1PPXA

Solution structure of the mutt pyrophosphohydrolase complexed with mg(2+) and 8-oxo-dgmp, a tightly-bound product
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
129
structure length
129
Chain Sequence
MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Mutator mutT protein
publication title Solution structure and NH exchange studies of the MutT pyrophosphohydrolase complexed with Mg(2+) and 8-oxo-dGMP, a tightly bound product.
pubmed doi rcsb
source organism Escherichia coli
total genus 16
structure length 129
sequence length 129
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1ppxA00
1Q54A 2O5FA 4S2YA 5C8LA 2YVNA 2DUKA 3O8SA 4KTBA 5BS6A 3G0QA 2W4EA 3P6YA 4YPHA 1V8YA 2A6TA 2GT4A 3GZ6A 3Q4IA 1PUNA 1U20A 1X51A 3GG6A 3BAPA 3GWYA 5ANVA 2ICJA 1Q33A 2KDWA 5GHNA 1KTGA 1PPVA 3GRNA 2XSQA 2DSDA 1VC8A 2QJTA 1JRKA 4JZTA 1MUTA 3BHOA 2I8UA 4NFWA 3X0LA 3ZR0A 5ANWA 3MGMA 3FSPA 1TUMA 2KDVA 3U53A 3Q2TA 2I6KA 4ILQA 4ZG0A 3EEUA 3KVHA 1V8LA 2QKMB 3CNGA 3EXQA 3EF5A 5ANUA 3O6ZA 3SHDA 1VK6A 1XSCA 5FSNA 5GHPA 4YPRA 1RYAA 1PPWA 4ICKA 2A8RA 5DEQA 3X0JA 3J7Ye 3X0SA 3A6SA 5DD4A 3F13A 3I9XA 3P5TA 2B0VA 1NQZA 1VIUA 3L85A 3COUA 3X0IA 5ANSA 1MP2A 1V8MA 5DDGA 1F3YA 1I9AA 5DPKA 2A8QA 3O61A 1Q27A 5FSIA 1RRQA 4NFXA 1RRSA 2O5WA 3R03A 1PPXA 2R5WA 2B06A 1X84A 2O1CA 1NQYA 1VRLA 2I8TA 5CFIA 1V8IA 3Q2SA 4KG3A 4JZVA 5GHIA 1V8VA 1NFSA 2A8TA 4V14A 2B2KA 3X0RA 3N77A 1MR2A 2G73A 2RRKA 3I7UA 1V8WA 3MCFA 3ZR1A 1VHZA 3X0OA 1VCDA 3X0PA 2DSCA 2JVBA 4JZSA 1IRYA 4KG4A 3Q93A 1K2EA 5HZXA 1OW2A 3DKUA 1SZ3A 5FSLA 5GHQA 5IW5A 1MQEA 4C9WA 3I7VA 2G74A 4KYXA 2VNQA 3EESA 1X83A 4N1TA 1G0SA 3Q1PA 1PUSA 3RH7A 1JKNA 3E57A 3MDIA 1MQWA 1XSAA 1MK1A 2GB5A 3A6TA 5FSOA 3O69A 1SU2A 1V8SA 3OGAA 5C7TA 3QSJA 3O52A 3GZ5A 1PUQA 1V8UA 2QJOA 1VC9A 3A6UA 2DHOA 3BM4A 3F6AA 5BONA 3ACAA 1V8TA 2PNYA 4S2WA 1VHGA 2CL3A 3DUPA 5FSKA 4S2XA 3MDGA 2A8SA 2AZWA 4IJXA 1V8RA 2VNPA 2PQVA 1SOIA 2YVOA 1HX3A 2YVPA 3X0KA 1KHZA 2FMLA 1PVFA 5CFJA 4YOQA 4JZUA 3FJYA 