4NFWA

Structure and atypical hydrolysis mechanism of the nudix hydrolase orf153 (ymfb) from escherichia coli
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
MFKPHVTVACVVHAEGKFLVVEETINGKALWNQPAGHLEADETLVEAAARELWEETGISAQPQHFIRMHQWIAPDKTPFLRFLFAIELEQICPTQPHDSDIDCCRWVSAEEILQASNLRSPLVAESIRCYQSGQRYPLEMIGDFNWPFTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative Nudix hydrolase ymfB
publication title Divalent metal ion-based catalytic mechanism of the Nudix hydrolase Orf153 (YmfB) from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
total genus 38
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2013-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 4nfwA00
1K2EA 3GZ8A 1V8VA 5GHNA 3MDIA 2QKMB 2A8RA 3G0QA 3MDGA 1IRYA 4YPHA 1NQZA 1U20A 2PNYA 1VHGA 3F13A 3GG6A 1SU2A 5DD4A 3SHDA 3FJYA 5DPKA 3E57A 1XSCA 2YYHA 3KVHA 3MGMA 5GHMA 1NFSA 4ICKA 4N1UA 3EEUA 4S2YA 5DDGA 1RRQA 4KG4A 1Q27A 3H95A 3U53A 1V8WA 2I8UA 4JZSA 2YVOA 3X0QA 1SZ3A 3X0SA 3ACAA 1PUQA 1V8RA 2QJOA 1MUTA 2J8QA 3Q2SA 3DUPA 3Q91A 1VIUA 3Q93A 5GHQA 2G73A 2B0VA 3BAPA 4C9XA 3AC9A 2DHOA 3CNGA 5ANVA 5IW4A 2FVVA 2DSCA 1PPWA 3ZR0A 3RH7A 2DSBA 1VC8A 1I9AA 5ANSA 4HVYA 3A6TA 5ANWA 4DYWA 3I7VA 3R03A 1PPXA 2DUKA 1PPVA 4S2VA 1V8YA 1RRSA 1JKNA 2RRKA 1HZTA 3MCFA 5ANUA 3FFUA 2VNQA 2XSQA 1F3YA 3N9UA 1Q33A 5BS6A 3A6UA 5I8UA 1G9QA 2GT2A 2I6KA 2VNPA 1X51A 2PQVA 4N1TA 2FMLA 1VC9A 1PVFA 5CFJA 3COUA 3OGAA 3Q2TA 3O69A 5C7TA 4S2XA 1MQWA 3O52A 3SONA 4JZUA 3GZ6A 3N77A 1MR2A 3FCMA 5DEQA 1V8IA 1MP2A 3FK9A 3GWYA 5GHJA 5GHPA 4IJXA 5LPGA 2KDWA 5GHOA 1V8UA 3HYQA 1TUMA 2A8PA 2AZWA 1SOIA 3WHWA 4KYXA 1V8NA 3GZ5A 1VK6A 5IW5A 3I7UA 1GA7A 5GHIA 1G0SA 5BONA 3P5TA 5C7QA 3GRNA 4S2WA 3Q1PA 1VRLA 2A8TA 1XSBA 3O6ZA 2JVBA 2DSDA 2ICKA 4NFXA 2A6TA 5FSKA 3X0NA 5CFIA 4YPRA 5FSLA 3SMDA 1X84A 3BM4A 3A6SA 3X0RA 2KDVA 2Q9PA 2QJTA 2I8TA 3O8SA 5FSIA 2O5WA 1R67A 1X83A 3F6AA 1NQYA 2A8QA 2B06A 2B2KA 1MK1A 1JRKA 3Q4IA 3ZR1A 1V8SA 2GT4A 3FSPA 1QVJA 1VHZA 5ISYA 3I9XA 5C8LA 2CL3A 