2QKMB

The crystal structure of fission yeast mrna decapping enzyme dcp1-dcp2 complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
266
structure length
266
Chain Sequence
MSFTNATFSQVLDDLSARFILNLPAEEQSSVERLCFQIEQAHWFYEDFIRAQNDQLPSLGLRVFSAKLFAHCPLLWKWSKVHEEAFDDFLRYKTRIPVRGAIMLDMSMQQCVLVKGWKASSGWGFPKGKIDKDESDVDCAIREVYEETGFDCSSRINPNEFIDMTIRGQNVRLYIIPGISLDTRFESRTRKEISKIEWHNLMDLPTFKKNKPQTMKNKFYMVIPFLAPLKKWIKKRNIANNTTKEKNISVDVDADASSQLLSLLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of dcp2 recognition and activation by dcp1.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase
molecule keywords SPBC3B9.21 protein
total genus 80
structure length 266
sequence length 266
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00293 NUDIX NUDIX domain
B PF05026 DCP2 Dcp2, box A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1050 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2qkmB01
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2qkmB02
3BM4A 5BONA 2Q9PA 4HFQA 1V8UA 1V8TA 3BAPA 4KTBA 2DSDA 4KG3A 1GA7A 2DSCA 2XSQA 2YYHA 3COUA 3X0OA 1Q33A 2O5FA 3EEUA 1HZTA 3X0MA 2B2KA 4ILQA 1KTGA 1MP2A 1V8IA 3Q4IA 3CNGA 1PUQA 2AZWA 2RRKA 3SONA 2I8UA 3P6YA 2I8TA 2FMLA 2R5WA 3X0LA 1MK1A 5FSKA 1VHZA 3HHJA 3J7Ye 2YVOA 4JZVA 3SHDA 3O8SA 4S2VA 3KVHA 3L85A 4V14A 5FSLA 3SMDA 4N1TA 2I6KA 1TUMA 5DDGA 1NQYA 1VHGA 1V8RA 3GG6A 3Q93A 5C7TA 2GB5A 3ACAA 5C8LA 1Q27A 3F6AA 5ANSA 5I8UA 4YOQA 3GZ6A 4NFXA 1RRQA 3ZR1A 3X0NA 4ZG0A 4YPRA 1NFZA 2QJTA 3EF5A 4NFWA 1NQZA 2G73A 3FCMA 5FSIA 3X0QA 3AC9A 3A6SA 5GHOA 1OW2A 3I7UA 3ZR0A 4S2WA 4IJXA 5GHPA 3FK9A 2J8QA 2O5WA 3A6TA 3P5TA 5ANVA 5CFIA 5DPKA 3ID9A 1VC9A 1MR2A 3X0SA 3WHWA 5IW5A 2FVVA 5GHNA 3FFUA 1KT9A 3HYQA 5GHQA 2QKLB 1V8LA 4YPHA 5DD4A 1PPXA 2ICJA 1K26A 1HX3A 1PVFA 3I7VA 4K6EA 2VNPA 5DEQA 1RRSA 2O1CA 4KG4A 2PNYA 3FSPA 5ANUA 1VC8A 1SZ3A 1RYAA 1JKNA 2KDVA 2YVPA 3O61A 1SOIA 5ISYA 1VIQA 3E57A 3O6ZA 1V8NA 1V8SA 1PPWA 1X51A 2GT2A 3GZ5A 3N9UA 1PUNA 1XSAA 1V8VA 2A8TA 4JZTA 5HZXA 3X0KA 4KYXA 1G9QA 1XSBA 3X0IA 1IRYA 3O52A 2VNQA 1V8YA 2KDWA 1SJYA 2YVMA 3EESA 5ANWA 5FSNA 4C9WA 4S2YA 5C7QA 1Q54A 1R67A 3I9XA 3Q2SA 2DHOA 4N1UA 3H95A 1KHZA 1G0SA 1MQWA 3RH7A 1VRLA 1VIUA 2A8RA 2G74A 2ICKA 4DYWA 3MDGA 2GT4A 1K2EA 3A6VA 3FJYA 5CFJA 2DSBA 1JRKA 3Q1PA 3MDIA 1F3YA 4MPOA 2A6TA 4C9XA 1MUTA 1VK6A 3GWYA 3DKUA 3R03A 3X0PA 1V8WA 2A8QA 3G0QA 1PUSA 5GHJA 4S2XA 4JZUA 3O69A 1VCDA 2QKMB 3OGAA 2W4EA 1X84A 3A6UA 5FSOA 5FSMA 1PPVA 2A8PA 1QVJA 5GHIA 3U53A 2JVBA 2FKBA 1U20A 1MQEA 3N77A 3MCFA 2PQVA 5IW4A 2CL3A 3MGMA 3X0JA 3EXQA 1NFSA 5LPGA 3BHOA 3F13A 2B0VA 4ICKA 1I9AA 2A8SA 2DUKA 2QJOA 5BS6A 1XSCA 1SU2A 1V8MA 1X83A 3GZ8A 4JZSA 5ANTA 4HVYA 3QSJA 3X0RA 3Q91A 5GHMA 3Q2TA 2B06A 3GRNA 2YVNA 3DUPA
chains in the Genus database with same CATH superfamily
3CP8A 2JSCA 4AVPA 1PP7U 2MD5A 5L3BA 3I4NJ 4HNTA 4HEA2 2E7XA 2GWRA 4BE1A 2XSQA 3UKGA 2E1CA 3H5NA 3F9KA 2M4GA 4AU7A 3CC7I 2LR8A 4MFDA 1FEXA 3CNGA 1PUQA 3ZQQA 2RRKA 2I8UA 4B3AA 3QWLA 3DFGA 3S2DJ 2FMLA 1PUFB 4XKBA 4HLXA 5J40A 1K6OA 4I09A 2LLKA 2MW8A 1YW8A 4NDLA 1XD7A 2IA0A 3CUQB 3OSGA 1CF7A 2WV0A 2ZB9A 3IAS2 3JTHA 2DFFA 2CZRA 4FETA 5DM6F 3VEPA 3X0NA 3OWTA 1TC3C 4ZG0A 1ZK8A 2VE8A 1OISA 2LDUA 3EYIA 3AC9A 2V9PA 3FXOA 1YYVA 4HSRA 1S8NA 5B1BH 4L5JA 4PJLA 5GHPA 1FSHA 1Q1HA 3LAPA 2QGUA 3IKTA 2YSRA 1XC5A 3IKVA 3JSOA 3A02A 4ZC3A 2OPTA 4EGYA 4G6DA 1UHMA 4GYIA 4IHVA 4FE7A 5J8CA 2HU9A 2PI0A 1HX3A 3KYLA 3PNVA 3T5XA 1X3ZB 1MD0A 2EBIA 1O3TA 1GV5A 1FOWA 3LFUA 1OJLA 2ETHA 3F3XA 3PL8A 3F6OA 3CDIA 2NOJB 2QVOA 3OYJA 3Q3SA 4RAFA 3J80Z 3A01A 3ZGKA 1WKMA 1HKQA 2VPRA 2ECCA 1X4PA 2JT1A 3OYCA 9ANTA 1AA7A 2IW5A 2A05A 2DPDA 5LGTA 4KISA 2DFHA 5EYRA 1OCTC 5FKNA 2ICKA 4G6TB 1R7JA 4J7HA 1MIJA 2HTSA 3FF5A 1SFKA 5FO5A 4BY1J 2D1HA 1LE8B 1MMAA 4BQAA 3F21A 4WXCA 1T95A 3ZCOA 3PUFA 3Q0VA 5GHJA 3HRTA 2QQ8A 2V1DA 2VE9A 3CC2I 3MQ0A 2VQLA 4ENKA 4BBRJ 1EJ9A 3U53A 4MQ9F 1VF9A 3AL0B 5LPGA 5KAIC 5ILUA 3OL3A 3DPLC 1TW3A 3D5SC 2L0KA 2QQBA 5CLSA 4ESBA 3F13A 5BS6A 1JKRC 4D7MA 1UZCA 1IUFA 3BWGA 3HOZJ 3X0RA 4F7ZA 3BJ6A 1WJBA 2EFNA 2VJIA 3QPSA 4BQNA 4I7HA 4L18B 3DWLE 3OR2C 1D1CA 4RDUA 3BTIA 2ZBKA 4B3XA 2RQPA 2V9VA 3KZZA 1SD4A 3A01B 2E5ZA 2DSCA 3ROUA 3DV8A 4RB3C 2XPUA 2W82A 5ILVA 3K70D 4ON0A 1SFOJ 1WI9A 2RQQA 4IQ4A 3VFZA 3M8FA 5FSKA 3HOWJ 5LRSA 3ABLH 3PUBA 4CA0A 2WC2A 4B44A 1EH7A 1TL8A 2HR3A 1WJAA 2E19A 2LG4A 4BDZA 3L1PA 2DFIA 3QPLA 2MABA 3KLOA 2A6EF 3F6AA 2K9LA 1FMVA 3AG3H 3GO5A 2JA7J 4I76A 1XGNA 1X19A 2R7TA 4XOPA 2DK8A 4BE2A 3JREA 1GUUA 1YE9A 1MDMA 3T1BA 1PUEE 4XM3A 3OIQA 4XN3A 1RUNA 2O5WA 3A6TA 1F43A 5ANVA 3KCCA 1VNDA 1VC9A 3WHWA 4Q4ZF 1BI1A 2X0LA 4X1EA 1ZGJA 1HOMA 4AC0A 3U9GA 3O2PE 4LITA 3NRVA 3F23A 5FD6A 5JHUA 1D3YA 1DP3A 3IWFA 2VIXA 4PJMA 4BY7J 4Q48A 4XKCA 4LJZF 4II3A 2OC6A 2M2EA 3OS0A 4A93J 2MFZA 1S7AA 1XSDA 2GT2A 5GTHC 2A8TA 1FTZA 3MCZA 2YVMA 2BVMA 