5C7QA

Crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
182
structure length
182
Chain Sequence
MKHLEEKTLSTRQIFKGRYLKIEQDQVQAPDGRTYTREYILHPGAAMMIPLLPNGNVVMIHQYRHAVKKVFLEFPAGKRDHNEETLLTAKRELLEETGYEAKDWKFLTTIHPVIGYSNEHIDLYLARDLTHLEQRLDQGEFIEVVEVKPADLMQLVLEGKVSDVKTQIGAFWLDKFLRGEWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NudF protein
publication title Structural and Enzymatic Characterization of a Nucleoside Diphosphate Sugar Hydrolase from Bdellovibrio bacteriovorus.
pubmed doi rcsb
source organism Bdellovibrio bacteriovorus
molecule tags Hydrolase
total genus 49
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 3.6.1.13: ADP-ribose diphosphatase.
pdb deposition date 2015-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5c7qA00
4YPHA 1VC8A 2FKBA 1NQZA 3U53A 3ZR0A 2A8QA 5CFIA 3X0JA 4S2YA 1V8NA 2GT4A 1V8RA 1VRLA 2PNYA 3GZ8A 2KDWA 1VC9A 2YVPA 3FJYA 2J8QA 3X0LA 1RRSA 1Q54A 2PQVA 5ANWA 3X0PA 2B06A 5C7QA 3KVHA 3A6UA 5FSKA 3ZR1A 1KT9A 2A6TA 4KG3A 2YVNA 2DUKA 1MK1A 1PPVA 3P6YA 3I7VA 3OGAA 3Q91A 1MQEA 1VHZA 5GHQA 1JRKA 3EESA 3GWYA 4K6EA 1I9AA 4N1UA 3DKUA 2DSCA 2B2KA 3FFUA 1PUNA 1JKNA 5C8LA 1PVFA 4KYXA 2A8SA 1HZTA 2KDVA 3ID9A 3FSPA 1PUSA 1TUMA 2YYHA 3BHOA 3X0OA 2G74A 5DD4A 1X84A 4MPOA 1R67A 3GZ5A 2VNPA 4NFXA 1V8SA 3G0QA 3I9XA 4S2WA 3A6SA 1V8YA 1V8IA 1VIUA 1VK6A 4JZTA 5DPKA 1KHZA 2O1CA 3X0IA 5GHJA 1Q33A 2B0VA 2A8TA 3GRNA 2VNQA 2O5FA 1MQWA 1MP2A 1Q27A 3CNGA 3I7UA 5FSOA 4ZG0A 2I6KA 3RH7A 3WHWA 3HHJA 3FK9A 4KTBA 5ANTA 2Q9PA 3BAPA 3AC9A 2A8PA 1NFSA 4JZVA 2RRKA 2DHOA 2AZWA 3SONA 1SU2A 1U20A 3A6VA 3F6AA 5DEQA 2W4EA 1MUTA 3Q1PA 3HYQA 5FSIA 1IRYA 1SJYA 1RYAA 3SHDA 3F13A 3O52A 3X0KA 5DDGA 5ISYA 3E57A 1MR2A 1V8UA 4YPRA 4JZUA 1G9QA 2QJOA 3Q2SA 4ILQA 3DUPA 3SMDA 1V8WA 3FCMA 2CL3A 5ANVA 3X0MA 5IW5A 2YVOA 3N9UA 1VIQA 2ICJA 3J7Ye 1V8LA 1F3YA 2I8TA 2FVVA 3MCFA 2DSBA 3A6TA 1NFZA 2YVMA 3H95A 3QSJA 5GHIA 1GA7A 5GHNA 1XSAA 1KTGA 1SZ3A 1XSCA 2FMLA 2GT2A 2QKMB 4V14A 1NQYA 4DYWA 3GG6A 3O69A 5CFJA 3Q4IA 4YOQA 2ICKA 