3SMDA 1VIQA 5ANTA 5GHMA 2FVVA 3ID9A 5FSMA 4C9XA 3X0QA 3HHJA 3FK9A 5GHOA 3HYQA 2A8PA 3X0MA 1R67A 1V8NA 2Q9PA 1GA7A 1QVJA 2ICKA 2DSBA 4HFQA 5ISYA 3SONA 4K6EA 4MPOA 1K26A 4DYWA 2GT2A 1KT9A 1XSBA 4N1UA 3A6VA 3N9UA 5LPGA 3H95A 4S2VA 3GZ8A 5GHJA 2J8QA 4HVYA 3FFUA 2FKBA 2YVMA 3WHWA 1SJYA 3X0NA 1G9QA 3AC9A 5C7QA 2YYHA 5I8UA 5IW4A 1HZTA 3Q91A 1NFZA 3FCMA
chains in the Genus database with same CATH superfamily
1Q54A 2O5FA 4S2YA 5C8LA 2YVNA 2DUKA 3O8SA 4KTBA 5BS6A 3G0QA 2W4EA 3P6YA 4YPHA 1V8YA 2A6TA 2GT4A 3GZ6A 3Q4IA 1PUNA 1U20A 1X51A 3GG6A 3BAPA 3GWYA 5ANVA 2ICJA 1Q33A 2KDWA 5GHNA 1KTGA 1PPVA 3GRNA 2XSQA 2DSDA 1VC8A 2QJTA 1JRKA 4JZTA 1MUTA 3BHOA 2I8UA 4NFWA 3X0LA 3ZR0A 4J7HA 5ANWA 3MGMA 3FSPA 1TUMA 2KDVA 3U53A 3Q2TA 2I6KA 4ILQA 4ZG0A 3EEUA 3KVHA 1V8LA 2QKMB 3CNGA 3EXQA 3EF5A 5ANUA 3O6ZA 3SHDA 1VK6A 1XSCA 5FSNA 5GHPA 4YPRA 1RYAA 1PPWA 4ICKA 2A8RA 5DEQA 3X0JA 3J7Ye 3X0SA 3A6SA 5DD4A 3F13A 3I9XA 3P5TA 2B0VA 1NQZA 1VIUA 3L85A 3COUA 3X0IA 5ANSA 1MP2A 1V8MA 5DDGA 1F3YA 1I9AA 5DPKA 2A8QA 3O61A 1Q27A 5FSIA 1RRQA 4NFXA 1RRSA 2O5WA 3R03A 1PPXA 2R5WA 2B06A 1X84A 2O1CA 1NQYA 1VRLA 2I8TA 5CFIA 1V8IA 3Q2SA 4KG3A 4JZVA 5GHIA 1V8VA 1NFSA 2A8TA 4V14A 2B2KA 3X0RA 3N77A 1MR2A 2G73A 2RRKA 3I7UA 1V8WA 3MCFA 3ZR1A 1VHZA 3X0OA 1VCDA 3X0PA 2DSCA 2JVBA 4JZSA 1IRYA 4KG4A 3Q93A 1K2EA 5HZXA 1OW2A 3DKUA 1SZ3A 5FSLA 5GHQA 5IW5A 1MQEA 4C9WA 3I7VA 2G74A 4KYXA 2VNQA 3EESA 1X83A 4N1TA 1G0SA 3Q1PA 1PUSA 3RH7A 1JKNA 3E57A 3MDIA 1MQWA 1XSAA 1MK1A 2GB5A 3A6TA 5FSOA 3O69A 1SU2A 1V8SA 3OGAA 5C7TA 3QSJA 3O52A 3GZ5A 1PUQA 1V8UA 2QJOA 1VC9A 3A6UA 2DHOA 3BM4A 3F6AA 5BONA 3ACAA 1V8TA 2PNYA 4S2WA 1VHGA 2CL3A 3DUPA 5FSKA 4S2XA 3MDGA 2A8SA 2AZWA 4IJXA 1V8RA 2VNPA 2PQVA 1SOIA 2YVOA 1HX3A 2YVPA 3X0KA 1KHZA 2FMLA 1PVFA 5CFJA 4YOQA 4JZUA 3FJYA 3SMDA 1VIQA 5ANTA 5GHMA 2FVVA 3ID9A 5FSMA 4C9XA 3X0QA 3HHJA 3FK9A 5GHOA 3HYQA 2A8PA 3X0MA 1R67A 1V8NA 2Q9PA 1GA7A 1QVJA 2ICKA 2DSBA 4HFQA 5ISYA 3SONA 4K6EA 4MPOA 1K26A 4DYWA 2GT2A 1KT9A 1XSBA 4N1UA 3A6VA 3N9UA 5LPGA 3H95A 4S2VA 3GZ8A 5GHJA 2J8QA 4HVYA 2CZRA 3FFUA 2FKBA 2YVMA 3WHWA 1SJYA 3X0NA 1G9QA 3AC9A 5C7QA 4J7GA 2YYHA 5I8UA 5IW4A 1HZTA 3Q91A 1NFZA 3FCMA