4LD5A 2VB6A 1TWCJ 5IT3A 2IRFG 2VXDA 4PGGA 1J9IA 2DCEA 4IRHA 2XSJC 4IXAA 1LB2A 2OUMA 4CICA 5FKOA 1FLIA 4LK0F 3RDIA 4XIDA 4DIQA 5CFJA 3A03A 1TWGJ 1F3YA 2DBBA 2NS8A 3X0PA 2W84A 1U8BA 3FKJA 3GLLA 3PQJA 3FXLA 3ZMVA 1DQUA 4LMYA 2L4MA 2OZUA 2FKBA 4E7KA 5DCFA 5GPCA 2GLOA 3PIOF 1JUPA 3DBLB 5LGNA 1SU2A 5LLQA 5EDNA 1XTAA 1OR7A 3SEZA 4UVCA 4OIPF 1TBXA 1N78A 4B4CA 2VBWA 1BJAA 5DUKA 2Z3YA 1FBQA 4AM3A 3FIWA 2QWWA 4RA2A 1IZ1A 5DD8A 1ACIA 2F5FA 3CCLI 1LKXA 2JA8J 2UXNA 4A5MA 4G7ZF 2CYYA 2PJPA 4HNUA 4LLGF 4XLCA 1K61A 4LG0B 2TDXA 3WGHA 2EFQA 4CYDA 4ZYHA 2DT7B 3LA3A 2H09A 2XB0X 3BTJA 3D5RC 2BEOA 4XQFA 3KEOA 5GAGJ 2EV6A 2CQKA 5EG0B 3J81Z 4IHXA 1Z21A 5FJ8J 2QF7A 3RCOA 1IW7F 3KP4A 3HOUJ 3PO2J 1E17A 2CGPA 4BEHB 1FP2A 1M1EB 5FLXK 4KYWA 1RRQA 1D0ZA 4E70A 3GZNB 4P55A 5F6FA 4XRMA 1QVUA 3H5RA 1RESA 3LA7A 1OW2A 3I7UA 3HEFA 2IGMA 3JAMK 2M5WA 4IJXA 2JVHA 2LF7A 1ZRDA 2DT6A 3F0CA 2Q0OA 2QSHX 1RR7A 5GHNA 4UB6C 1QQIA 5H2FC 2PMZA 2MBFA 1FIAA 5TJJA 2E34A 2V1XA 3DEWA 2P6SA 5BNGA 5EGOB 2TRTA 1GHCA 1ZQ3P 2Z16A 2ELKA 3DKYA 3FXKA 3GX4X 1JGSA 3CCJI 1OQYA 3JRGA 2FOWA 3SFZA 4XSXF 4L9TA 5E1ZB 1FIPA 3JRFA 2GXBA 2K9QA 1BC7C 2XAGA 1X51A 4R8HA 5IYCJ 1TQIA 4HF2A 3DXJF 4UV8A 3X0KA 1LJ9A 4JX4A 1W0UA 1AHDP 4EM0B 4P5OA 5ANWA 2BVLA 4N0BA 1JXSA 2Y9YA 2RC4A 2ZJPF 2TCTA 1VRLA 2A8RA 2OQGA 2E2JJ 2QYOA 4YIRX 2IS6A 4C3HJ 5ED4A 1P4AA 5TRDA 4ZDLA 4CSWA 4IZZA 1D8JA 2WADA 3KP7A 3RSNA 2XUBA 4S2XA 2RKHA 2VLAA 3K4LA 4UXNA 2MA3A 5FSOA 2JVGA 3QAHA 5EGOA 3K1PA 3HZJA 4P9UA 2R7ZJ 3GW2A 5E79C 3ZN0A 2OV7A 3A2KA 2UUZA 1HBXG 3BCBA 1WFXA 1JJ8C 1V8MA 2XGXA 4XLNF 1IUYA 4YFKF 1FPQA 1PUFA 1SAXA 4O3MA 1Y1VJ 3R0AA 2L2OA 5F1JA 2FBKA 4CCKA 3ZMSA 5LBQA 2IS2A 4CCLA 1IDZA 3M1EA 2DLLA 1WWXA 4NQWA 2X6OA 1I27A 4IHYA 3EEUA 4WXHA 4E7HA 4ESJA 3VDXA 2DT5A 4M6VA 3BCAA 3SQNA 4M3DA 3W2AA 1NHAA 3HRSA 1X1AA 4HDVA 2I8TA 3S1QJ 3JCUC 3BR5A 1XMKA 3BDDA 1W0TA 2F5EA 1G3TA 2B63J 2VQHA 2Z9OA 1OFCX 3EDPA 4A0ZA 2LY9A 3PFIA 1V8RA 5FFXA 2HQ5A 4B09A 3TW7A 1I5ZA 1UFMA 2Y69H 5FSIA 1R6RA 3TKYA 1NTCA 2EIMH 4XBFA 3CCUI 1UG2A 4I0BA 1ZG1A 2FEZA 4BHPA 2CUFA 1FP1D 5M3FJ 5IW5A 1ZN2A 3O6BB 3JRAA 1WJDA 3S1NJ 1KT9A 4YFNF 2JRMA 3HL2A 2FVVA 3FFUA 1IV8A 2DO7A 4PUSA 1STZA 1WH7A 1Y8QB 1T0FC 2E5NA 2JQ7A 1ZTRA 3TP3A 3HTSB 2QBYA 1QGPA 4EATA 3FZVA 1R23A 1PJRA 1DU6A 3GVAA 5IP9J 1RUOA 5EZHA 3O61A 1X58A 2F5VA 1SFXA 3HJEA 2BXZA 3G2BA 5L3CA 2MH9A 4BJ6C 2BZTA 2PX9A 2AO9A 4E4HA 3VYTB 3X0IA 1P7IA 2GA2A 1V5FA 4RLQA 1V4RA 1UG0A 2JPBA 4HG2A 1Q54A 2R92J 4XLEA 4C2UA 4DYRA 1U6GA 1E2XA 1YX3A 3R6SA 4X0GA 3WTYC 5FKLA 1K4TA 2QM3A 5TGTA 1B8IA 4M3EA 1J7KA 2DDBA 4BDYA 2P7CB 3FJYA 3I5UA 1Z6RA 5CQEA 4A3JJ 3Q1PA 1F1ZA 2V4JC 4IHTA 1MUTA 3I64A 3G4SI 4C9XA 4D5FA 5FRNA 3G6EI 3REOA 2KP6A 1K6YA 1R5GA 1VCDA 4F91B 2ADUA 2A68F 2W4EA 3C1DA 5FSMA 2QLZA 3OYFA 2K9SA 2MG4A 3F72A 2UV1A 1VQ5I 4UVBA 2PQVA 5CPRB 3BHOA 2NS0A 2ZNYA 5DS9A 2HZTA 5HLGA 3BQYA 4CXFA 2L5QA 2M30A 1D5VA 1T39A 4WX9A 4OAYA 3JRBA 1HQCA 4ENNA 1V8UA 3BAPA 2HXOA 3FBIB 2VJ4A 4FX4A 4XSZF 3B73A 2ZSHB 4L5EA 2O5FA 4Y15A 2XAHA 1B72B 1MP2A 1G3SA 1SEUA 1S5LC 4C2MJ 3VODA 1FMWA 3P6YA 1S7OA 2H94A 3HUGA 3CMYA 1LQ1A 2LTPA 4A5NA 3OYKA 1YTYA 3TO9A 3TMOA 2H8RA 3RYPA 2V79A 5K1YA 1YIJI 2QUFA 2Y75A 2O9LA 1BI2A 2DYSH 5I8UA 5EG0A 1QZYA 5DUIA 5HDKA 1MNDA 3DTEA 2XRLA 4NFXA 1OCZH 1WVRA 2KFDA 1HW2A 4AUXA 4A3CJ 2KZGA 1J0RA 2R7SA 2YUSA 4L9NA 2E1OA 3LL7A 1R5HA 1TTYA 2ZO4A 4V2GA 2OU2A 4F3QA 1L0OC 3C18A 3R60A 5D5XB 2ID3A 2BHZA 3PSIA 4HOBA 3KP3A 2AHQA 1T0FA 3K7AJ 3S2WA 3ZMZA 5HOOA 5GHQA 1N77A 2R7WA 1KQ9A 3ABMH 1FYMA 4MEXF 1PPXA 4KIFA 1R71A 1PVFA 4D1QA 1POGA 1SMTA 4U0YA 1Z9CA 1SD6A 1JT6A 1Z6TA 2M34A 3NEUA 4XLHA 1VC8A 2PLYA 4AVZA 1E3OC 3MEXA 2IP2A 1XG1A 3HOVJ 4ZZLA 1I3AA 1V8NA 5H20A 2GIVA 4F55A 5HDNA 1MBFA 2EWNA 5GP9A 4YFXF 1XSBA 3U2RA 1IRYA 2VNQA 3EESA 2ZMEB 3IUOA 2VONA 4GCVA 4N4NB 5CJ9A 3HOSA 3RJPA 3WG7H 1MZBA 4M9ZA 5F0HA 2R5ZA 3ZP5A 2HQNA 4BQOA 2COBA 5ICEA 3S1MJ 1T56A 2OCEA 2A6HF 3OIOA 2KRFA 2G74A 3T8RA 3MDGA 3AG1H 3F8NA 5E1XA 1YO5C 1FOXA 1U5TB 3DU6A 3QOPA 1VK6A 1V8WA 2A8QA 4UVAA 1FNNA 3SYTA 5D8LB 3A6UA 2O03A 1PPVA 2OZ6A 4M3BA 3H9JA 5J47A 3CMAI 2GOMA 4M71A 2L9VA 2X4HA 5IW4A 4RM3A 1X1CA 3BG5A 1XCBA 5L3DA 1F5TA 1NFSA 1H89C 1E3HA 3L09A 3LSTA 1QPIA 1MMSA 3RQIA 2VOOA 2KIMA 2DUKA 2AXTC 3GLXA 5M5YJ 5J1UA 2XF5A 1GVJA 3PO3J 1V5GA 5B3SH 2YVNA 1ETQA 2EILH 3AKZA 2HNHA 2Q9PA 3ZQCA 3CCYA 1K78A 2UWMA 2KQRA 4II2A 1AKHA 1ZH5A 3COUA 2P81A 5E3NA 2R5ZB 2QA4I 3KP2A 1J75A 2XSDC 2Y2ZA 2EFPA 4ILQA 2BGCA 4LIUA 3AG4H 4Y7NJ 5BPIA 2AZWA 2CW7A 4WXDA 1V54H 3OYDA 1Z3YA 3E7LA 1O4XA 2IA1A 1R9TJ 1Z7LA 1VHZA 2M0MA 5K5RA 4G6QA 2K9MA 1YOVB 1TQPA 3TO7A 3L85A 2Y0MA 4BQQA 3DLLF 3ML6A 2QQAA 1DGWY 4EGZA 5FKKA 5EF6A 3BLYA 3TEDA 4S04A 4N1TA 4DQ2A 3MVPA 2Z5UA 1HDPA 1QZZA 4KN7X 3FMRA 4OWRB 3KZYA 4LOCA 5ANSA 1P92A 1JUSA 2P0WA 2EV5A 3A0BC 2IGKA 4JOMA 3BR1A 2L7KA 1JHHA 2ZFUA 2OF7A 1JJ6C 5CVJA 5LFAA 2R93J 2F4OB 2Q1ZB 5C3EJ 