3Q93A 5ANUA 3MDGA 3MDIA 3BM4A 2I8UA 4N1TA 2G73A 3GZ6A 5GHOA 4JZSA 1V8VA 4HVYA 4NFWA 3Q2TA 5BONA 3EEUA 5GHPA 5GHMA 3O8SA 1QVJA 3O61A 3R03A 1SOIA 2GB5A 5I8UA 3X0QA 3L85A 5C7TA 1RRQA 1PUQA 3EF5A 5HZXA 5FSMA 1X51A 2DSDA 3X0SA 1VHGA 1PPXA 2A8RA 3X0NA 5ANSA 3MGMA 3O6ZA 4S2VA 5IW4A 3N77A 1G0SA 4S2XA 4KG4A 5LPGA 1V8MA 2O5WA 4C9XA 2JVBA 2R5WA 1V8TA 3COUA 1XSBA 3X0RA 4ICKA 3EXQA 5FSNA 4HFQA 5BS6A 1VCDA 1OW2A 2XSQA 1K2EA 1PPWA 4IJXA 5FSLA 2QJTA 1K26A 1X83A 1HX3A 3ACAA 4C9WA 3P5TA
chains in the Genus database with same CATH superfamily
4YPHA 1VC8A 2FKBA 1NQZA 3U53A 3ZR0A 2A8QA 5CFIA 3X0JA 4S2YA 1V8NA 2GT4A 1V8RA 1VRLA 2PNYA 3GZ8A 2KDWA 1VC9A 2YVPA 3FJYA 2J8QA 3X0LA 1RRSA 1Q54A 2PQVA 2CZRA 5ANWA 3X0PA 2B06A 5C7QA 3KVHA 3A6UA 5FSKA 3ZR1A 1KT9A 2A6TA 4KG3A 2YVNA 2DUKA 1MK1A 1PPVA 3P6YA 3I7VA 3OGAA 3Q91A 1MQEA 1VHZA 5GHQA 1JRKA 3EESA 3GWYA 4K6EA 1I9AA 4N1UA 3DKUA 2DSCA 2B2KA 3FFUA 1PUNA 1JKNA 5C8LA 1PVFA 4KYXA 2A8SA 1HZTA 2KDVA 3ID9A 3FSPA 1PUSA 1TUMA 2YYHA 3BHOA 3X0OA 2G74A 5DD4A 1X84A 4MPOA 1R67A 3GZ5A 2VNPA 4NFXA 1V8SA 3G0QA 3I9XA 4S2WA 3A6SA 1V8YA 1V8IA 1VIUA 1VK6A 4JZTA 5DPKA 1KHZA 2O1CA 3X0IA 5GHJA 1Q33A 2B0VA 2A8TA 3GRNA 2VNQA 2O5FA 1MQWA 1MP2A 1Q27A 3CNGA 3I7UA 5FSOA 4ZG0A 2I6KA 3RH7A 3WHWA 3HHJA 3FK9A 4KTBA 5ANTA 2Q9PA 3BAPA 3AC9A 2A8PA 1NFSA 4JZVA 2RRKA 2DHOA 2AZWA 3SONA 1SU2A 1U20A 3A6VA 3F6AA 5DEQA 2W4EA 1MUTA 3Q1PA 3HYQA 5FSIA 1IRYA 1SJYA 1RYAA 3SHDA 3F13A 3O52A 3X0KA 5DDGA 5ISYA 3E57A 1MR2A 1V8UA 4YPRA 4JZUA 1G9QA 2QJOA 3Q2SA 4ILQA 3DUPA 3SMDA 1V8WA 3FCMA 2CL3A 5ANVA 3X0MA 5IW5A 2YVOA 3N9UA 1VIQA 2ICJA 3J7Ye 1V8LA 1F3YA 2I8TA 2FVVA 3MCFA 4J7HA 2DSBA 3A6TA 1NFZA 2YVMA 3H95A 3QSJA 5GHIA 1GA7A 5GHNA 1XSAA 1KTGA 1SZ3A 1XSCA 2FMLA 2GT2A 2QKMB 4V14A 1NQYA 4DYWA 3GG6A 3O69A 5CFJA 3Q4IA 4YOQA 2ICKA 3Q93A 5ANUA 3MDGA 3MDIA 3BM4A 2I8UA 4N1TA 2G73A 3GZ6A 5GHOA 4JZSA 1V8VA 4HVYA 4NFWA 3Q2TA 5BONA 3EEUA 5GHPA 5GHMA 3O8SA 1QVJA 3O61A 3R03A 1SOIA 2GB5A 5I8UA 3X0QA 3L85A 5C7TA 1RRQA 1PUQA 3EF5A 5HZXA 5FSMA 1X51A 2DSDA 3X0SA 1VHGA 1PPXA 2A8RA 3X0NA 5ANSA 3MGMA 3O6ZA 4S2VA 5IW4A 3N77A 1G0SA 4S2XA 4KG4A 5LPGA 1V8MA 2O5WA 4C9XA 2JVBA 2R5WA 1V8TA 3COUA 1XSBA 3X0RA 4ICKA 3EXQA 5FSNA 4HFQA 4J7GA 5BS6A 1VCDA 1OW2A 2XSQA 1K2EA 1PPWA 4IJXA 5FSLA 2QJTA 1K26A 1X83A 1HX3A 3ACAA 4C9WA 3P5TA