chains in the Genus database with same CATH topology
1Q54A 2O5FA 4S2YA 5C8LA 2YVNA 2DUKA 3O8SA 4KTBA 5BS6A 3G0QA 2W4EA 3P6YA 4YPHA 1V8YA 2A6TA 2GT4A 3GZ6A 3Q4IA 1PUNA 1U20A 1X51A 3GG6A 3BAPA 3GWYA 5ANVA 2ICJA 1Q33A 2KDWA 5GHNA 1KTGA 1PPVA 3GRNA 2XSQA 2DSDA 1VC8A 2QJTA 1JRKA 4JZTA 1MUTA 3BHOA 2I8UA 4NFWA 3X0LA 3ZR0A 4J7HA 5ANWA 3MGMA 3FSPA 1TUMA 2KDVA 3U53A 3Q2TA 2I6KA 4ILQA 4ZG0A 3EEUA 3KVHA 1V8LA 2QKMB 3CNGA 3EXQA 3EF5A 5ANUA 3O6ZA 3SHDA 1VK6A 1XSCA 5FSNA 5GHPA 4YPRA 1RYAA 1PPWA 4ICKA 2A8RA 5DEQA 3X0JA 3J7Ye 3X0SA 3A6SA 5DD4A 3F13A 3I9XA 3P5TA 2B0VA 1NQZA 1VIUA 3L85A 3COUA 3X0IA 5ANSA 1MP2A 1V8MA 5DDGA 1F3YA 1I9AA 5DPKA 2A8QA 3O61A 1Q27A 5FSIA 1RRQA 4NFXA 1RRSA 2O5WA 3R03A 1PPXA 2R5WA 2B06A 1X84A 2O1CA 1NQYA 1VRLA 2I8TA 5CFIA 1V8IA 3Q2SA 4KG3A 4JZVA 5GHIA 1V8VA 1NFSA 2A8TA 4V14A 2B2KA 3X0RA 3N77A 1MR2A 2G73A 2RRKA 3I7UA 1V8WA 3MCFA 3ZR1A 1VHZA 3X0OA 1VCDA 3X0PA 2DSCA 2JVBA 4JZSA 1IRYA 4KG4A 3Q93A 1K2EA 5HZXA 1OW2A 3DKUA 1SZ3A 5FSLA 5GHQA 5IW5A 1MQEA 4C9WA 3I7VA 2G74A 4KYXA 2VNQA 3EESA 1X83A 4N1TA 1G0SA 3Q1PA 1PUSA 3RH7A 1JKNA 3E57A 3MDIA 1MQWA 1XSAA 1MK1A 2GB5A 3A6TA 5FSOA 3O69A 1SU2A 1V8SA 3OGAA 5C7TA 3QSJA 3O52A 3GZ5A 1PUQA 1V8UA 2QJOA 1VC9A 3A6UA 2DHOA 3BM4A 3F6AA 5BONA 3ACAA 1V8TA 2PNYA 4S2WA 1VHGA 2CL3A 3DUPA 5FSKA 4S2XA 3MDGA 2A8SA 2AZWA 4IJXA 1V8RA 2VNPA 2PQVA 1SOIA 2YVOA 1HX3A 2YVPA 3X0KA 1KHZA 2FMLA 1PVFA 5CFJA 4YOQA 4JZUA 3FJYA 3SMDA 1VIQA 5ANTA 5GHMA 2FVVA 3ID9A 5FSMA 4C9XA 3X0QA 3HHJA 3FK9A 5GHOA 3HYQA 2A8PA 3X0MA 1R67A 1V8NA 2Q9PA 1GA7A 1QVJA 2ICKA 2DSBA 4HFQA 5ISYA 3SONA 4K6EA 4MPOA 1K26A 4DYWA 2GT2A 1KT9A 1XSBA 4N1UA 3A6VA 3N9UA 5LPGA 3H95A 4S2VA 3GZ8A 5GHJA 2J8QA 4HVYA 2CZRA 3FFUA 2FKBA 2YVMA 3WHWA 1SJYA 3X0NA 1G9QA 3AC9A 5C7QA 4J7GA 2YYHA 5I8UA 5IW4A 1HZTA 3Q91A 1NFZA 3FCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q54 