1HCRA 4MTEA 4ZDOA 2IJLA 1EV7A 3ASNH 3JRHA 2QKLB 2XPWA 2ZXHA 5J4YA 3FK6A 1A5JA 4JK1X 2JJ7A 3K1NA 2X1EA 3COAC 4BE0A 2EIKH 3TOAA 4WWCA 3LWFA 2J5PA 3CJQB 2L7MP 2MC3A 2VN2A 4PFPA 3WGGA 1O7FA 4F93B 1A6IA 3O6ZA 2KJCA 1KU3A 2CO5A 2MSYA 1PPWA 3O8HA 5BPDA 1D8KA 1XSAA 4YIIA 2F6CA 3ASOH 2M8EA 4RBOA 1Z0XA 3CJTB 5FSNA 2WY8Q 1L3LA 3OOUA 4HW0A 1G0SA 2GZWA 5H6QA 2N8GA 4NUBA 2EH3A 1P2FA 4PSWA 5AONA 4OIOF 1QU3A 3GEZA 4HX7A 4QPQA 5J6XA 4IPAA 5HLTA 2CQXA 1WI3A 4RLFA 3LSRA 3MDIA 1YJ9I 4I2OA 3H0DA 3BR2A 3FDYA 3HKZN 3IH4A 2KIFA 2R4GA 3BPVA 3P7NA 4KMUX 2KIUA 2R7QA 2JVBA 4MNUA 3PJRA 3PSFA 4RAGA 2I5UA 3W2VA 5DCMA 2A69F 1OR7C 1UJ8A 4O6JA 4D7NA 4XOTA 5F64A 1X83A 3OS2A 1LFUP 1SVOA 5FRMA 4A3KJ 3ZMTA 2LY2A 1DUXC 5B66C 1V8TA 2FBIA 2NOGA 3V7CA 1GA7A 3QP5A 3FWEA 2DOEA 1ODDA 1WJFA 2F5CA 1JUMA 3I59A 4HA8A 2CV2A 2MYSA 5E3OA 2HQRA 1SD7A 5IYDJ 1RI7A 1PYVA 4BHCA 2C6YA 2EFWA 1YRNB 4HYEA 3SFIA 3CCRI 3X0LA 1MK1A 2ESHA 3DEUA 4HQEA 2ZNZA 5CVRA 2HI3A 3O8SA 3GMEA 2MLGA 5E3MA 1EKEA 3BG9A 3QRFF 3I4PA 5C7TA 4AYBA 2W7NA 3CCMI 2WV1A 3F8FA 3RPUD 4Z6YA 2M3AA 2MD0A 3LQRA 3ZR0A 2MC4A 3CLOA 3QPHA 2ZC2A 1G3YA 4E7IA 2ZJ2A 2CS3A 1WJCA 2IGNA 4C30A 3SZPA 3FM3A 4A3LJ 1MMGA 2GA1A 4UUSB 1TLHB 2DDAA 4A69C 3FMSA 2VNPA 5DEQA 1LFBA 3CESA 1A04A 2B0LA 2VC0A 3MN2A 4RS8A 3V7SA 1HA8A 3U1DA 3S3NA 3CO6C 5D5WB 2KKOA 2IBDA 4MTDA 3BPXA 2L54A 1SOIA 1ZYRF 2FOKA 5E17F 3K4KA 1CF7B 1FZPB 3G0QA 2AXLA 3LQQA 3M8EA 2X48A 4E7JA 4XK4A 1USTA 4MO7A 5JVTA 1X3WB 1T38A 1HXDA 5C7QA 4XICA 1BM9A 1APLC 2Q8KA 1I50J 3OYAA 1DPUA 5JFRA 3W6VA 2ECBA 5D5VB 4M74A 4R79A 3I58A 2FMYA 2VKHA 3DBRB 2MLKA 3IAM2 5E18F 3K4NA 1T98A 2V26A 1MMDA 1U5TA 4KA4A 3CCQI 1X2MA 1ETOA 3H9QA 4B1RA 1GXPA 4U7DA 2VKDA 1R58A 3UR3C 1GLNA 1QVJA 3F8MA 3M7GA 1YX5A 3L2VA 1MQEA 5IP6A 3N77A 5EEAA 1S7EA 2Q2EA 1VQLI 2XAUA 3IHUA 2DA3A 3C3WA 1HKSA 5AIQA 3K4MA 2O6GE 3GTMJ 1ETYA 5F27A 4IRGA 5KHDA 2GAUA 4HF1A 1N25A 2JUGA 3HUGB 1KYWA 1RKTA 1RPWA 3TDUC 4LB5A 2CW8A 1ERDA 3CCVI 1Y0NA 5IY5H 2BY1A 2PN6A 3X0OA 4YIFA 2LRDA 2MH2A 2AS5F 1X1DA 4QSHA 3X0MA 2D45A 4BXUA 4ENJA 3ZQ7A 1Y56A 3Q4IA 4BH9A 3H3UA 4M9SA 3BTCA 4RGSA 2E35A 4E6KG 4FASD 4KIGA 1U78A 1SFEA 4BU2A 4JZVA 2RNJA 4P9FA 2CW0F 3KVHA 1X1BA 2CFOA 3ABTA 1OLTA 2DW4A 1T33A 3I53A 4JP0A 4UHTA 2K86A 1RC9A 3SMDA 3BZ6A 2CV1A 3E6DA 1VHGA 3SDGA 1MBJA 5LHGA 2RVCA 3PNTA 4MEYF 3Q0UA 1OCCH 4G8XA 2JWTA 1K79A 5DV5A 2DMPA 3FCMA 2QSFX 3WE2A 3CJNA 4P1WA 1YW9A 3TBIA 2R7VA 4ESFA 1ETWA 5HNFA 3ID9A 5GPAA 4EJWA 1R4MB 1X2NA 2LP0A 3HYQA 4HF0A 3QU3A 4YPHA 5DD4A 3F8CA 1VQNI 1LDDA 2CQNA 4V19K 4CGZA 4M72A 2E1NA 2P6TA 1D5YA 4K6EA 1O3QA 3AAFA 4KG4A 1JKOC 2K40A 4HV5A 2PNYA 5J4VA 5KNLA 4HSTA 3FMQA 2FSWA 3DPTA 2ME6A 3X2QH 3J81K 1MJ9A 4U0WA 1VQKI 3LA2A 3HHGA 3N97A 2K85A 2VXZA 1D0XA 5L3EA 3S16J 3ZRGA 1WQ2A 2LFBA 1U2WA 1YS6A 2Z99A 2HQAA 2OCCH 3CMMA 3NWSA 4QWQA 3HPHA 4PSXA 4G94A 1W7PD 3FX3A 1P4WA 2BY3A 1W36D 3Q2SA 1W4MA 4J00A 1MJAA 1CQTA 3DPUA 1XS9A 1O3SA 3BR0A 4DYWA 3DP7A 1ZELA 4X6AJ 5LGUA 3K69A 3HOXJ 2FJ1A 1K2EA 3D0SA 4ABZA 1YLFA 4NQWB 4WF2A 1XMXA 2BW3B 3UNGC 2HGCA 2XV4S 3I71A 2OD5A 5EZGA 3EUHA 3CCSI 3O69A 1PP8F 4UUTA 3OGAA 2LMDA 3WTTC 2FNAA 3H0GJ 3MZYA 4P96A 3OYLA 5F04A 2A8PA 2QENA 3EYYA 4N9HA 2L01A 2WY7Q 3VSLA 2PQ8A 3CLQA 4NNJA 4W1UA 3X0JA 3EXQA 1XB4A 2L9SA 4ICKA 5HNHA 2KT0A 3WHCA 1LE8A 1YHQI 2LYCA 3K4JA 2P5VA 2V1UA 4DGWB 2R5YB 5KAFC 1KGSA 2RV8A 2D1VA 4U7BA 2HYGD 2DA5A 2FQ4A 4XKWA 1HDDC 3SZGA 1OPCA 3QQAA 2M8GX 4Y13A 2O8XA 3MFKA 3E6CC 2RDPA 5LHIA 2NVYJ 4OIQF 3HRUA 3CDLA 4LG3A 2ELHA 1KQ8A 5K5OA 2B2KA 3KYDB 2F4IA 3MKWB 3IL2A 5K7HA 4XLAA 1TWFJ 2WWYA 2NVUB 2VBYA 4M6YA 2BW3A 2CU7A 1RNLA 3QOEA 3CF2A 1XMAA 2KDOA 5FSLA 2XASA 4XN0A 4JX6A 1H88C 5HLIA 4HDUA 3GUDA 2VT3A 3M1CA 1NQYA 5M5XJ 3BR6A 3E5QA 4BXFA 3ZPLA 1IN6A 2E7WA 2EPFA 1W36C 5EEGA 3RKXA 4EJUA 1D1BA 1EF4A 5JR3A 1BBYA 1PDNC 1X4OA 1O7LA 2IPQX 1MSEC 1DGRM 4B43A 2XB5A 3TW6A 2Z1DA 3FM5A 1YQAA 2LSOA 1VQ8I 1JTXA 2NXNB 2R7DA 1B8IB 1T2KA 1S9HA 2J5OA 1XGOA 1ZLJA 2HS5A 2Y0SN 4JBAA 1O3RA 1K26A 2ICJA 3I7VA 2GIZA 1Z77A 2DA7A 2DPUA 2PJRB 1G2HA 2O1CA 4Y17A 4RM2A 3S8PA 1Y39A 2R3SA 2CV0A 4BAYA 2KDZA 1VQ6I 4HQMA 1IJWC 3O8GA 1U8RA 1ZREA 1MKMA 2M7BA 3L2CA 1VZ0A 1JKPC 2XAQA 2HOTA 2CQQA 4KYXA 1G9QA 3I4MJ 1V55H 2M0CA 4S2YA 2BOLA 3QYEA 1KYZA 4BS9A 3ZXSA 4DW6A 1MH3A 1WPKA 4ZJZA 2P7VB 4A3IJ 1T8IA 3NAUA 1ETXA 1BR1A 4FT8A 5FLMJ 4CHUA 4A3BJ 1MQWA 2G7UA 1T08B 1U3EM 1HF0A 1VI0A 1T6SA 1SC7A 3H3VK 3ZQFA 3WHBA 5C4JJ 2KHMA 3BZCA 4MPOA 3GWYA 3MAJA 3WODF 1I6XA 1NK2P 1MBEA 4OMYA 2HOAA 4TV7A 1N75A 3RYRA 5D8KB 5B1AH 4UNOA 2HEOA 3I9V2 3EUHC 4PZJA 4PFOA 4ZTJA 3P9IA 3FBNB 2OBPA 1TWAJ 3TQNA 1W1WE 1LDJA 4IL6C 2KMUA 4ZYAA 3HG9A 4EM1A 1IDYA 3I56I 1HW1A 1ZGWA 2NRAC 4HX4A 3GZ8A 1R00A 3KZIC 3S32A 3QSJA 2EIJH 1S6LA 3GRNA 1YRNA 5F0CA 4HNVA 5BONA 3ABUA 1BI3A 1OYYA 2VPLA 1OYIA 3S3OA 2QQ9A 2DSDA 2I10A 5LEKA 4C2TA 3CUQA 4MFEA 1H0MA 2YYHA 2X1DA 2CSOA 3HPGA 4A3EJ 4IF4A 1G8XA 