chains in the Genus database with same CATH topology
4YPHA 1VC8A 2FKBA 1NQZA 3U53A 3ZR0A 2A8QA 5CFIA 3X0JA 4S2YA 1V8NA 2GT4A 1V8RA 1VRLA 2PNYA 3GZ8A 2KDWA 1VC9A 2YVPA 3FJYA 2J8QA 3X0LA 1RRSA 1Q54A 2PQVA 2CZRA 5ANWA 3X0PA 2B06A 5C7QA 3KVHA 3A6UA 5FSKA 3ZR1A 1KT9A 2A6TA 4KG3A 2YVNA 2DUKA 1MK1A 1PPVA 3P6YA 3I7VA 3OGAA 3Q91A 1MQEA 1VHZA 5GHQA 1JRKA 3EESA 3GWYA 4K6EA 1I9AA 4N1UA 3DKUA 2DSCA 2B2KA 3FFUA 1PUNA 1JKNA 5C8LA 1PVFA 4KYXA 2A8SA 1HZTA 2KDVA 3ID9A 3FSPA 1PUSA 1TUMA 2YYHA 3BHOA 3X0OA 2G74A 5DD4A 1X84A 4MPOA 1R67A 3GZ5A 2VNPA 4NFXA 1V8SA 3G0QA 3I9XA 4S2WA 3A6SA 1V8YA 1V8IA 1VIUA 1VK6A 4JZTA 5DPKA 1KHZA 2O1CA 3X0IA 5GHJA 1Q33A 2B0VA 2A8TA 3GRNA 2VNQA 2O5FA 1MQWA 1MP2A 1Q27A 3CNGA 3I7UA 5FSOA 4ZG0A 2I6KA 3RH7A 3WHWA 3HHJA 3FK9A 4KTBA 5ANTA 2Q9PA 3BAPA 3AC9A 2A8PA 1NFSA 4JZVA 2RRKA 2DHOA 2AZWA 3SONA 1SU2A 1U20A 3A6VA 3F6AA 5DEQA 2W4EA 1MUTA 3Q1PA 3HYQA 5FSIA 1IRYA 1SJYA 1RYAA 3SHDA 3F13A 3O52A 3X0KA 5DDGA 5ISYA 3E57A 1MR2A 1V8UA 4YPRA 4JZUA 1G9QA 2QJOA 3Q2SA 4ILQA 3DUPA 3SMDA 1V8WA 3FCMA 2CL3A 5ANVA 3X0MA 5IW5A 2YVOA 3N9UA 1VIQA 2ICJA 3J7Ye 1V8LA 1F3YA 2I8TA 2FVVA 3MCFA 4J7HA 2DSBA 3A6TA 1NFZA 2YVMA 3H95A 3QSJA 5GHIA 1GA7A 5GHNA 1XSAA 1KTGA 1SZ3A 1XSCA 2FMLA 2GT2A 2QKMB 4V14A 1NQYA 4DYWA 3GG6A 3O69A 5CFJA 3Q4IA 4YOQA 2ICKA 3Q93A 5ANUA 3MDGA 3MDIA 3BM4A 2I8UA 4N1TA 2G73A 3GZ6A 5GHOA 4JZSA 1V8VA 4HVYA 4NFWA 3Q2TA 5BONA 3EEUA 5GHPA 5GHMA 3O8SA 1QVJA 3O61A 3R03A 1SOIA 2GB5A 5I8UA 3X0QA 3L85A 5C7TA 1RRQA 1PUQA 3EF5A 5HZXA 5FSMA 1X51A 2DSDA 3X0SA 1VHGA 1PPXA 2A8RA 3X0NA 5ANSA 3MGMA 3O6ZA 4S2VA 5IW4A 3N77A 1G0SA 4S2XA 4KG4A 5LPGA 1V8MA 2O5WA 4C9XA 2JVBA 2R5WA 1V8TA 3COUA 1XSBA 3X0RA 4ICKA 3EXQA 5FSNA 4HFQA 4J7GA 5BS6A 1VCDA 1OW2A 2XSQA 1K2EA 1PPWA 