3DKUA 5HZXA 1KTGA 2ICJA 4ILQA 2O5FA 4HFQA 4JZTA 2O1CA 1SJYA 2W4EA 3EESA 4V14A 5FSOA 3X0KA 3X0PA 5FSMA 2G74A 1RYAA 2R5WA 1XSAA 1MQEA 1K26A 1KHZA 3ID9A 5FSNA 4C9WA 4K6EA 3QSJA 2YVPA 1VCDA 2FKBA 3EF5A 3EXQA 3O61A 3X0LA 1V8TA 4KG3A 4ZG0A 1OW2A 3L85A 2YVNA 4MPOA 2GB5A 4KTBA 3J7Ye 3X0JA 1Q54A 3BHOA 3X0IA 3HHJA 3X0MA 1PUNA 1V8MA 5ANTA 1PUSA 3A6VA 4YOQA 2A8SA 4JZVA 1HX3A 1KT9A 4NFWA 3P6YA 1VIQA 1V8LA 2YVMA 1NFZA 3X0OA
chains in the Genus database with same CATH superfamily
1K2EA 3GZ8A 1V8VA 5GHNA 3MDIA 2QKMB 2A8RA 3G0QA 3MDGA 1IRYA 4YPHA 1NQZA 1U20A 2PNYA 1VHGA 3F13A 3GG6A 1SU2A 5DD4A 3SHDA 3FJYA 5DPKA 3E57A 1XSCA 2YYHA 3KVHA 3MGMA 5GHMA 1NFSA 4ICKA 4J7GA 3EEUA 4N1UA 5DDGA 4S2YA 1RRQA 4KG4A 1Q27A 3H95A 3U53A 1V8WA 2I8UA 4JZSA 2YVOA 3X0QA 1SZ3A 3X0SA 3ACAA 1PUQA 1V8RA 2QJOA 1MUTA 2J8QA 3Q2SA 3DUPA 3Q91A 1VIUA 3Q93A 5GHQA 2G73A 2B0VA 3BAPA 4C9XA 3AC9A 2DHOA 3CNGA 5ANVA 5IW4A 2FVVA 2DSCA 1PPWA 3ZR0A 3RH7A 2DSBA 1VC8A 1I9AA 5ANSA 4HVYA 3A6TA 5ANWA 4DYWA 3I7VA 3R03A 1PPXA 2DUKA 1PPVA 4S2VA 1V8YA 1RRSA 1JKNA 2RRKA 1HZTA 3MCFA 5ANUA 3FFUA 2VNQA 2XSQA 1F3YA 3N9UA 1Q33A 5BS6A 3A6UA 5I8UA 1G9QA 2GT2A 2I6KA 2VNPA 1X51A 2PQVA 4N1TA 2FMLA 1VC9A 1PVFA 5CFJA 3COUA 3OGAA 3Q2TA 3O69A 5C7TA 4S2XA 1MQWA 3O52A 3SONA 4JZUA 3GZ6A 3N77A 1MR2A 3FCMA 5DEQA 1V8IA 1MP2A 3FK9A 3GWYA 5GHJA 5GHPA 4IJXA 5LPGA 2KDWA 5GHOA 1V8UA 3HYQA 1TUMA 2A8PA 2AZWA 1SOIA 3WHWA 4KYXA 1V8NA 3GZ5A 1VK6A 5IW5A 3I7UA 1GA7A 5GHIA 1G0SA 5BONA 3P5TA 5C7QA 3GRNA 4S2WA 3Q1PA 1VRLA 2A8TA 1XSBA 3O6ZA 2JVBA 2DSDA 2ICKA 4NFXA 2A6TA 5FSKA 3X0NA 5CFIA 4YPRA 5FSLA 3SMDA 1X84A 3BM4A 3A6SA 3X0RA 2KDVA 2Q9PA 2QJTA 2I8TA 3O8SA 5FSIA 2O5WA 1R67A 1X83A 3F6AA 1NQYA 2A8QA 2B06A 2B2KA 1MK1A 1JRKA 3Q4IA 3ZR1A 1V8SA 2GT4A 3FSPA 1QVJA 1VHZA 5ISYA 3I9XA 4J7HA 5C8LA 2CL3A 3DKUA 5HZXA 1KTGA 2ICJA 4ILQA 2O5FA 4HFQA 4JZTA 2O1CA 1SJYA 2W4EA 3EESA 4V14A 5FSOA 3X0KA 3X0PA 5FSMA 2G74A 1RYAA 2R5WA 1XSAA 1MQEA 1K26A 1KHZA 3ID9A 5FSNA 4C9WA 4K6EA 2CZRA 3QSJA 2YVPA 1VCDA 2FKBA 3EF5A 3EXQA 3O61A 3X0LA 1V8TA 4KG3A 4ZG0A 1OW2A 3L85A 2YVNA 4MPOA 2GB5A 4KTBA 3J7Ye 3X0JA 1Q54A 3BHOA 3X0IA 3HHJA 3X0MA 1PUNA 1V8MA 5ANTA 1PUSA 3A6VA 4YOQA 2A8SA 4JZVA 1HX3A 1KT9A 4NFWA 3P6YA 1VIQA 1V8LA 2YVMA 1NFZA 3X0OA