1S3JA 5CYVA 2K02A 2LBFA 5DYMA 1V8IA 4Y3OA 5HDGA 2YU3A 3KPHA 1I6HJ 4RGUA 5DTDA 1X3UA 2R5WA 1DDNA 3KE2A 2CMPA 3I55I 1NG6A 3V8LA 3RKQA 1BC8C 1A36A 3EUAA 2FD5A 1YIOA 4IKFA 1R1TA 2XROA 4V14A 3JAMZ 2DQRA 1KA8A 3MZ8A 2PMZN 5IPAA 2IT0A 4UB8C 2VOPA 1BW6A 4IHSA 2NNYA 3S3MA 3EETA 3C7JA 4L9VA 5FROA 2GB5A 4E7ZA 4Z2YA 3K2ZA 5ICFA 4CYCB 3HSEA 2Z2SB 3ZR1A 3RI4A 2JA6J 1IXSB 4B47A 2NVXJ 2R7FA 3HSFA 1UHWA 3WU1B 2BE5F 4PK4A 3RIRA 2JMWA 3ELKA 5CVIA 4LLLA 2V1NA 5DM7F 5ICCA 1VQ4I 2NS7A 2L9NA 3BTLA 3W3CA 3S15J 2B7EA 4EQQA 2F5DA 4W97A 4PJJA 4MQVA 1NH3A 3LSHA 3SZTA 3HKZA 1REPC 1SFUA 4OIRF 1F9NA 3WTZA 1S29A 4KIBA 5K7ZA 1IRGA 2M87A 3E5UA 3VYRB 3J7ZI 2HYJA 3RPQA 4I98B 5HVQC 4E7LA 1SANA 3NWTA 3WG9A 3KIOA 4NB5A 4I99C 1JKQC 4IQJA 1VIQA 3RQ4A 4IRIA 3TOBA 1XCVA 2YX4A 2VC1A 3PNYA 1V8VA 2FRHA 5F08A 5HZXA 3AL0C 4GGGA 2DK5A 1IXCA 1R67A 4S05A 3G73A 5M5WJ 1UMQA 1KHZA 2F4MB 2O61A 1IXRC 4KJZA 4EJVA 2EA4A 2Q2EB 4N9IA 5GAHJ 5J8FA 3G3ZA 2DOFA 1EH6A 2EZHA 2O5RA 3CCEI 1U0JA 3GTPJ 4NC7A 1JRKA 3OYMA 3SDBA 3P5JA 4IOCF 1BI0A 2PBIA 3K6GA 3WTUC 1IC8A 3FXRA 4FISA 1R1UA 5H6RA 1X84A 1MBHA 1AU7A 4BYYA 1QRYA 2KISA 1FX7A 2K27A 1ORKA 3BJOA 5JI6A 1HLVA 2OQRA 3HGGA 2NVTJ 2ZXJA 1P7JA 4BJTA 2GXGA 3H9GA 4ZYEA 4CUGA 4Y4RA 1NK3P 2E71A 3MD2A 1FYLA 3I59B 4PJ0C 1XGSA 1W7PB 3DEEA 2EB7A 1HZTA 3HYIA 2VKEA 4AWXB 3S93A 1IO2A 4XKVA 3OYNA 3GFJA 4IOAF 2CG4A 2DFEA 2VQCA 2B9SA 4I02A 4KITB 2KRHA 1ONVA 3GXOA 1ON2A 5BOXA 4EV0A 2A3SA 3A1YA 1Z05A 1OCPA 2PFBA 4YPRA 2ZJRF 4G12A 2JK3A 1GVDA 2HOEA 3A6SA 4CZCA 1LDKB 1GV2A 2KRCA 1G6NA 3TGNA 2ZMEC 3V8JA 2A61A 1MR2A 3FHZA 3CJRB 1OYWA 2JPCA 3W6KB 1UELB 1BR2A 4JYKA 4CO8A 1IN8A 3QPTA 3LSJA 3KFWX 1QHGA 2VL8A 3H92A 4CDGA 4IVNA 2HDWA 2P4WA 1B1BA 5E1WA 3WTXC 2OAZA 3L9FA 3OYEA 4BBSJ 1UCRA 2ISYA 1BW5A 3VYUB 5JHFA 1EH8A 2DTRA 3ZQLA 1SZ3A 1ETKA 2Y48A 2YVPA 1JI8A 2LK2A 2Y30A 3OMYA 1J5YA 1X1PA 3ZQIA 2HVRA 2LREA 2NYXA 3IP4B 3WU0A 5D6FA 1IV6A 3HHHA 1MJBA 4CZZA 4IX7A 4N1UA 5KK1A 4DOZA 3I3LA 1QZEA 2V6CA 4RAZA 4A0XA 1UHSA 4ZTFA 2M45A 3E0JB 3HXLA 4D0PA 2K4BA 2E60A 1PVEA 5HS8A 4QPOA 2LH9A 1IRZA 3R03A 4J01A 4K2EA 1RZ4A 1FWZA 5IT9K 1J59A 3M3YJ 2STTA 5FLXZ 1BJZA 1FTTA 1VFCA 2EQRA 2L7FP 4XRFA 4YELA 4A3GJ 3MCFA 4XNFA 1XSXA 1TNSA 2IA2A 2XPVA 2QJOA 1CGPA 4AIJA 4JZSA 3JW4A 2QZ8A 5HS7A 4L0ZB 4HVYA 4AIHA 3Q91A 5GHMA 3Q2TA 2H27A 4NHJA 2PG4A 1QA6A 5GTIC 1QNTA 3FXQA 1LUJB 2LD5A 3FXJA 2RGVA 2V6EA 2XGDA 2FBHA 2Y9ZA 3PQKA 3BT9A 3HOTA 4RB1A 3HB9A 2YS9A 2CUJA 1ENHA 4GO1A 3CO7C 3OYGA 4FQGA 1ZARA 4U88A 3N4MA 4KFCA 3WGIA 5D4RA 2GQQA 1OCRH 2LBFB 3HHJA 3G1OA 1LEAA 5D4SA 5IOYA 4S2VA 3HIFA 5TISC 1E3PA 1TT5B 1USSA 2IAIA 4HBLA 4DBQA 1JT0A 3IRRA 4HRIA 3CZ6A 4S0HB 4FHTA 2I6KA 1KU9A 3K0LA 1O57A 2VQGA 3G1LA 3OV8A 3F22A 1G4DA 1DPRA 2ELJA 3EPZA 1TW2A 1Q27A 3C2GA 4CCMA 4CCOA 3LNQA 4A12A 3Q9SA 3JR9A 2QJTA 2Y31A 4NFWA 1FJLA 3KX2A 2CRGA 1S72I 4D9JA 5LD2C 4LB6B 4A2UA 1VQ7I 2E2HJ 2J8QA 2L7ZA 1P9QC 2X6YA 3V4GA 3L2WA 2YR2A 3MMYB 5HODA 4ZDPA 4XORA 4KUMA 3PFYA 2RN7A 3JRCA 2XVCA 2ICWG 4PDKA 5IOZA 1R1VA 3BC8A 3BR3A 3EQLF 1IN7A 2FU4A 1ON1A 2DQLA 2HTJA 2I8DA 3F6VA 3I0TA 5HLHA 3MKYB 3FSPA 1YG2A 3L7WA 2YX7A 2KDVA 2ZXIA 2VJ5A 1B9MA 1RKWA 3MKZA 5ISYA 2YU9J 4RB0A 5C44J 3GZ5A 3KETA 5CVUA 2ZKZA 4ETSA 2IS1A 2XGEA 3K4CA 5KCMA 2LNBA 2ISZA 1SJYA 2HYFA 2IGOA 4OU0A 2DMNA 3EUKL 3GYHX 2WB1A 5L3FA 4CCNA 1FOKA 2GT4A 1ZKGA 1KQ0A 4UUSA 4IJAA 2KJBA 3D5LA 2K4JA 5LHHA 3I54A 1YITI 1PUSA 2DA6A 3DLAA 3L2UA 1BIAA 5L3GA 5GHIA 3GFMA 4A6EA 1WZ2A 2EJRA 3CMEI 2HVSA 4UUVA 1AOYA 1Q1VA 1BOAA 2GM4A 4A0YA 3DCFA 2M1BA 1MBKA 5FKMA 1Z7UA 2R7UA 1WJ5A 2DJNA 5ANTA 1LFPA 3HGYA 3LSKA 1SVLA 2HXIA 1MNEA 3F8BA 2D5VA 4GRIA 5IT9Z 2B06A 1MH4A 2KLOA 4ZH4F 2GXAA 3W6JB 2D2WA 3RKYA 4LK1F 4A3FJ 4CH7A 2Z33A 3MZHA 2FA5A 2DA4A 2ZSIB 1Q33A 3JTGA 5AIPA 4KNYA 4PJNA 2CJJA 1FC3A 1U9NA 2XAJA 2DMUA 2PEXA 1B9NA 4A3MJ 4G7HF 4GXOA 3GWZA 2EZKA 3J7Ye 3RKWA 3SHDA 1WCMJ 2PMUA 3E6MA 2BXYA 2FXAA 1AKHB 1IGNA 2H6BA 4D5CA 5K5QA 4RGXA 4HLYA 2P8TA 3GG6A 3VPRA 3IRQA 1MNMC 1MGTA 2DI3A 1V5EA 3J7AO 3S14J 4MIMA 5KVRA 3FISA 3HC7A 5A2QZ 2ME0A 3V8KA 3JRDA 1NQZA 5ERIA 4HZFA 5GHOA 3W2WA 4FTHA 3GTQJ 4XRSA 2X6WA 1RR8C 2E1MB 6PAXA 1VQPI 4H4KC 3LSGA 2BYVE 3FK9A 4DJAA 3FKIJ 4KMFA 5FB2A 1H9TA 3H35A 3K2AA 3AFHA 2DOAA 4DYQA 3H1CA 3LSMA 2M7AA 3ESWB 1V8LA 3KEQA 4KT5C 2WTEA 3DTIA 4LGWA 3DKWA 1XDSA 2KZVA 4YRVA 4DYCA 5E3LA 1JKNA 2KIQA 5LEJA 5GAEJ 1Y8RB 2DMTA 2ZJQF 3GF2A 2W4SA 4YG2F 5CVVA 1OCOH 3M07A 1FOYA 1ZG3A 1P6RA 4JZTA 5F0FA 1WHUA 3K1MA 1PUNA 3H36A 3RZOJ 1MDMB 1V8YA 3JRIA 2XRNA 4UV9A 1IN5A 2G9WA 4XLFA 3U1KA 1IAWA 1JHFA 2R5YA 1YW7A 3BP8A 1WJEA 3GFLA 3IWZA 3BG7A 2JUCA 2VASA 4FX0A 4XLPF 5BMZA 3B6AA 3Q0WA 3SEQA 1ULYA 3BJAA 5JLWA 1VQOI 4A6DA 4F92B 2GOXB 4BGDA 3LMMA 3OR1C 2E2IJ 4GFBA 4JZUA 4RMNA 2JSPA 2QKMB 4HPQA 4EVIA 1W7PA 4ENMA 3SJMA 5D5UB 2UXXA 3BZKA 3GTLJ 2JA2A 3ERMA 4MLOA 1B72A 4AIKA 2XKPA 5LRRA 1ZRFA 4B8XA 1MW7A 2OA4A 4KICA 3VOEA 2W85A 