A;  2O5F A;  4S2Y A;  5C8L A;  2YVN A;  2DUK A;  3O8S A;  4KTB A;  5BS6 A;  3G0Q A;  2W4E A;  3P6Y A;  4YPH A;  1V8Y A;  2A6T A;  2GT4 A;  3GZ6 A;  3Q4I A;  1PUN A;  1U20 A;  1X51 A;  3GG6 A;  3BAP A;  3GWY A;  5ANV A;  2ICJ A;  1Q33 A;  2KDW A;  5GHN A;  1KTG A;  1PPV A;  3GRN A;  2XSQ A;  2DSD A;  1VC8 A;  2QJT A;  1JRK A;  4JZT A;  1MUT A;  3BHO A;  2I8U A;  4NFW A;  3X0L A;  3ZR0 A;  5ANW A;  3MGM A;  3FSP A;  1TUM A;  2KDV A;  3U53 A;  3Q2T A;  2I6K A;  4ILQ A;  4ZG0 A;  3EEU A;  3KVH A;  1V8L A;  2QKM B;  3CNG A;  3EXQ A;  3EF5 A;  5ANU A;  3O6Z A;  3SHD A;  1VK6 A;  1XSC A;  5FSN A;  5GHP A;  4YPR A;  1RYA A;  1PPW A;  4ICK A;  2A8R A;  5DEQ A;  3X0J A;  3J7Y e;  3X0S A;  3A6S A;  5DD4 A;  3F13 A;  3I9X A;  3P5T A;  2B0V A;  1NQZ A;  1VIU A;  3L85 A;  3COU A;  3X0I A;  5ANS A;  1MP2 A;  1V8M A;  5DDG A;  1F3Y A;  1I9A A;  5DPK A;  2A8Q A;  3O61 A;  1Q27 A;  5FSI A;  1RRQ A;  4NFX A;  1RRS A;  2O5W A;  3R03 A;  1PPX A;  2R5W A;  2B06 A;  1X84 A;  2O1C A;  1NQY A;  1VRL A;  2I8T A;  5CFI A;  1V8I A;  3Q2S A;  4KG3 A;  4JZV A;  5GHI A;  1V8V A;  1NFS A;  2A8T A;  4V14 A;  2B2K A;  3X0R A;  3N77 A;  1MR2 A;  2G73 A;  2RRK A;  3I7U A;  1V8W A;  3MCF A;  3ZR1 A;  1VHZ A;  3X0O A;  1VCD A;  3X0P A;  2DSC A;  2JVB A;  4JZS A;  1IRY A;  4KG4 A;  3Q93 A;  1K2E A;  5HZX A;  1OW2 A;  3DKU A;  1SZ3 A;  5FSL A;  5GHQ A;  5IW5 A;  1MQE A;  4C9W A;  3I7V A;  2G74 A;  4KYX A;  2VNQ A;  3EES A;  1X83 A;  4N1T A;  1G0S A;  3Q1P A;  1PUS A;  3RH7 A;  1JKN A;  3E57 A;  3MDI A;  1MQW A;  1XSA A;  1MK1 A;  2GB5 A;  3A6T A;  5FSO A;  3O69 A;  1SU2 A;  1V8S A;  3OGA A;  5C7T A;  3QSJ A;  3O52 A;  3GZ5 A;  1PUQ A;  1V8U A;  2QJO A;  1VC9 A;  3A6U A;  2DHO A;  3BM4 A;  3F6A A;  5BON A;  3ACA A;  1V8T A;  2PNY A;  4S2W A;  1VHG A;  2CL3 A;  3DUP A;  5FSK A;  4S2X A;  3MDG A;  2A8S A;  2AZW A;  4IJX A;  1V8R A;  2VNP A;  2PQV A;  1SOI A;  2YVO A;  1HX3 A;  2YVP A;  3X0K A;  1KHZ A;  