4IJXA 5FSLA 2QJTA 1K26A 1X83A 1HX3A 3ACAA 4C9WA 3P5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YPH A;  1VC8 A;  2FKB A;  1NQZ A;  3U53 A;  3ZR0 A;  2A8Q A;  5CFI A;  3X0J A;  4S2Y A;  1V8N A;  2GT4 A;  1V8R A;  1VRL A;  2PNY A;  3GZ8 A;  2KDW A;  1VC9 A;  2YVP A;  3FJY A;  2J8Q A;  3X0L A;  1RRS A;  1Q54 A;  2PQV A;  5ANW A;  3X0P A;  2B06 A;  5C7Q A;  3KVH A;  3A6U A;  5FSK A;  3ZR1 A;  1KT9 A;  2A6T A;  4KG3 A;  2YVN A;  2DUK A;  1MK1 A;  1PPV A;  3P6Y A;  3I7V A;  3OGA A;  3Q91 A;  1MQE A;  1VHZ A;  5GHQ A;  1JRK A;  3EES A;  3GWY A;  4K6E A;  1I9A A;  4N1U A;  3DKU A;  2DSC A;  2B2K A;  3FFU A;  1PUN A;  1JKN A;  5C8L A;  1PVF A;  4KYX A;  2A8S A;  1HZT A;  2KDV A;  3ID9 A;  3FSP A;  1PUS A;  1TUM A;  2YYH A;  3BHO A;  3X0O A;  2G74 A;  5DD4 A;  1X84 A;  4MPO A;  1R67 A;  3GZ5 A;  2VNP A;  4NFX A;  1V8S A;  3G0Q A;  3I9X A;  4S2W A;  3A6S A;  1V8Y A;  1V8I A;  1VIU A;  1VK6 A;  4JZT A;  5DPK A;  1KHZ A;  2O1C A;  3X0I A;  5GHJ A;  1Q33 A;  2B0V A;  2A8T A;  3GRN A;  2VNQ A;  2O5F A;  1MQW A;  1MP2 A;  1Q27 A;  3CNG A;  3I7U A;  5FSO A;  4ZG0 A;  2I6K A;  3RH7 A;  3WHW A;  3HHJ A;  3FK9 A;  4KTB A;  5ANT A;  2Q9P A;  3BAP A;  3AC9 A;  2A8P A;  1NFS A;  4JZV A;  2RRK A;  2DHO A;  2AZW A;  3SON A;  1SU2 A;  1U20 A;  3A6V A;  3F6A A;  5DEQ A;  2W4E A;  1MUT A;  3Q1P A;  3HYQ A;  5FSI A;  1IRY A;  1SJY A;  1RYA A;  3SHD A;  3F13 A;  3O52 A;  3X0K A;  5DDG A;  5ISY A;  3E57 A;  1MR2 A;  1V8U A;  4YPR A;  4JZU A;  1G9Q A;  2QJO A;  3Q2S A;  4ILQ A;  3DUP A;  3SMD A;  1V8W A;  3FCM A;  2CL3 A;  5ANV A;  3X0M A;  5IW5 A;  2YVO A;  3N9U A;  1VIQ A;  2ICJ A;  3J7Y e;  1V8L A;  1F3Y A;  2I8T A;  2FVV A;  3MCF A;  2DSB A;  3A6T A;  1NFZ A;  2YVM A;  3H95 A;  3QSJ A;  5GHI A;  1GA7 A;  5GHN A;  1XSA A;  1KTG A;  1SZ3 A;  1XSC A;  2FML A;  2GT2 A;  2QKM B;  4V14 A;  1NQY A;  4DYW A;  3GG6 A;  3O69 A;  5CFJ A;  3Q4I A;  4YOQ A;  2ICK A;  3Q93 A;  5ANU A;  3MDG A;  3MDI A;  3BM4 A;  2I8U A;  4N1T A;  2G73 A;  