3DUPA 4G7OF 3OSFA 3BM4A 4U0VA 4HAMA 3GTJJ 3AG2H 4BHBA 2STWA 3DF8A 3OY9A 4ASNA 5ILSA 2ZCWA 4DZPA 1YJNI 2R0QC 2VODA 2H1LA 2XGCA 1F4KA 1LEBA 1GT0C 1KTGA 3B6CA 1ZGAA 3J7YJ 3KP6A 4NC8A 1VTNC 2LKSA 3QYBA 1OMIA 4XONA 1BIBA 3RZDJ 4MGRA 1FYKA 4UY8I 2WA0A 4ZYDA 2DTZA 2W57A 3OOPA 2DU9A 3BROA 2HWVA 3KYCB 5FD5A 3K10A 3FXUA 2JZYA 3P9KA 4A3DJ 2EK5A 4CYCA 1I1SA 1TUMA 5FGMA 3PM1A 1IN4A 1ETVA 5K7FA 3ZQGA 2W00A 1KZHA 3LSPA 5FLVA 2WAQN 3CF5F 3GZ6A 1R5ID 3HSRA 1ITYA 3ACAA 2KPMA 1ZR4A 4EJTA 3ECOA 1DP7P 1NFZA 3NARA 2LOOA 4GYGA 1D1AA 2VI6A 4EEFG 1H8AC 3GCMA 3ZMDA 5CFIA 3L2RA 5DPKA 2XHKA 3ZOBA 2EINH 2DN0A 1R49A 1QVTA 2HZDA 2CWEA 3GBGA 4BUPA 2IEKA 2EZIA 2EZLA 3OIPA 4XMYA 1BR4A 1J2XA 4WCGA 3CDHA 2IS4A 3T8TA 1ZG5A 2H6CA 2ZMEA 4HX8A 4OINF 3DU5A 3TO6A 5A2QK 4L5IA 4AIDA 2K3FA 1JGGA 1HSJA 1NG7A 3E5XA 2HPMA 4BACA 1P4XA 3WTSC 2W24A 4U87A 3ISPA 3E57A 1D0YA 4PCQA 3N9UA 1RIOH 5HS9A 4I0AA 1Y0UA 2XAFA 3IH3A 4N4OB 1E0EA 2HVQA 1ZLKA 2CUZA 2O0YA 2KDWA 3SXYA 5J1YA 4L0YB 1B6AA 3A0HC 3I9XA 4O5VA 4KDPA 4E7SA 3LOCA 2EFOA 3CP2A 5M3MJ 5JVGF 1WH5A 2FUG2 5EJCA 2XF7A 4IHWA 3A6VA 1DU0A 4M73A 3LAJA 2PJRA 4FCYA 2QEXI 3GTKJ 3FK7A 3HTUA 3A4CA 2DAOA 3E6BA 1R4NB 1W5SA 2YPRA 2BY2A 2HDDA 2BBYA 3VWBA 5CQGA 1K78B 2L9RA 2WB1N 3L00A 4ITVA 1U20A 2HPIA 1U5TC 1FY7A 2X9DA 4M3FA 4XRSG 3MGMA 4DNCA 1TT0A 4FE4A 4QTRA 2XKOA 2A8SA 4KT6A 4RAYA 1XSCA 1ZHFA 1FT9A 1QHHD 2L4AA 2PMHA 1TQMA 1XSVA 2HFHA 2VJJA 3WE3A 2OTLI 1YI2I 2EV0A 2DA1A 3C2BA 2LY1A 4ZZDA 4HFQA 2XF6A 2OJED 3LSIA 3M9AA 4QIWN 4KTBA 2R7RA 2WAEA 3RTRA 3ECHA 1G59A 1K83J 3LFKA 4DZJA 1WSUA 3GFIA 3SONA 1R36A 2CFXA 2WAFA 3BG6A 4L9JA 1VQMI 2DMQA 3V42A 5IP7J 2DYRH 3ZMUA 1JE8A 2AQFA 3QYFA 2G0EA 2ID6A 3H5AA 4LG0A 3RPUA 5DDGA 4BNCA 1FSEA 2AQEA 3GTGJ 2W1OA 3DQVC 1J09A 1LVKA 1FBSA 1Z91A 1UAAA 3HOYJ 1G3WA 3Q93A 5C8LA 5BQTA 5IYBJ 2Y0SA 3D1NI 4XR6A 4CCJA 4LFUA 2G73A 2LVSA 1TNTA 3X0QA 2FNPA 1WRJA 2ZXWH 2R7OA 3VYSB 3Q5FA 3S17J 4BEHA 1MMNA 4NBQA 5C4XJ 4WK8F 2GBYA 4C9YA 3S2HJ 1QBJA 1TP4A 1YJWI 3X0SA 4KN4X 3ZR8X 2W48A 3S1RJ 1KU2A 3BOQA 3L2QA 5CKTA 5E8IA 1A35A 1K4SA 3IH2A 3G71I 4JX5A 2K9NA 2WAQA 5J1RA 1XGMA 2UZKA 1RRSA 1C0WA 2V9KA 4R1HA 3WTVC 2LF8A 1AWCA 3DKXA 1XN7A 4MHGA 3HM5A 4HV6A 3DTKA 3ERED 3HBLA 2HKOA 1BL0A 1TWHJ 4OOIA 1QO0D 4C3IJ 1HKTA 4F52A 1ZR2A 5F1RA 1ZRCA 1XX5A 2JN6A 1RRJA 2FF4A 4BJ5C 5B5EC 3HRMA 3B02A 1Z1DA 4OAZA 4Q5SF 4RGRA 4IO9F 4C9WA 2X1CA 3U21A 2L3DA 1GDTA 3E3VA 2LKXA 1SAUA 1LNWA 2LKPA 3PIPF 4H0EA 1I1GA 5JLXA 3V7RA 2KL4A 2QCOA 4EMSA 1UB9A 3E1SA 3K70C 2FE3A 1QPMA 4BL0B 3MWMA 3ONQA 2LC2A 4I01A 2DA2A 3KP5A 1LVAA 3BY6A 2VUMJ 3J7AY 4M6XA 4RB2C 1XDUA 2JA5J 1KONA 1IRXA 3CUQC 2XDVA 3E97A 2F48A 3BQZA 4NC6A 2O7OA 1A6QA 2CL3A 1I39A 4M9XA 1I9AA 3VSKA 1BN5A 5ICGA 3OYHA 4Y52J 3C2HA 2DJIA 3QODA 2A5WA 1TZLA 5GADJ 1Y1WJ 2MGQA 2R7XA 1B59A 2DODA 1XPXA 2E1MC 2G7HA 1A31A 4GDFA 1HSTA 3IC7A 1V3FA 4BKXA 3M4OJ 2EA2A 3TL4X 3N05A 4KG3A 2WBMA 2QSGX 2F2EA 2XIGA 5FFZA 3OL4A 1IG7A 3SHFA 4M3GA 3NQOA 3VB2A 4V2FA 1U9OA 1K7AA 1BA5A 3CD6I 3WU2C 2W25A 3QP6A 1HW5A 1W5TA 1I3QJ 5E8GA 1R22A 1YFHA 2VBZA 4G9YA 2NNNA 3ZN1A 2YVOA 2COMA 2P5KA 2X85A 2P5LC 2JRTA 2NVQJ 2ZFWA 1JTYA 5J3LA 1SD5A 3G1MA 1VQ9I 3H3ZA 4LIVA 2NAZA 1B4AA 1F36A 2FQ3A 2RREA 4YOQA 3MKLA 3CTAA 1SMYF 2OTJI 3EF5A 3M8JA 2IXSA 2ACJA 2FX0A 4S2WA 2ESNA 1YS7A 2K5CA 4Y33A 4AD9A 3P5TA 4XL9A 2BHYA 3FXMA 2A07F 4OMZA 3T0YA 4B48A 2HOSA 1EA3A 1W5CC 2XC7A 2CUEA 2M4KA 2CQ7A 3FHNA 3CQZJ 3Q9VA 3TP0A 3OYIA 3BG3A 4AYBN 4I6ZA 5DCMB 2K3PA 3DBHB 3J80K 1IF1A 3R61A 2K7LA 1IRFA 4J19A 3K4BA 5ANUA 5EEHA 1MSFC 3GTOJ 4BXXJ 1RYAA 2H8WA 5E20A 2QBYB 3CUOA 3ABKH 3WTWC 1KU7A 2E36A 1V8SA 2V7FA 1Z67A 3OS1A 4JQFA 2M9HA 4IEJA 3O52A 2VT2A 3ZQHA 1ZAOA 2JTVA 1MBGA 3IV5A 3TDZC 4LLNA 3CC4I 2DHOA 2HDCA 3H95A 4YEJA 2O8KA 3R0JA 3RH7A 1LPQA 1VIUA 4QLCU 2RNGA 3JSPA 4J7GA 1WGXA 2DSBA 1FBUA 1GXQA 1Y6IA 2A6TA 5D6EA 4C3JJ 3DKUA 4PGHA 2A5YB 1RETA 4ANJA 2BY0A 3R4KA 4EJOA 3HDDA 1HC8A 2DXIA 4DBRA 3QU6A 1SVMA 2VKVA 2VBXA 2X51A 2IVMA 3OYBA 3K9TA 3KEYA 2B0VA 2X6XA 3P9CA 4EM2A 3KLNA 2L02A 3O3KA 2O3FA 1H9GA 1Z3XA 4Q47A 2CH0A 2H1KA 2HKXA 1BOBA 1OKRA 2BV6A 3ULQB 2RAEA 4ZYGA
chains in the Genus database with same CATH topology