2FML A;  1PVF A;  5CFJ A;  4YOQ A;  4JZU A;  3FJY A;  3SMD A;  1VIQ A;  5ANT A;  5GHM A;  2FVV A;  3ID9 A;  5FSM A;  4C9X A;  3X0Q A;  3HHJ A;  3FK9 A;  5GHO A;  3HYQ A;  2A8P A;  3X0M A;  1R67 A;  1V8N A;  2Q9P A;  1GA7 A;  1QVJ A;  2ICK A;  2DSB A;  4HFQ A;  5ISY A;  3SON A;  4K6E A;  4MPO A;  1K26 A;  4DYW A;  2GT2 A;  1KT9 A;  1XSB A;  4N1U A;  3A6V A;  3N9U A;  5LPG A;  3H95 A;  4S2V A;  3GZ8 A;  5GHJ A;  2J8Q A;  4HVY A;  3FFU A;  2FKB A;  2YVM A;  3WHW A;  1SJY A;  3X0N A;  1G9Q A;  3AC9 A;  5C7Q A;  2YYH A;  5I8U A;  5IW4 A;  1HZT A;  3Q91 A;  1NFZ A;  3FCM A; 
#chains in the Genus database with same CATH topology
 1Q54 A;  2O5F A;  4S2Y A;  5C8L A;  2YVN A;  2DUK A;  3O8S A;  4KTB A;  5BS6 A;  3G0Q A;  2W4E A;  3P6Y A;  4YPH A;  1V8Y A;  2A6T A;  2GT4 A;  3GZ6 A;  3Q4I A;  1PUN A;  1U20 A;  1X51 A;  3GG6 A;  3BAP A;  3GWY A;  5ANV A;  2ICJ A;  1Q33 A;  2KDW A;  5GHN A;  1KTG A;  1PPV A;  3GRN A;  2XSQ A;  2DSD A;  1VC8 A;  2QJT A;  1JRK A;  4JZT A;  1MUT A;  3BHO A;  2I8U A;  4NFW A;  3X0L A;  3ZR0 A;  4J7H A;  5ANW A;  3MGM A;  3FSP A;  1TUM A;  2KDV A;  3U53 A;  3Q2T A;  2I6K A;  4ILQ A;  4ZG0 A;  3EEU A;  3KVH A;  1V8L A;  2QKM B;  3CNG A;  3EXQ A;  3EF5 A;  5ANU A;  3O6Z A;  3SHD A;  1VK6 A;  1XSC A;  5FSN A;  5GHP A;  4YPR A;  1RYA A;  1PPW A;  4ICK A;  2A8R A;  5DEQ A;  3X0J A;  3J7Y e;  3X0S A;  3A6S A;  5DD4 A;  3F13 A;  3I9X A;  3P5T A;  2B0V A;  1NQZ A;  1VIU A;  3L85 A;  3COU A;  3X0I A;  5ANS A;  1MP2 A;  1V8M A;  5DDG A;  1F3Y A;  1I9A A;  5DPK A;  2A8Q A;  3O61 A;  1Q27 A;  5FSI A;  1RRQ A;  4NFX A;  1RRS A;  2O5W A;  3R03 A;  1PPX A;  2R5W A;  2B06 A;  1X84 A;  2O1C A;  1NQY A;  1VRL A;  2I8T A;  5CFI A;  1V8I A;  3Q2S A;  4KG3 A;  4JZV A;  5GHI A;  1V8V A;  1NFS A;  2A8T A;  4V14 A;  2B2K A;  3X0R A;  3N77 A;  1MR2 A;  2G73 A;  2RRK A;  3I7U A;  1V8W A;  3MCF A;  3ZR1 A;  1VHZ A;  3X0O A;  1VCD A;  3X0P A;  2DSC A;  2JVB A;  4JZS A;  1IRY A;  4KG4 A;  3Q93 