3GZ6 A;  5GHO A;  4JZS A;  1V8V A;  4HVY A;  4NFW A;  3Q2T A;  5BON A;  3EEU A;  5GHP A;  5GHM A;  3O8S A;  1QVJ A;  3O61 A;  3R03 A;  1SOI A;  2GB5 A;  5I8U A;  3X0Q A;  3L85 A;  5C7T A;  1RRQ A;  1PUQ A;  3EF5 A;  5HZX A;  5FSM A;  1X51 A;  2DSD A;  3X0S A;  1VHG A;  1PPX A;  2A8R A;  3X0N A;  5ANS A;  3MGM A;  3O6Z A;  4S2V A;  5IW4 A;  3N77 A;  1G0S A;  4S2X A;  4KG4 A;  5LPG A;  1V8M A;  2O5W A;  4C9X A;  2JVB A;  2R5W A;  1V8T A;  3COU A;  1XSB A;  3X0R A;  4ICK A;  3EXQ A;  5FSN A;  4HFQ A;  5BS6 A;  1VCD A;  1OW2 A;  2XSQ A;  1K2E A;  1PPW A;  4IJX A;  5FSL A;  2QJT A;  1K26 A;  1X83 A;  1HX3 A;  3ACA A;  4C9W A;  3P5T A; 
#chains in the Genus database with same CATH topology
 4YPH A;  1VC8 A;  2FKB A;  1NQZ A;  3U53 A;  3ZR0 A;  2A8Q A;  5CFI A;  3X0J A;  4S2Y A;  1V8N A;  2GT4 A;  1V8R A;  1VRL A;  2PNY A;  3GZ8 A;  2KDW A;  1VC9 A;  2YVP A;  3FJY A;  2J8Q A;  3X0L A;  1RRS A;  1Q54 A;  2PQV A;  2CZR A;  5ANW A;  3X0P A;  2B06 A;  5C7Q A;  3KVH A;  3A6U A;  5FSK A;  3ZR1 A;  1KT9 A;  2A6T A;  4KG3 A;  2YVN A;  2DUK A;  1MK1 A;  1PPV A;  3P6Y A;  3I7V A;  3OGA A;  3Q91 A;  1MQE A;  1VHZ A;  5GHQ A;  1JRK A;  3EES A;  3GWY A;  4K6E A;  1I9A A;  4N1U A;  3DKU A;  2DSC A;  2B2K A;  3FFU A;  1PUN A;  1JKN A;  5C8L A;  1PVF A;  4KYX A;  2A8S A;  1HZT A;  2KDV A;  3ID9 A;  3FSP A;  1PUS A;  1TUM A;  2YYH A;  3BHO A;  3X0O A;  2G74 A;  5DD4 A;  1X84 A;  4MPO A;  1R67 A;  3GZ5 A;  2VNP A;  4NFX A;  1V8S A;  3G0Q A;  3I9X A;  4S2W A;  3A6S A;  1V8Y A;  1V8I A;  1VIU A;  1VK6 A;  4JZT A;  5DPK A;  1KHZ A;  2O1C A;  3X0I A;  5GHJ A;  1Q33 A;  2B0V A;  2A8T A;  3GRN A;  2VNQ A;  2O5F A;  1MQW A;  1MP2 A;  1Q27 A;  3CNG A;  3I7U A;  5FSO A;  4ZG0 A;  2I6K A;  3RH7 A;  3WHW A;  3HHJ A;  3FK9 A;  4KTB A;  5ANT A;  2Q9P A;  3BAP A;  3AC9 A;  2A8P A;  1NFS A;  4JZV A;  2RRK A;  2DHO A;  2AZW A;  3SON A;  1SU2 A;  1U20 A;  3A6V A;  3F6A A;  5DEQ A;  2W4E A;  1MUT A;  3Q1P A;  3HYQ A;  5FSI A;  1IRY A;  1SJY