4U7BA 3CP8A 1V8UA 3BAPA 3FBIB 2VJ4A 4XKWA 3SZGA 4HNTA 4CH7A 4HEA2 4BE1A 2XSQA 2ZSIB 2ZSHB 1Q33A 2O5FA 4LG3A 3H5NA 3F9KA 2M4GA 2B2KA 4AU7A 1MP2A 2F4IA 3CNGA 1PUQA 3MKWB 4PJNA 3ZQQA 4XLAA 2I8UA 2RRKA 1FMWA 3P6YA 2FMLA 4XKBA 2BW3A 3J7Ye 3SHDA 3QOEA 3OYKA 3CF2A 2KDOA 3TMOA 5FSLA 4XN0A 3M1CA 1NQYA 3IAS2 3GG6A 4BXFA 2CZRA 4FETA 5I8UA 1W36C 1V5EA 4NFXA 1MNDA 3DTEA 3X0NA 3OWTA 4ZG0A 3HC7A 1D1BA 1NQZA 2R7SA 3AC9A 5GHOA 3W2WA 3LL7A 4HSRA 2X6WA 1X4OA 2E1MB 4PJLA 1DGRM 4H4KC 3LSGA 5GHPA 4B43A 3FK9A 4DJAA 4F3QA 2Z1DA 3H35A 4ZC3A 3PSIA 3AFHA 2DOAA 3LSMA 5HOOA 1N77A 5GHQA 2M7AA 2R7WA 1V8LA 1PPXA 1S9HA 2HU9A 2ICJA 1K26A 1HX3A 1PVFA 4D1QA 3DTIA 3KYLA 2PJRB 3I7VA 2KZVA 2O1CA 4RM2A 3S8PA 4YRVA 3PNVA 2CV0A 4XLHA 1VC8A 1JKNA 4AVZA 3LFUA 2M7BA 2W4SA 1VZ0A 3PL8A 1V8NA 4JZTA 4F55A 1PUNA 2NOJB 3OYJA 1G9QA 1XSBA 4KYXA 1IRYA 2VNQA 1V8YA 3EESA 4S2YA 2BOLA 3ZGKA 3IUOA 3QYEA 4N4NB 4BS9A 1X4PA 3ZXSA 3OYCA 3HOSA 1AA7A 4XLFA 4ZJZA 4KISA 4BQOA 1BR1A 1MQWA 1WJEA 3BG7A 2VASA 2ICKA 2G74A 3MDGA 4G6TB 4J7HA 3DU6A 1SFKA 3SEQA 1MMAA 2KHMA 4MPOA 1VK6A 3GWYA 4F92B 1V8WA 2GOXB 4BGDA 1T95A 3LMMA 3OR1C 3ZCOA 2A8QA 5GHJA 4JZUA 1N75A 4RMNA 2JSPA 2QKMB 3SYTA 2VQLA 3I9V2 3EUHC 3A6UA 4HPQA 1PPVA 3H9JA 4PFOA 4ZTJA 3U53A 3FBNB 2GOMA 5IW4A 2KMUA 4ZYAA 3HG9A 4RM3A 1X1CA 3AL0B 1NFSA 5LPGA 3OL3A 3DPLC 3F13A 3D5SC 2JA2A 4MLOA 2DUKA 5BS6A 3GZ8A 3S32A 3QSJA 1MW7A 2XF5A 3X0RA 3GRNA 1WJBA 4BQNA 2VJIA 1V5GA 2YVNA 3DUPA 3DWLE 3OR2C 1D1CA 3AKZA 3BM4A 2HNHA 2Q9PA 5BONA 2VPLA 4B3XA 3S3OA 2DSDA 2UWMA 2KQRA 2E5ZA 4II2A 4C2TA 2DSCA 3OY9A 3COUA 2YYHA 2X1DA 3HPGA 2W82A 3K70D 1G8XA 4ILQA 2LBFA 1KTGA 4LIUA 1V8IA 4NC8A 2RQQA 4Y3OA 2AZWA 2CW7A 3QYBA 4IQ4A 3OYDA 1Z3YA 4XONA 2R5WA 2WA0A 1Z7LA 1VHZA 5FSKA 2CMPA 2M0MA 3PUBA 1NG6A 4CA0A 2K9MA 4IKFA 3EUAA 3K10A 3L85A 4BQQA 4V14A 4B44A 1DGWY 4BDZA 1WJAA 2LG4A 3BLYA 4N1TA 1TUMA 3S3MA 2W00A 4OWRB 2MABA 5FROA 2GB5A 3ACAA 3F6AA 4E7ZA 5ANSA 2K9LA 1FMVA 2KPMA 3GZ6A 2Z2SB 3ZR1A 2P0WA 4B47A 1NFZA 2LOOA 1X19A 2IGKA 1D1AA 4JOMA 2R7TA 4XOPA 4PK4A 4BE2A 2L7KA 1YE9A 2ZFUA 4XM3A 5LFAA 3OIQA 5CFIA 4XN3A 2O5WA 3L2RA 3A6TA 5ANVA 5DPKA 2V1NA 2Q1ZB 1VC9A 2L9NA 3WHWA 3W3CA 4ZDOA 4PJJA 2HZDA 4BUPA 3GBGA 2QKLB 2ZXHA 3LSHA 3OIPA 4XMYA 1BR4A 3HKZA 4LITA 2IS4A 2X1EA 3DU5A 4BE0A 1NG7A 3VYRB 1DP3A 2VIXA 4PJMA 3CJQB 5HVQC 4E7LA 2HPMA 4XKCA 4BACA 4PFPA 4II3A 3NWTA 2OC6A 4IQJA 1VIQA 4U87A 3OS0A 3E57A 3RQ4A 4F93B 1D0YA 3O6ZA 2MFZA 3N9UA 1PPWA 2GT2A 1XSAA 3PNYA 1V8VA 2A8TA 2F6CA 4N4OB 1E0EA 5HZXA 2HVQA 2CUZA 3AL0C 2KDWA 5FSNA 2YVMA 2BVMA 2VB6A 2WY8Q 1R67A 3I9XA 2VXDA 3OOUA 4E7SA 2DCEA 1KHZA 1G0SA 2XSJC 4NUBA 4KJZA 2OUMA 3CP2A 4PSWA 1QU3A 2FUG2 2Q2EB 4QPQA 2XF7A 4DIQA 3A6VA 5CFJA 5HLTA 2O5RA 4RLFA 1JRKA 3MDIA 1F3YA 1U0JA 2PJRA 4NC7A 3OYMA 3SDBA 3X0PA 3H0DA 3K6GA 3FDYA 3FKJA 2R4GA 3A4CA 1X84A 1DQUA 2R7QA 2JVBA 3VWBA 5CQGA 3PSFA 4E7KA 3PJRA 1U20A 4ITVA 3W2VA 2HPIA 2FKBA 3MGMA 1TT0A 1OR7C 2A8SA 4KT6A 1XSCA 4XOTA 1SU2A 1X83A 4BJTA 2VJJA 1QHHD 3H9GA 3OS2A 4CUGA 4Y4RA 5FRMA 3MD2A 3SEZA 2LY1A 2LY2A 4HFQA 1V8TA 2XF6A 3LSIA 1N78A 4KTBA 3DEEA 1GA7A 2R7RA 1WJFA 1LKXA 2WAEA 3RTRA 1G59A 1HZTA 2CV2A 2MYSA 3S93A 4HNUA 4XKVA 3OYNA 3SONA 1PYVA 4XLCA 3X0LA 1MK1A 2WAFA 3BG6A 2VQCA 3O8SA 4KITB 2KRHA 2DT7B 3V42A 3D5RC 4XQFA 2AQFA 3QYFA 3H5AA 1Z21A 5DDGA 2AQEA 3RCOA 2W1OA 3A1YA 3DQVC 1J09A 1LVKA 1UAAA 3Q93A 5C7TA 4AYBA 5C8LA 2W7NA 4BEHB 1RRQA 2Y0SA 3RPUD 1D0ZA 4XR6A 4YPRA 2M3AA 4CCJA 2MD0A 2G73A 3H5RA 3X0QA 3VYSB 3A6SA 2R7OA 1OW2A 4CZCA 1LDKB 3I7UA 2MC4A 4BEHA 3ZR0A 1MMNA 2IGMA 4IJXA 2JVHA 2KRCA 4C9YA 4E7IA 2CS3A 1WJCA 2IGNA 4C30A 2DT6A 3CJRB 1MR2A 3X0SA 3ZR8X 5GHNA 1UELB 1BR2A 1MMGA 2PMZA 5CKTA 3L2QA 1QHGA 2VL8A 2HDWA 2Z16A 2WAQA 2VNPA 5DEQA 3DKYA 1RRSA 3CESA 2V9KA 1HA8A 3S3NA 3OYEA 3DKXA 3DTKA 3VYUB 5JHFA 1SZ3A 2YVPA 1SOIA 1JI8A 4F52A 3OMYA 3K4KA 1X51A 4BJ5C 3G0QA 2HVRA 2LREA 4E7JA 3X0KA 3IP4B 4OAZA 4P5OA 5ANWA 2BVLA 4C9WA 5C7QA 2X1CA 3U21A 4IX7A 4N1UA 4DOZA 3I3LA 3OYAA 1SAUA 4ZTFA 1VRLA 2A8RA 2KL4A 3E0JB 3HXLA 4R79A 2IS6A 3K70C 3E1SA 2E60A 4BL0B 3ONQA 2LC2A 2VKHA 4QPOA 3IAM2 4ZDLA 2LH9A 3K4NA 4CSWA 4IZZA 3R03A 4J01A 3J7AY 2WADA 2V26A 3RSNA 4S2XA 1MMDA 2VLAA 3K4LA 1KONA 3H9QA 1IRXA 2JVGA 2VKDA 5FSOA 3UR3C 1GLNA 1QVJA 4YELA 1YX5A 2XDVA 3L2VA 1MQEA 3MCFA 3N77A 4XNFA 2CL3A 2OV7A 3A2KA 2XAUA 1I9AA 2UUZA 2QJOA 3VSKA 3BCBA 3K4MA 1WFXA 3OYHA 3C2HA 2DJIA 3QODA 2A5WA 1TZLA 2R7XA 1V8MA 4JZSA 4HVYA 3Q91A 5GHMA 3Q2TA 5KHDA 3HUGB 2JUGA 2E1MC 2L2OA 4CCKA 2CW8A 1ERDA 3TL4X 3N05A 2V6EA 2WBMA 2IS2A 4CCLA 4KG3A 3OL4A 3HOTA 3X0OA 2LRDA 1X1DA 3EEUA 2CUJA 3X0MA 4E7HA 3VDXA 1Y56A 3OYGA 3Q4IA 3BCAA 3W2AA 1X1AA 4E6KG 2I8TA 4FASD 2LBFB 3HHJA 4BU2A 2YVOA 4JZVA 4S2VA 3KVHA 1X1BA 2CFOA 1OLTA 2X85A 2VQHA 4DBQA 4HRIA 3CZ6A 3SMDA 2CV1A 2I6KA 2VQGA 1VHGA 1V8RA 2ELJA 4LIVA 3EPZA 2RREA 3C2GA 4CCMA 3PNTA 4CCOA 1Q27A 4YOQA 2QJTA 3EF5A 4NFWA 3M8JA 2IXSA 3KX2A 3FCMA 5FSIA 1R6RA 4D9JA 5LD2C 4P1WA 4S2WA 3TBIA 2K5CA 4Y33A 2R7VA 2J8QA 3P5TA 4XL9A 5HNFA 3ID9A 4B48A 1P9QC 1EA3A 2X6YA 3L2WA 2FVVA 5IW5A 2XC7A 1WJDA 3FFUA 1KT9A 3HL2A 3MMYB 3HYQA 4ZDPA 2M4KA 3FHNA 4PUSA 4XORA 4YPHA 5DD4A 1T0FC 3PFYA 2E5NA 3OYIA 4K6EA 3BC8A 2K3PA 4KG4A 2PNYA 2I8DA 4EATA 1PJRA 5KNLA 3K4BA 4HSTA 3MKYB 3DPTA 5ANUA 3FSPA 1RYAA 2KDVA 2ZXIA 2VJ5A 3O61A 2F5VA 3MKZA 2VXZA 5ISYA 3G2BA 1D0XA 4BJ6C 1V8SA 3ZRGA 3GZ5A 2V7FA 3OS1A 2IS1A 4JQFA 4E4HA 2HQAA 3VYTB 3K4CA 3CMMA 3NWSA 5KCMA 3O52A 3X0IA 1SJYA 1V5FA 3HPHA 4PSXA 2IGOA 4RLQA 1UG0A 1Q54A 4HG2A 1W36D 3Q2SA 2DHOA 3H95A 3EUKL 4XLEA 4J00A 4C2UA 2WB1A 3DPUA 4YEJA 3RH7A 1YX3A 1VIUA 4DYWA 4X0GA 4CCNA 1ZELA 2RNGA 