chains in the Genus database with same CATH topology
1K2EA 3GZ8A 1V8VA 5GHNA 3MDIA 2QKMB 2A8RA 3G0QA 3MDGA 1IRYA 4YPHA 1NQZA 1U20A 2PNYA 1VHGA 3F13A 3GG6A 1SU2A 5DD4A 3SHDA 3FJYA 5DPKA 3E57A 1XSCA 2YYHA 3KVHA 3MGMA 5GHMA 1NFSA 4ICKA 4J7GA 3EEUA 4N1UA 5DDGA 4S2YA 1RRQA 4KG4A 1Q27A 3H95A 3U53A 1V8WA 2I8UA 4JZSA 2YVOA 3X0QA 1SZ3A 3X0SA 3ACAA 1PUQA 1V8RA 2QJOA 1MUTA 2J8QA 3Q2SA 3DUPA 3Q91A 1VIUA 3Q93A 5GHQA 2G73A 2B0VA 3BAPA 4C9XA 3AC9A 2DHOA 3CNGA 5ANVA 5IW4A 2FVVA 2DSCA 1PPWA 3ZR0A 3RH7A 2DSBA 1VC8A 1I9AA 5ANSA 4HVYA 3A6TA 5ANWA 4DYWA 3I7VA 3R03A 1PPXA 2DUKA 1PPVA 4S2VA 1V8YA 1RRSA 1JKNA 2RRKA 1HZTA 3MCFA 5ANUA 3FFUA 2VNQA 2XSQA 1F3YA 3N9UA 1Q33A 5BS6A 3A6UA 5I8UA 1G9QA 2GT2A 2I6KA 2VNPA 1X51A 2PQVA 4N1TA 2FMLA 1VC9A 1PVFA 5CFJA 3COUA 3OGAA 3Q2TA 3O69A 5C7TA 4S2XA 1MQWA 3O52A 3SONA 4JZUA 3GZ6A 3N77A 1MR2A 3FCMA 5DEQA 1V8IA 1MP2A 3FK9A 3GWYA 5GHJA 5GHPA 4IJXA 5LPGA 2KDWA 5GHOA 1V8UA 3HYQA 1TUMA 2A8PA 2AZWA 1SOIA 3WHWA 4KYXA 1V8NA 3GZ5A 1VK6A 5IW5A 3I7UA 1GA7A 5GHIA 1G0SA 5BONA 3P5TA 5C7QA 3GRNA 4S2WA 3Q1PA 1VRLA 2A8TA 1XSBA 3O6ZA 2JVBA 2DSDA 2ICKA 4NFXA 2A6TA 5FSKA 3X0NA 5CFIA 4YPRA 5FSLA 3SMDA 1X84A 3BM4A 3A6SA 3X0RA 2KDVA 2Q9PA 2QJTA 2I8TA 3O8SA 5FSIA 2O5WA 1R67A 1X83A 3F6AA 1NQYA 2A8QA 2B06A 2B2KA 1MK1A 1JRKA 3Q4IA 3ZR1A 1V8SA 2GT4A 3FSPA 1QVJA 1VHZA 5ISYA 3I9XA 4J7HA 5C8LA 2CL3A 3DKUA 5HZXA 1KTGA 2ICJA 4ILQA 2O5FA 4HFQA 4JZTA 2O1CA 1SJYA 2W4EA 3EESA 4V14A 5FSOA 3X0KA 3X0PA 5FSMA 2G74A 1RYAA 2R5WA 1XSAA 1MQEA 1K26A 1KHZA 3ID9A 5FSNA 4C9WA 4K6EA 2CZRA 3QSJA 2YVPA 1VCDA 2FKBA 3EF5A 3EXQA 3O61A 3X0LA 1V8TA 4KG3A 4ZG0A 1OW2A 3L85A 2YVNA 4MPOA 2GB5A 4KTBA 3J7Ye 3X0JA 1Q54A 3BHOA 3X0IA 3HHJA 3X0MA 1PUNA 1V8MA 5ANTA 1PUSA 3A6VA 4YOQA 2A8SA 4JZVA 1HX3A 1KT9A 4NFWA 3P6YA 1VIQA 1V8LA 2YVMA 1NFZA 