A;  1RYA A;  3SHD A;  3F13 A;  3O52 A;  3X0K A;  5DDG A;  5ISY A;  3E57 A;  1MR2 A;  1V8U A;  4YPR A;  4JZU A;  1G9Q A;  2QJO A;  3Q2S A;  4ILQ A;  3DUP A;  3SMD A;  1V8W A;  3FCM A;  2CL3 A;  5ANV A;  3X0M A;  5IW5 A;  2YVO A;  3N9U A;  1VIQ A;  2ICJ A;  3J7Y e;  1V8L A;  1F3Y A;  2I8T A;  2FVV A;  3MCF A;  4J7H A;  2DSB A;  3A6T A;  1NFZ A;  2YVM A;  3H95 A;  3QSJ A;  5GHI A;  1GA7 A;  5GHN A;  1XSA A;  1KTG A;  1SZ3 A;  1XSC A;  2FML A;  2GT2 A;  2QKM B;  4V14 A;  1NQY A;  4DYW A;  3GG6 A;  3O69 A;  5CFJ A;  3Q4I A;  4YOQ A;  2ICK A;  3Q93 A;  5ANU A;  3MDG A;  3MDI A;  3BM4 A;  2I8U A;  4N1T A;  2G73 A;  3GZ6 A;  5GHO A;  4JZS A;  1V8V A;  4HVY A;  4NFW A;  3Q2T A;  5BON A;  3EEU A;  5GHP A;  5GHM A;  3O8S A;  1QVJ A;  3O61 A;  3R03 A;  1SOI A;  2GB5 A;  5I8U A;  3X0Q A;  3L85 A;  5C7T A;  1RRQ A;  1PUQ A;  3EF5 A;  5HZX A;  5FSM A;  1X51 A;  2DSD A;  3X0S A;  1VHG A;  1PPX A;  2A8R A;  3X0N A;  5ANS A;  3MGM A;  3O6Z A;  4S2V A;  5IW4 A;  3N77 A;  1G0S A;  4S2X A;  4KG4 A;  5LPG A;  1V8M A;  2O5W A;  4C9X A;  2JVB A;  2R5W A;  1V8T A;  3COU A;  1XSB A;  3X0R A;  4ICK A;  3EXQ A;  5FSN A;  4HFQ A;  4J7G A;  5BS6 A;  1VCD A;  1OW2 A;  2XSQ A;  1K2E A;  1PPW A;  4IJX A;  5FSL A;  2QJT A;  1K26 A;  1X83 A;  1HX3 A;  3ACA A;  4C9W A;  3P5T A; 
#chains in the Genus database with same CATH homology
 4YPH A;  1VC8 A;  2FKB A;  1NQZ A;  3U53 A;  3ZR0 A;  2A8Q A;  5CFI A;  3X0J A;  4S2Y A;  1V8N A;  2GT4 A;  1V8R A;  1VRL A;  2PNY A;  3GZ8 A;  2KDW A;  1VC9 A;  2YVP A;  3FJY A;  2J8Q A;  3X0L A;  1RRS A;  1Q54 A;  2PQV A;  2CZR A;  5ANW A;  3X0P A;  2B06 A;  5C7Q A;  3KVH A;  3A6U A;  5FSK A;  3ZR1 A;  1KT9 A;  2A6T A;  4KG3 A;  2YVN A;  2DUK A;  1MK1 A;  1PPV A;  3P6Y A;  3I7V A;  3OGA A;  3Q91 A;  1MQE A;  1VHZ A;  5GHQ A;  1JRK A;  3EES A;  3GWY A;  4K6E A;  1I9A A;  4N1U A;  3DKU A;  2DSC A;  2B2K A;  3FFU A;  1PUN A;  1JKN A;  5C8L A;  1PVF A;  4KYX A;  2A8S A;  1HZT A;  2KDV A;  3ID9 A;  3FSP A;  1PUS