2GT4A 5TGTA 1K2EA 4J7GA 4BDYA 3FJYA 5CQEA 2DSBA 4NQWB 3D5LA 3Q1PA 1Y6IA 2BW3B 2V4JC 2A6TA 3UNGC 1MUTA 4C9XA 3DKUA 5FRNA 1PUSA 2KP6A 1K6YA 3O69A 1VCDA 3DLAA 4F91B 3OGAA 2W4EA 4ANJA 3L2UA 5FSMA 3OYLA 2A8PA 5GHIA 3OYFA 2DXIA 4DBRA 2WY7Q 2UV1A 3VSLA 2PQVA 2X51A 4NNJA 5CPRB 3OYBA 3X0JA 2HVSA 3EXQA 3BHOA 3KEYA 2B0VA 2L9SA 4ICKA 5HNHA 2X6XA 2R7UA 1WJ5A 1Z3XA 2L5QA 5ANTA 1LFPA 2CH0A 2LYCA 1BOBA 3K4JA 3LSKA 1MNEA 2B06A 4GRIA 4OAYA 4DGWB 2KLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BM4 A;  5BON A;  2Q9P A;  4HFQ A;  1V8U A;  1V8T A;  3BAP A;  4KTB A;  2DSD A;  4KG3 A;  1GA7 A;  2DSC A;  2XSQ A;  2YYH A;  3COU A;  3X0O A;  1Q33 A;  2O5F A;  3EEU A;  1HZT A;  3X0M A;  2B2K A;  4ILQ A;  1KTG A;  1MP2 A;  1V8I A;  3Q4I A;  3CNG A;  1PUQ A;  2AZW A;  2RRK A;  3SON A;  2I8U A;  3P6Y A;  2I8T A;  2FML A;  2R5W A;  3X0L A;  1MK1 A;  5FSK A;  1VHZ A;  3HHJ A;  3J7Y e;  2YVO A;  4JZV A;  3SHD A;  3O8S A;  4S2V A;  3KVH A;  3L85 A;  4V14 A;  5FSL A;  3SMD A;  4N1T A;  2I6K A;  1TUM A;  5DDG A;  1NQY A;  1VHG A;  1V8R A;  3GG6 A;  3Q93 A;  5C7T A;  2GB5 A;  3ACA A;  5C8L A;  1Q27 A;  3F6A A;  5ANS A;  5I8U A;  4YOQ A;  3GZ6 A;  4NFX A;  1RRQ A;  3ZR1 A;  3X0N A;  4ZG0 A;  4YPR A;  1NFZ A;  2QJT A;  3EF5 A;  4NFW A;  1NQZ A;  2G73 A;  3FCM A;  5FSI A;  3X0Q A;  3AC9 A;  3A6S A;  5GHO A;  1OW2 A;  3I7U A;  3ZR0 A;  4S2W A;  4IJX A;  5GHP A;  3FK9 A;  2J8Q A;  2O5W A;  3A6T A;  3P5T A;  5ANV A;  5CFI A;  5DPK A;  3ID9 A;  1VC9 A;  1MR2 A;  3X0S A;  3WHW A;  5IW5 A;  2FVV A;  5GHN A;  3FFU A;  1KT9 A;  3HYQ A;  5GHQ A;  2QKL B;  1V8L A;  4YPH A;  5DD4 A;  1PPX A;  2ICJ A;  1K26 A;  1HX3 A;  1PVF A;  3I7V A;  4K6E A;  2VNP A;  5DEQ A;  1RRS A;  2O1C A;  4KG4 A;  2PNY A;  3FSP A;  5ANU A;  1VC8 A;  1SZ3 A;  1RYA A;  1JKN A;  2KDV A;  2YVP A;  3O61 A;  1SOI A;  5ISY A;  1VIQ A;  3E57 A;  3O6Z A;  1V8N A;  1V8S A;  1PPW A;  1X51 A;  2GT2 A;  3GZ5 A;  3N9U A;  1PUN A;  1XSA A;  1V8V A;  2A8T A;  4JZT A;  5HZX A;  3X0K A;  4KYX A;  1G9Q A;  1XSB A;  3X0I A;  1IRY A;  3O52 A;  2VNQ A;  1V8Y A;  2KDW A;  1SJY A;  2YVM A;  3EES A;  5ANW A;  5FSN A;  4C9W A;  4S2Y A;  5C7Q A;  1Q54 A;  1R67 A;  3I9X A;  3Q2S A;  2DHO A;  4N1U A;  3H95 A;  1KHZ A;  1G0S A;  1MQW A;  3RH7 A;  1VRL A;  1VIU A;  2A8R A;  2G74 A;  2ICK A;  4DYW A;  3MDG A;  2GT4 A;  1K2E A;  3A6V A;  3FJY A;  5CFJ A;  2DSB A;  1JRK A;  3Q1P A;  3MDI A;  1F3Y A;  4MPO A;  2A6T A;  4C9X A;  1MUT A;  1VK6 A;  3GWY A;  3DKU A;  3R03 A;  3X0P A;  1V8W A;  2A8Q A;  3G0Q A;  1PUS A;  5GHJ A;  4S2X A;  4JZU A;  3O69 A;  1VCD A;  2QKM B;  3OGA A;  2W4E A;  1X84 A;  3A6U A;  5FSO A;  5FSM A;  1PPV A;  2A8P A;  1QVJ A;  5GHI A;  3U53 A;  2JVB A;  2FKB A;  1U20 A;  1MQE A;  3N77 A;  3MCF A;  2PQV A;  5IW4 A;  2CL3 A;  3MGM A;  3X0J A;  3EXQ A;  1NFS A;  5LPG A;  3BHO A;  3F13 A;  2B0V A;  4ICK A;  1I9A A;  2A8S A;  2DUK A;  2QJO A;  5BS6 A;  1XSC A;  1SU2 A;  1V8M A;  1X83 A;  3GZ8 A;  4JZS A;  5ANT A;  4HVY A;  3QSJ A;  3X0R A;  3Q91 A;  5GHM A;  3Q2T A;  2B06 A;  3GRN A;  2YVN A;  3DUP A; 
#chains in the Genus database with same CATH topology
 3CP8 A;  2JSC A;  4AVP A;  1PP7 U;  2MD5 A;  5L3B A;  3I4N J;  4HNT A;  4HEA 2;  2E7X A;  2GWR A;  4BE1 A;  2XSQ A;  3UKG A;  2E1C A;  3H5N A;  3F9K A;  2M4G A;  4AU7 A;  3CC7 I;  2LR8 A;  4MFD A;  1FEX A;  3CNG A;  1PUQ A;  3ZQQ A;  2RRK A;  2I8U A;  4B3A A;  3QWL A;  3DFG A;  3S2D J;  2FML A;  1PUF B;  4XKB A;  4HLX A;  5J40 A;  1K6O A;  4I09 A;  2LLK A;  2MW8 A;  1YW8 A;  4NDL A;  1XD7 A;  2IA0 A;  3CUQ B;  3OSG A;  1CF7 A;  2WV0 A;  2ZB9 A;  3IAS 2;  3JTH A;  2DFF A;  2CZR A;  4FET A;  5DM6 F;  3VEP A;  3X0N A;  3OWT A;  1TC3 C;  4ZG0 A;  1ZK8 A;  2VE8 A;  1OIS A;  2LDU A;  3EYI A;  3AC9 A;  2V9P A;  3FXO A;  1YYV A;  4HSR A;  1S8N A;  5B1B H;  4L5J A;  4PJL A;  5GHP A;  1FSH A;  1Q1H A;  3LAP A;  2QGU A;  3IKT A;  2YSR A;  1XC5 A;  3IKV A;  3JSO A;  3A02 A;  4ZC3 A;  2OPT A;  4EGY A;  4G6D A;  1UHM A;  4GYI A;  4IHV A;  4FE7 A;  5J8C A;  2HU9 A;  2PI0 A;  1HX3 A;  3KYL A;  3PNV A;  3T5X A;  1X3Z B;  1MD0 A;  2EBI A;  1O3T A;  1GV5 A;  1FOW A;  3LFU A;  1OJL A;  2ETH A;  3F3X A;  3PL8 A;  3F6O A;  3CDI A;  2NOJ B;  2QVO A;  3OYJ A;  3Q3S A;  4RAF A;  3J80 Z;  3A01 A;  3ZGK A;  1WKM A;  1HKQ A;  2VPR A;  2ECC A;  1X4P A;  2JT1 A;  3OYC A;  9ANT A;  1AA7 A;  2IW5 A;  2A05 A;  2DPD A;  5LGT A;  4KIS A;  2DFH A;  5EYR A;  1OCT C;  5FKN A;  2ICK A;  4G6T B;  1R7J A;  4J7H A;  1MIJ A;  2HTS A;  3FF5 A;  1SFK A;  5FO5 A;  4BY1 J;  2D1H A;  1LE8 B;  1MMA A;  4BQA A;  3F21 A;  4WXC A;  1T95 A;  3ZCO A;  3PUF A;  3Q0V A;  5GHJ A;  3HRT A;  2QQ8 A;  2V1D A;  2VE9 A;  3CC2 I;  3MQ0 A;  2VQL A;  4ENK A;  4BBR J;  1EJ9 A;  3U53 A;  4MQ9 F;  1VF9 A;  3AL0 B;  5LPG A;  5KAI