3X0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K2E A;  3GZ8 A;  1V8V A;  5GHN A;  3MDI A;  2QKM B;  2A8R A;  3G0Q A;  3MDG A;  1IRY A;  4YPH A;  1NQZ A;  1U20 A;  2PNY A;  1VHG A;  3F13 A;  3GG6 A;  1SU2 A;  5DD4 A;  3SHD A;  3FJY A;  5DPK A;  3E57 A;  1XSC A;  2YYH A;  3KVH A;  3MGM A;  5GHM A;  1NFS A;  4ICK A;  4N1U A;  3EEU A;  4S2Y A;  5DDG A;  1RRQ A;  4KG4 A;  1Q27 A;  3H95 A;  3U53 A;  1V8W A;  2I8U A;  4JZS A;  2YVO A;  3X0Q A;  1SZ3 A;  3X0S A;  3ACA A;  1PUQ A;  1V8R A;  2QJO A;  1MUT A;  2J8Q A;  3Q2S A;  3DUP A;  3Q91 A;  1VIU A;  3Q93 A;  5GHQ A;  2G73 A;  2B0V A;  3BAP A;  4C9X A;  3AC9 A;  2DHO A;  3CNG A;  5ANV A;  5IW4 A;  2FVV A;  2DSC A;  1PPW A;  3ZR0 A;  3RH7 A;  2DSB A;  1VC8 A;  1I9A A;  5ANS A;  4HVY A;  3A6T A;  5ANW A;  4DYW A;  3I7V A;  3R03 A;  1PPX A;  2DUK A;  1PPV A;  4S2V A;  1V8Y A;  1RRS A;  1JKN A;  2RRK A;  1HZT A;  3MCF A;  5ANU A;  3FFU A;  2VNQ A;  2XSQ A;  1F3Y A;  3N9U A;  1Q33 A;  5BS6 A;  3A6U A;  5I8U A;  1G9Q A;  2GT2 A;  2I6K A;  2VNP A;  1X51 A;  2PQV A;  4N1T A;  2FML A;  1VC9 A;  1PVF A;  5CFJ A;  3COU A;  3OGA A;  3Q2T A;  3O69 A;  5C7T A;  4S2X A;  1MQW A;  3O52 A;  3SON A;  4JZU A;  3GZ6 A;  3N77 A;  1MR2 A;  3FCM A;  5DEQ A;  1V8I A;  1MP2 A;  3FK9 A;  3GWY A;  5GHJ A;  5GHP A;  4IJX A;  5LPG A;  2KDW A;  5GHO A;  1V8U A;  3HYQ A;  1TUM A;  2A8P A;  2AZW A;  1SOI A;  3WHW A;  4KYX A;  1V8N A;  3GZ5 A;  1VK6 A;  5IW5 A;  3I7U A;  1GA7 A;  5GHI A;  1G0S A;  5BON A;  3P5T A;  5C7Q A;  3GRN A;  4S2W A;  3Q1P A;  1VRL A;  2A8T A;  1XSB A;  3O6Z A;  2JVB A;  2DSD A;  2ICK A;  4NFX A;  2A6T A;  5FSK A;  3X0N A;  5CFI A;  4YPR A;  5FSL A;  3SMD A;  1X84 A;  3BM4 A;  3A6S A;  3X0R A;  2KDV A;  2Q9P A;  2QJT A;  2I8T A;  3O8S A;  5FSI A;  2O5W A;  1R67 A;  1X83 A;  3F6A A;  1NQY A;  2A8Q A;  2B06 A;  2B2K A;  1MK1 A;  1JRK A;  3Q4I A;  3ZR1 A;  1V8S A;  2GT4 A;  3FSP A;  1QVJ A;  1VHZ A;  5ISY A;  3I9X A;  5C8L A;  2CL3 A;  3DKU A;  5HZX