A;  1TUM A;  2YYH A;  3BHO A;  3X0O A;  2G74 A;  5DD4 A;  1X84 A;  4MPO A;  1R67 A;  3GZ5 A;  2VNP A;  4NFX A;  1V8S A;  3G0Q A;  3I9X A;  4S2W A;  3A6S A;  1V8Y A;  1V8I A;  1VIU A;  1VK6 A;  4JZT A;  5DPK A;  1KHZ A;  2O1C A;  3X0I A;  5GHJ A;  1Q33 A;  2B0V A;  2A8T A;  3GRN A;  2VNQ A;  2O5F A;  1MQW A;  1MP2 A;  1Q27 A;  3CNG A;  3I7U A;  5FSO A;  4ZG0 A;  2I6K A;  3RH7 A;  3WHW A;  3HHJ A;  3FK9 A;  4KTB A;  5ANT A;  2Q9P A;  3BAP A;  3AC9 A;  2A8P A;  1NFS A;  4JZV A;  2RRK A;  2DHO A;  2AZW A;  3SON A;  1SU2 A;  1U20 A;  3A6V A;  3F6A A;  5DEQ A;  2W4E A;  1MUT A;  3Q1P A;  3HYQ A;  5FSI A;  1IRY A;  1SJY A;  1RYA A;  3SHD A;  3F13 A;  3O52 A;  3X0K A;  5DDG A;  5ISY A;  3E57 A;  1MR2 A;  1V8U A;  4YPR A;  4JZU A;  1G9Q A;  2QJO A;  3Q2S A;  4ILQ A;  3DUP A;  3SMD A;  1V8W A;  3FCM A;  2CL3 A;  5ANV A;  3X0M A;  5IW5 A;  2YVO A;  3N9U A;  1VIQ A;  2ICJ A;  3J7Y e;  1V8L A;  1F3Y A;  2I8T A;  2FVV A;  3MCF A;  4J7H A;  2DSB A;  3A6T A;  1NFZ A;  2YVM A;  3H95 A;  3QSJ A;  5GHI A;  1GA7 A;  5GHN A;  1XSA A;  1KTG A;  1SZ3 A;  1XSC A;  2FML A;  2GT2 A;  2QKM B;  4V14 A;  1NQY A;  4DYW A;  3GG6 A;  3O69 A;  5CFJ A;  3Q4I A;  4YOQ A;  2ICK A;  3Q93 A;  5ANU A;  3MDG A;  3MDI A;  3BM4 A;  2I8U A;  4N1T A;  2G73 A;  3GZ6 A;  5GHO A;  4JZS A;  1V8V A;  4HVY A;  4NFW A;  3Q2T A;  5BON A;  3EEU A;  5GHP A;  5GHM A;  3O8S A;  1QVJ A;  3O61 A;  3R03 A;  1SOI A;  2GB5 A;  5I8U A;  3X0Q A;  3L85 A;  5C7T A;  1RRQ A;  1PUQ A;  3EF5 A;  5HZX A;  5FSM A;  1X51 A;  2DSD A;  3X0S A;  1VHG A;  1PPX A;  2A8R A;  3X0N A;  5ANS A;  3MGM A;  3O6Z A;  4S2V A;  5IW4 A;  3N77 A;  1G0S A;  4S2X A;  4KG4 A;  5LPG A;  1V8M A;  2O5W A;  4C9X A;  2JVB A;  2R5W A;  1V8T A;  3COU A;  1XSB A;  3X0R A;  4ICK A;  3EXQ A;  5FSN A;  4HFQ A;  4J7G A;  5BS6 A;  1VCD A;  1OW2 A;  2XSQ A;  1K2E A;  1PPW A;  4IJX A;  5FSL A;  2QJT A;  1K26 A;  1X83 A;  1HX3 A;  3ACA A;  4C9W A;  3P5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...