;  5ANV A;  2FVV A;  1SJY A;  1VHG A;  2W4E A;  3EEU A;  1VK6 A;  2DSD A;  1X84 A;  1KTG A;  1Q27 A;  1OW2 A;  2YVN A;  4HFQ A;  4S2X A;  5GHJ A;  4C9X A;  4YOQ A;  5GHP A;  3H95 A;  3GZ5 A;  3BAP A;  3FJY A;  5FSK A;  4C9W A;  1XSA A;  1V8I A;  2A8P A;  3FFU A;  3Q91 A;  3FSP A;  5C7T A;  4K6E A;  3O69 A;  3X0J A;  3RH7 A;  3BHO A;  4S2V A;  1MR2 A;  3GZ8 A;  1VHZ A;  2B2K A;  2B06 A;  2DHO A;  3COU A;  3HYQ A;  1RRS A;  5ANU A;  1MQW A;  1V8W A;  5GHN A;  5BS6 A;  2A8S A;  3X0M A;  3Q2T A;  1V8Y A;  2CZR A;  3GRN A;  5I8U A;  1VC8 A;  3SHD A;  1PUN A;  2DSC A;  2VNQ A;  3Q1P A;  5C8L A;  2O1C A;  5DDG A;  5GHM A; 
#chains in the Genus database with same CATH homology
 4JZS A;  5LPG A;  1F3Y A;  3E57 A;  2I6K A;  4ILQ A;  2A8R A;  3ZR1 A;  3HHJ A;  5GHO A;  1KHZ A;  2GT2 A;  3X0I A;  5CFI A;  3GWY A;  3O61 A;  2QJO A;  3R03 A;  5DD4 A;  1NFS A;  4KG3 A;  3X0S A;  2DSB A;  2J8Q A;  1NFZ A;  4S2W A;  3MDG A;  1VRL A;  4JZT A;  1QVJ A;  3EES A;  1X83 A;  2A8Q A;  5FSL A;  4KTB A;  3BM4 A;  1X51 A;  3F13 A;  3O8S A;  4YPH A;  4YPR A;  2ICJ A;  1MQE A;  5ANW A;  3L85 A;  3Q2S A;  2FKB A;  1PPW A;  2QKM B;  3ID9 A;  3I7V A;  4NFW A;  5FSO A;  3U53 A;  1Q33 A;  1SU2 A;  2KDW A;  3MCF A;  4NFX A;  5ANT A;  4DYW A;  1G0S A;  3I7U A;  3O52 A;  5GHI A;  5IW4 A;  1U20 A;  2RRK A;  1VIU A;  1HX3 A;  5FSN A;  3X0R A;  1RYA A;  1V8M A;  3I9X A;  1VIQ A;  2G74 A;  2ICK A;  2O5W A;  3X0K A;  4N1T A;  2PNY A;  2PQV A;  3X0O A;  1JRK A;  2I8T A;  5C7Q A;  4HVY A;  1RRQ A;  3A6S A;  2R5W A;  1VCD A;  1SOI A;  3GG6 A;  4KYX A;  1V8S A;  5FSM A;  1V8R A;  4V14 A;  4MPO A;  2AZW A;  3DUP A;  1XSC A;  2YVM A;  1V8V A;  1MP2 A;  3FCM A;  2Q9P A;  2A6T A;  1R67 A;  5FSI A;  2YVP A;  2VNP A;  5GHQ A;  2A8T A;  3ZR0 A;  5CFJ A;  1JKN A;  1TUM A;  5ANS A;  1PVF A;  3X0P A;  4JZU A;  5IW5 A;  3SMD A;  2QJT A;  4JZV A;  5BON A;  1MK1 A;  2FML A;  1PUQ A;  2CL3 A;  1SZ3 A;  3A6V A;  3CNG A;  3QSJ A;  1Q54 A;  2G73 A;  3X0Q A;  3DKU A;  3N77 A;  1V8U A;  2YVO A;  3P6Y A;  3EXQ A;  2JVB A;  4ICK A;  1MUT A;  2O5F A;  1PPV A;  1IRY A;  3WHW A;  1V8N A;  3Q4I A;  1K26 A;  3N9U A;  5HZX A;  3KVH A;  3MDI A;  2GT4 A;  2GB5 A;  3O6Z A;  1VC9 A;  1V8L A;  2B0V A;  3EF5 A;  3F6A A;  4IJX A;  1K2E A;  2KDV A;  3Q93 A;  4KG4 A;  1V8T A;  1NQY A;  1XSB A;  3G0Q A;  1KT9 A;  1NQZ A;  2YYH A;  3ACA A;  3MGM A;  4J7G A;  4N1U A;  3SON A;  3FK9 A;  3J7Y e;  3GZ6 A;  2XSQ A;  3AC9 A;  5DPK A;  2DUK A;  1GA7 A;  1PUS A;  3P5T A;  3X0L A;  1I9A A;  2I8U A;  1G9Q A;  1HZT A;  1PPX A;  5DEQ A;  3X0N A;  3OGA A;  3A6U A;  4ZG0 A;  4S2Y A;  3A6T A;  5ISY A;  4J7H A;  5ANV A;  2FVV A;  1SJY A;  1VHG A;  2W4E A;  3EEU A;  1VK6 A;  2DSD A;  1X84 A;  1KTG A;  1Q27 A;  1OW2 A;  2YVN A;  4HFQ A;  4S2X A;  5GHJ A;  4C9X A;  4YOQ A;  5GHP A;  3H95 A;  3GZ5 A;  3BAP A;  3FJY A;  5FSK A;  4C9W A;  1XSA A;  1V8I A;  2A8P A;  3FFU A;  3Q91 A;  3FSP A;  5C7T A;  4K6E A;  3O69 A;  3X0J A;  3RH7 A;  3BHO A;  4S2V A;  1MR2 A;  3GZ8 A;  1VHZ A;  2B2K A;  2B06 A;  2DHO A;  3COU A;  3HYQ A;  1RRS A;  5ANU A;  1MQW A;  1V8W A;  5GHN A;  5BS6 A;  2A8S A;  3X0M A;  3Q2T A;  1V8Y A;  2CZR A;  3GRN A;  5I8U A;  1VC8 A;  3SHD A;  1PUN A;  2DSC A;  2VNQ A;  3Q1P A;  5C8L A;  2O1C A;  5DDG A;  5GHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...