A;  1KTG A;  2ICJ A;  4ILQ A;  2O5F A;  4HFQ A;  4JZT A;  2O1C A;  1SJY A;  2W4E A;  3EES A;  4V14 A;  5FSO A;  3X0K A;  3X0P A;  5FSM A;  2G74 A;  1RYA A;  2R5W A;  1XSA A;  1MQE A;  1K26 A;  1KHZ A;  3ID9 A;  5FSN A;  4C9W A;  4K6E A;  3QSJ A;  2YVP A;  1VCD A;  2FKB A;  3EF5 A;  3EXQ A;  3O61 A;  3X0L A;  1V8T A;  4KG3 A;  4ZG0 A;  1OW2 A;  3L85 A;  2YVN A;  4MPO A;  2GB5 A;  4KTB A;  3J7Y e;  3X0J A;  1Q54 A;  3BHO A;  3X0I A;  3HHJ A;  3X0M A;  1PUN A;  1V8M A;  5ANT A;  1PUS A;  3A6V A;  4YOQ A;  2A8S A;  4JZV A;  1HX3 A;  1KT9 A;  4NFW A;  3P6Y A;  1VIQ A;  1V8L A;  2YVM A;  1NFZ A;  3X0O A; 
#chains in the Genus database with same CATH topology
 1K2E A;  3GZ8 A;  1V8V A;  5GHN A;  3MDI A;  2QKM B;  2A8R A;  3G0Q A;  3MDG A;  1IRY A;  4YPH A;  1NQZ A;  1U20 A;  2PNY A;  1VHG A;  3F13 A;  3GG6 A;  1SU2 A;  5DD4 A;  3SHD A;  3FJY A;  5DPK A;  3E57 A;  1XSC A;  2YYH A;  3KVH A;  3MGM A;  5GHM A;  1NFS A;  4ICK A;  4J7G A;  3EEU A;  4N1U A;  5DDG A;  4S2Y A;  1RRQ A;  4KG4 A;  1Q27 A;  3H95 A;  3U53 A;  1V8W A;  2I8U A;  4JZS A;  2YVO A;  3X0Q A;  1SZ3 A;  3X0S A;  3ACA A;  1PUQ A;  1V8R A;  2QJO A;  1MUT A;  2J8Q A;  3Q2S A;  3DUP A;  3Q91 A;  1VIU A;  3Q93 A;  5GHQ A;  2G73 A;  2B0V A;  3BAP A;  4C9X A;  3AC9 A;  2DHO A;  3CNG A;  5ANV A;  5IW4 A;  2FVV A;  2DSC A;  1PPW A;  3ZR0 A;  3RH7 A;  2DSB A;  1VC8 A;  1I9A A;  5ANS A;  4HVY A;  3A6T A;  5ANW A;  4DYW A;  3I7V A;  3R03 A;  1PPX A;  2DUK A;  1PPV A;  4S2V A;  1V8Y A;  1RRS A;  1JKN A;  2RRK A;  1HZT A;  3MCF A;  5ANU A;  3FFU A;  2VNQ A;  2XSQ A;  1F3Y A;  3N9U A;  1Q33 A;  5BS6 A;  3A6U A;  5I8U A;  1G9Q A;  2GT2 A;  2I6K A;  2VNP A;  1X51 A;  2PQV A;  4N1T A;  2FML A;  1VC9 A;  1PVF A;  5CFJ A;  3COU A;  3OGA A;  3Q2T A;  3O69 A;  5C7T A;  4S2X A;  1MQW A;  3O52 A;  3SON A;  4JZU A;  3GZ6 A;  3N77 A;  1MR2 A;  3FCM A;  5DEQ A;  1V8I A;  1MP2 A;  3FK9 A;  3GWY A;  5GHJ A;  5GHP A;  4IJX A;  5LPG A;  2KDW A;  5GHO A;  1V8U A;  