A;  1K2E A;  5HZX A;  1OW2 A;  3DKU A;  1SZ3 A;  5FSL A;  5GHQ A;  5IW5 A;  1MQE A;  4C9W A;  3I7V A;  2G74 A;  4KYX A;  2VNQ A;  3EES A;  1X83 A;  4N1T A;  1G0S A;  3Q1P A;  1PUS A;  3RH7 A;  1JKN A;  3E57 A;  3MDI A;  1MQW A;  1XSA A;  1MK1 A;  2GB5 A;  3A6T A;  5FSO A;  3O69 A;  1SU2 A;  1V8S A;  3OGA A;  5C7T A;  3QSJ A;  3O52 A;  3GZ5 A;  1PUQ A;  1V8U A;  2QJO A;  1VC9 A;  3A6U A;  2DHO A;  3BM4 A;  3F6A A;  5BON A;  3ACA A;  1V8T A;  2PNY A;  4S2W A;  1VHG A;  2CL3 A;  3DUP A;  5FSK A;  4S2X A;  3MDG A;  2A8S A;  2AZW A;  4IJX A;  1V8R A;  2VNP A;  2PQV A;  1SOI A;  2YVO A;  1HX3 A;  2YVP A;  3X0K A;  1KHZ A;  2FML A;  1PVF A;  5CFJ A;  4YOQ A;  4JZU A;  3FJY A;  3SMD A;  1VIQ A;  5ANT A;  5GHM A;  2FVV A;  3ID9 A;  5FSM A;  4C9X A;  3X0Q A;  3HHJ A;  3FK9 A;  5GHO A;  3HYQ A;  2A8P A;  3X0M A;  1R67 A;  1V8N A;  2Q9P A;  1GA7 A;  1QVJ A;  2ICK A;  2DSB A;  4HFQ A;  5ISY A;  3SON A;  4K6E A;  4MPO A;  1K26 A;  4DYW A;  2GT2 A;  1KT9 A;  1XSB A;  4N1U A;  3A6V A;  3N9U A;  5LPG A;  3H95 A;  4S2V A;  3GZ8 A;  5GHJ A;  2J8Q A;  4HVY A;  2CZR A;  3FFU A;  2FKB A;  2YVM A;  3WHW A;  1SJY A;  3X0N A;  1G9Q A;  3AC9 A;  5C7Q A;  4J7G A;  2YYH A;  5I8U A;  5IW4 A;  1HZT A;  3Q91 A;  1NFZ A;  3FCM A; 
#chains in the Genus database with same CATH homology
 1Q54 A;  2O5F A;  4S2Y A;  5C8L A;  2YVN A;  2DUK A;  3O8S A;  4KTB A;  5BS6 A;  3G0Q A;  2W4E A;  3P6Y A;  4YPH A;  1V8Y A;  2A6T A;  2GT4 A;  3GZ6 A;  3Q4I A;  1PUN A;  1U20 A;  1X51 A;  3GG6 A;  3BAP A;  3GWY A;  5ANV A;  2ICJ A;  1Q33 A;  2KDW A;  5GHN A;  1KTG A;  1PPV A;  3GRN A;  2XSQ A;  2DSD A;  1VC8 A;  2QJT A;  1JRK A;  4JZT A;  1MUT A;  3BHO A;  2I8U A;  4NFW A;  3X0L A;  3ZR0 A;  4J7H A;  5ANW A;  3MGM A;  3FSP A;  1TUM A;  2KDV A;  3U53 A;  3Q2T A;  2I6K A;  4ILQ A;  4ZG0 A;  3EEU A;  3KVH A;  1V8L A;  2QKM B;  3CNG A;  3EXQ A;  3EF5 A;  5ANU A;  3O6Z A;  3SHD A;  1VK6 A;  1XSC A;  5FSN A;  5GHP A;  4YPR A;  1RYA A;  