3HYQ A;  1TUM A;  2A8P A;  2AZW A;  1SOI A;  3WHW A;  4KYX A;  1V8N A;  3GZ5 A;  1VK6 A;  5IW5 A;  3I7U A;  1GA7 A;  5GHI A;  1G0S A;  5BON A;  3P5T A;  5C7Q A;  3GRN A;  4S2W A;  3Q1P A;  1VRL A;  2A8T A;  1XSB A;  3O6Z A;  2JVB A;  2DSD A;  2ICK A;  4NFX A;  2A6T A;  5FSK A;  3X0N A;  5CFI A;  4YPR A;  5FSL A;  3SMD A;  1X84 A;  3BM4 A;  3A6S A;  3X0R A;  2KDV A;  2Q9P A;  2QJT A;  2I8T A;  3O8S A;  5FSI A;  2O5W A;  1R67 A;  1X83 A;  3F6A A;  1NQY A;  2A8Q A;  2B06 A;  2B2K A;  1MK1 A;  1JRK A;  3Q4I A;  3ZR1 A;  1V8S A;  2GT4 A;  3FSP A;  1QVJ A;  1VHZ A;  5ISY A;  3I9X A;  4J7H A;  5C8L A;  2CL3 A;  3DKU A;  5HZX A;  1KTG A;  2ICJ A;  4ILQ A;  2O5F A;  4HFQ A;  4JZT A;  2O1C A;  1SJY A;  2W4E A;  3EES A;  4V14 A;  5FSO A;  3X0K A;  3X0P A;  5FSM A;  2G74 A;  1RYA A;  2R5W A;  1XSA A;  1MQE A;  1K26 A;  1KHZ A;  3ID9 A;  5FSN A;  4C9W A;  4K6E A;  2CZR A;  3QSJ A;  2YVP A;  1VCD A;  2FKB A;  3EF5 A;  3EXQ A;  3O61 A;  3X0L A;  1V8T A;  4KG3 A;  4ZG0 A;  1OW2 A;  3L85 A;  2YVN A;  4MPO A;  2GB5 A;  4KTB A;  3J7Y e;  3X0J A;  1Q54 A;  3BHO A;  3X0I A;  3HHJ A;  3X0M A;  1PUN A;  1V8M A;  5ANT A;  1PUS A;  3A6V A;  4YOQ A;  2A8S A;  4JZV A;  1HX3 A;  1KT9 A;  4NFW A;  3P6Y A;  1VIQ A;  1V8L A;  2YVM A;  1NFZ A;  3X0O A; 
#chains in the Genus database with same CATH homology
 1K2E A;  3GZ8 A;  1V8V A;  5GHN A;  3MDI A;  2QKM B;  2A8R A;  3G0Q A;  3MDG A;  1IRY A;  4YPH A;  1NQZ A;  1U20 A;  2PNY A;  1VHG A;  3F13 A;  3GG6 A;  1SU2 A;  5DD4 A;  3SHD A;  3FJY A;  5DPK A;  3E57 A;  1XSC A;  2YYH A;  3KVH A;  3MGM A;  5GHM A;  1NFS A;  4ICK A;  4J7G A;  3EEU A;  4N1U A;  5DDG A;  4S2Y A;  1RRQ A;  4KG4 A;  1Q27 A;  3H95 A;  3U53 A;  1V8W A;  2I8U A;  4JZS A;  2YVO A;  3X0Q A;  1SZ3 A;  3X0S A;  3ACA A;  1PUQ A;  1V8R A;  2QJO A;  1MUT A;  2J8Q A;  3Q2S A;  3DUP A;  3Q91 A;  1VIU A;  3Q93 A;  5GHQ A;  2G73 A;  2B0V A;  3BAP A;  4C9X A;  3AC9 A;  2DHO A;  3CNG A;  5ANV A;  5IW4 A;  2FVV A;  2DSC A;  1PPW A;  3ZR0 A;  3RH7 A;  2DSB A;  1VC8 A;  1I9A A;  5ANS A;  4HVY A;  3A6T A;  5ANW A;  4DYW A;  3I7V A;  3R03 A;  1PPX A;  2DUK A;  1PPV A;  4S2V A;  1V8Y A;  1RRS A;  1JKN A;  2RRK A;  1HZT A;  3MCF A;  5ANU A;  3FFU A;  2VNQ A;  2XSQ A;  1F3Y A;  3N9U A;  1Q33 A;  5BS6 A;  3A6U A;  5I8U A;  1G9Q A;  2GT2 A;  2I6K A;  2VNP A;  1X51 A;  2PQV A;  4N1T A;  2FML A;  1VC9 A;  1PVF A;  5CFJ A;  3COU A;  3OGA A;  3Q2T A;  3O69 A;  5C7T A;  4S2X A;  1MQW A;  3O52 A;  3SON A;  4JZU A;  3GZ6 A;  3N77 A;  1MR2 A;  3FCM A;  5DEQ A;  1V8I A;  1MP2 A;  3FK9 A;  3GWY A;  5GHJ A;  5GHP A;  4IJX A;  5LPG A;  2KDW A;  5GHO A;  1V8U A;  3HYQ A;  1TUM A;  2A8P A;  2AZW A;  1SOI A;  3WHW A;  4KYX A;  1V8N A;  3GZ5 A;  1VK6 A;  5IW5 A;  3I7U A;  1GA7 A;  5GHI A;  1G0S A;  5BON A;  3P5T A;  5C7Q A;  3GRN A;  4S2W A;  3Q1P A;  1VRL A;  2A8T A;  1XSB A;  3O6Z A;  2JVB A;  2DSD A;  2ICK A;  4NFX A;  2A6T A;  5FSK A;  3X0N A;  5CFI A;  4YPR A;  5FSL A;  3SMD A;  1X84 A;  3BM4 A;  3A6S A;  3X0R A;  2KDV A;  2Q9P A;  2QJT A;  2I8T A;  3O8S A;  5FSI A;  2O5W A;  1R67 A;  1X83 A;  3F6A A;  1NQY A;  2A8Q A;  2B06 A;  2B2K A;  1MK1 A;  1JRK A;  3Q4I A;  3ZR1 A;  1V8S A;  2GT4 A;  3FSP A;  1QVJ A;  1VHZ A;  5ISY A;  3I9X A;  4J7H A;  5C8L A;  2CL3 A;  3DKU A;  5HZX A;  1KTG A;  2ICJ A;  4ILQ A;  2O5F A;  4HFQ A;  4JZT A;  2O1C A;  1SJY A;  2W4E A;  3EES A;  4V14 A;  5FSO A;  3X0K A;  3X0P A;  5FSM A;  2G74 A;  1RYA A;  2R5W A;  1XSA A;  1MQE A;  1K26 A;  1KHZ A;  3ID9 A;  5FSN A;  4C9W A;  4K6E A;  2CZR A;  3QSJ A;  2YVP A;  1VCD A;  2FKB A;  3EF5 A;  3EXQ A;  3O61 A;  3X0L A;  1V8T A;  4KG3 A;  4ZG0 A;  1OW2 A;  3L85 A;  2YVN A;  4MPO A;  2GB5 A;  4KTB A;  3J7Y e;  3X0J A;  1Q54 A;  3BHO A;  3X0I A;  3HHJ A;  3X0M A;  1PUN A;  1V8M A;  5ANT A;  1PUS A;  3A6V A;  4YOQ A;  2A8S A;  4JZV A;  1HX3 A;  1KT9 A;  4NFW A;  3P6Y A;  1VIQ A;  1V8L A;  2YVM A;  1NFZ A;  3X0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...