1PPW A;  4ICK A;  2A8R A;  5DEQ A;  3X0J A;  3J7Y e;  3X0S A;  3A6S A;  5DD4 A;  3F13 A;  3I9X A;  3P5T A;  2B0V A;  1NQZ A;  1VIU A;  3L85 A;  3COU A;  3X0I A;  5ANS A;  1MP2 A;  1V8M A;  5DDG A;  1F3Y A;  1I9A A;  5DPK A;  2A8Q A;  3O61 A;  1Q27 A;  5FSI A;  1RRQ A;  4NFX A;  1RRS A;  2O5W A;  3R03 A;  1PPX A;  2R5W A;  2B06 A;  1X84 A;  2O1C A;  1NQY A;  1VRL A;  2I8T A;  5CFI A;  1V8I A;  3Q2S A;  4KG3 A;  4JZV A;  5GHI A;  1V8V A;  1NFS A;  2A8T A;  4V14 A;  2B2K A;  3X0R A;  3N77 A;  1MR2 A;  2G73 A;  2RRK A;  3I7U A;  1V8W A;  3MCF A;  3ZR1 A;  1VHZ A;  3X0O A;  1VCD A;  3X0P A;  2DSC A;  2JVB A;  4JZS A;  1IRY A;  4KG4 A;  3Q93 A;  1K2E A;  5HZX A;  1OW2 A;  3DKU A;  1SZ3 A;  5FSL A;  5GHQ A;  5IW5 A;  1MQE A;  4C9W A;  3I7V A;  2G74 A;  4KYX A;  2VNQ A;  3EES A;  1X83 A;  4N1T A;  1G0S A;  3Q1P A;  1PUS A;  3RH7 A;  1JKN A;  3E57 A;  3MDI A;  1MQW A;  1XSA A;  1MK1 A;  2GB5 A;  3A6T A;  5FSO A;  3O69 A;  1SU2 A;  1V8S A;  3OGA A;  5C7T A;  3QSJ A;  3O52 A;  3GZ5 A;  1PUQ A;  1V8U A;  2QJO A;  1VC9 A;  3A6U A;  2DHO A;  3BM4 A;  3F6A A;  5BON A;  3ACA A;  1V8T A;  2PNY A;  4S2W A;  1VHG A;  2CL3 A;  3DUP A;  5FSK A;  4S2X A;  3MDG A;  2A8S A;  2AZW A;  4IJX A;  1V8R A;  2VNP A;  2PQV A;  1SOI A;  2YVO A;  1HX3 A;  2YVP A;  3X0K A;  1KHZ A;  2FML A;  1PVF A;  5CFJ A;  4YOQ A;  4JZU A;  3FJY A;  3SMD A;  1VIQ A;  5ANT A;  5GHM A;  2FVV A;  3ID9 A;  5FSM A;  4C9X A;  3X0Q A;  3HHJ A;  3FK9 A;  5GHO A;  3HYQ A;  2A8P A;  3X0M A;  1R67 A;  1V8N A;  2Q9P A;  1GA7 A;  1QVJ A;  2ICK A;  2DSB A;  4HFQ A;  5ISY A;  3SON A;  4K6E A;  4MPO A;  1K26 A;  4DYW A;  2GT2 A;  1KT9 A;  1XSB A;  4N1U A;  3A6V A;  3N9U A;  5LPG A;  3H95 A;  4S2V A;  3GZ8 A;  5GHJ A;  2J8Q A;  4HVY A;  2CZR A;  3FFU A;  2FKB A;  2YVM A;  3WHW A;  1SJY A;  3X0N A;  1G9Q A;  3AC9 A;  5C7Q A;  4J7G A;  2YYH A;  5I8U A;  5IW4 A;  1HZT A;  3Q91 A;  1NFZ A;  3FCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...