C;  5ILU A;  3OL3 A;  3DPL C;  1TW3 A;  3D5S C;  2L0K A;  2QQB A;  5CLS A;  4ESB A;  3F13 A;  5BS6 A;  1JKR C;  4D7M A;  1UZC A;  1IUF A;  3BWG A;  3HOZ J;  3X0R A;  4F7Z A;  3BJ6 A;  1WJB A;  2EFN A;  2VJI A;  3QPS A;  4BQN A;  4I7H A;  4L18 B;  3DWL E;  3OR2 C;  1D1C A;  4RDU A;  3BTI A;  2ZBK A;  4B3X A;  2RQP A;  2V9V A;  3KZZ A;  1SD4 A;  3A01 B;  2E5Z A;  2DSC A;  3ROU A;  3DV8 A;  4RB3 C;  2XPU A;  2W82 A;  5ILV A;  3K70 D;  4ON0 A;  1SFO J;  1WI9 A;  2RQQ A;  4IQ4 A;  3VFZ A;  3M8F A;  5FSK A;  3HOW J;  5LRS A;  3ABL H;  3PUB A;  4CA0 A;  2WC2 A;  4B44 A;  1EH7 A;  1TL8 A;  2HR3 A;  1WJA A;  2E19 A;  2LG4 A;  4BDZ A;  3L1P A;  2DFI A;  3QPL A;  2MAB A;  3KLO A;  2A6E F;  3F6A A;  2K9L A;  1FMV A;  3AG3 H;  3GO5 A;  2JA7 J;  4I76 A;  1XGN A;  1X19 A;  2R7T A;  4XOP A;  2DK8 A;  4BE2 A;  3JRE A;  1GUU A;  1YE9 A;  1MDM A;  3T1B A;  1PUE E;  4XM3 A;  3OIQ A;  4XN3 A;  1RUN A;  2O5W A;  3A6T A;  1F43 A;  5ANV A;  3KCC A;  1VND A;  1VC9 A;  3WHW A;  4Q4Z F;  1BI1 A;  2X0L A;  4X1E A;  1ZGJ A;  1HOM A;  4AC0 A;  3U9G A;  3O2P E;  4LIT A;  3NRV A;  3F23 A;  5FD6 A;  5JHU A;  1D3Y A;  1DP3 A;  3IWF A;  2VIX A;  4PJM A;  4BY7 J;  4Q48 A;  4XKC A;  4LJZ F;  4II3 A;  2OC6 A;  2M2E A;  3OS0 A;  4A93 J;  2MFZ A;  1S7A A;  1XSD A;  2GT2 A;  5GTH C;  2A8T A;  1FTZ A;  3MCZ A;  2YVM A;  2BVM A;  4LD5 A;  2VB6 A;  1TWC J;  5IT3 A;  2IRF G;  2VXD A;  4PGG A;  1J9I A;  2DCE A;  4IRH A;  2XSJ C;  4IXA A;  1LB2 A;  2OUM A;  4CIC A;  5FKO A;  1FLI A;  4LK0 F;  3RDI A;  4XID A;  4DIQ A;  5CFJ A;  3A03 A;  1TWG J;  1F3Y A;  2DBB A;  2NS8 A;  3X0P A;  2W84 A;  1U8B A;  3FKJ A;  3GLL A;  3PQJ A;  3FXL A;  3ZMV A;  1DQU A;  4LMY A;  2L4M A;  2OZU A;  2FKB A;  4E7K A;  5DCF A;  5GPC A;  2GLO A;  3PIO F;  1JUP A;  3DBL B;  5LGN A;  1SU2 A;  5LLQ A;  5EDN A;  1XTA A;  1OR7 A;  3SEZ A;  4UVC A;  4OIP F;  1TBX A;  1N78 A;  4B4C A;  2VBW A;  1BJA A;  5DUK A;  2Z3Y A;  1FBQ A;  4AM3 A;  3FIW A;  2QWW A;  4RA2 A;  1IZ1 A;  5DD8 A;  1ACI A;  2F5F A;  3CCL I;  1LKX A;  2JA8 J;  2UXN A;  4A5M A;  4G7Z F;  2CYY A;  2PJP A;  4HNU A;  4LLG F;  4XLC A;  1K61 A;  4LG0 B;  2TDX A;  3WGH A;  2EFQ A;  4CYD A;  4ZYH A;  2DT7 B;  3LA3 A;  2H09 A;  2XB0 X;  3BTJ A;  3D5R C;  2BEO A;  4XQF A;  3KEO A;  5GAG J;  2EV6 A;  2CQK A;  5EG0 B;  3J81 Z;  4IHX A;  1Z21 A;  5FJ8 J;  2QF7 A;  3RCO A;  1IW7 F;  3KP4 A;  3HOU J;  3PO2 J;  1E17 A;  2CGP A;  4BEH B;  1FP2 A;  1M1E B;  5FLX K;  4KYW A;  1RRQ A;  1D0Z A;  4E70 A;  3GZN B;  4P55 A;  5F6F A;  4XRM A;  1QVU A;  3H5R A;  1RES A;  3LA7 A;  1OW2 A;  3I7U A;  3HEF A;  2IGM A;  3JAM K;  2M5W A;  4IJX A;  2JVH A;  2LF7 A;  1ZRD A;  2DT6 A;  3F0C A;  2Q0O A;  2QSH X;  1RR7 A;  5GHN A;  4UB6 C;  1QQI A;  5H2F C;  2PMZ A;  2MBF A;  1FIA A;  5TJJ A;  2E34 A;  2V1X A;  3DEW A;  2P6S A;  5BNG A;  5EGO B;  2TRT A;  1GHC A;  1ZQ3 P;  2Z16 A;  2ELK A;  3DKY A;  3FXK A;  3GX4 X;  1JGS A;  3CCJ I;  1OQY A;  3JRG A;  2FOW A;  3SFZ A;  4XSX F;  4L9T A;  5E1Z B;  1FIP A;  3JRF A;  2GXB A;  2K9Q A;  1BC7 C;  2XAG A;  1X51 A;  4R8H A;  5IYC J;  1TQI A;  4HF2 A;  3DXJ F;  4UV8 A;  3X0K A;  1LJ9 A;  4JX4 A;  1W0U A;  1AHD P;  4EM0 B;  4P5O A;  5ANW A;  2BVL A;  4N0B A;  1JXS A;  2Y9Y A;  2RC4 A;  2ZJP F;  2TCT A;  1VRL A;  2A8R A;  2OQG A;  2E2J J;  2QYO A;  4YIR X;  2IS6 A;  4C3H J;  5ED4 A;  1P4A A;  5TRD A;  4ZDL A;  4CSW A;  4IZZ A;  1D8J A;  2WAD A;  3KP7 A;  3RSN A;  2XUB A;  4S2X A;  2RKH A;  2VLA A;  3K4L A;  4UXN A;  2MA3 A;  5FSO A;  2JVG A;  3QAH A;  5EGO A;  3K1P A;  3HZJ A;  4P9U A;  2R7Z J;  3GW2 A;  5E79 C;  3ZN0 A;  2OV7 A;  3A2K A;  2UUZ A;  1HBX G;  3BCB A;  1WFX A;  1JJ8 C;  1V8M A;  2XGX A;  4XLN F;  1IUY A;  4YFK F;  1FPQ A;  1PUF A;  1SAX A;  4O3M A;  1Y1V J;  3R0A A;  2L2O A;  5F1J A;  2FBK A;  4CCK A;  3ZMS A;  5LBQ A;  2IS2 A;  4CCL A;  1IDZ A;  3M1E A;  2DLL A;  1WWX A;  4NQW A;  2X6O A;  1I27 A;  4IHY A;  3EEU A;  4WXH A;  4E7H A;  4ESJ A;  3VDX A;  2DT5 A;  4M6V A;  3BCA A;  3SQN A;  4M3D A;  3W2A A;  1NHA A;  3HRS A;  1X1A A;  4HDV A;  2I8T A;  3S1Q J;  3JCU C;  3BR5 A;  1XMK A;  3BDD A;  1W0T A;  2F5E A;  1G3T A;  2B63 J;  2VQH A;  2Z9O A;  1OFC X;  3EDP A;  4A0Z A;  2LY9 A;  3PFI A;  1V8R A;  5FFX A;  2HQ5 A;  4B09 A;  3TW7 A;  1I5Z A;  1UFM A;  2Y69 H;  5FSI A;  1R6R A;  3TKY A;  1NTC A;  2EIM H;  4XBF A;  3CCU I;  1UG2 A;  4I0B A;  1ZG1 A;  2FEZ A;  4BHP A;  2CUF A;  1FP1 D;  5M3F J;  5IW5 A;  1ZN2 A;  3O6B B;  3JRA A;  1WJD A;  3S1N J;  1KT9 A;  4YFN F;  2JRM A;  3HL2 A;  2FVV A;  3FFU A;  1IV8 A;  2DO7 A;  4PUS A;  1STZ A;  1WH7 A;  1Y8Q B;  1T0F C;  2E5N A;  2JQ7 A;  1ZTR A;  3TP3 A;  3HTS B;  2QBY A;  1QGP A;  4EAT A;  3FZV A;  1R23 A;  1PJR A;  1DU6 A;  3GVA A;  5IP9 J;  1RUO A;  5EZH A;  3O61 A;  1X58 A;  2F5V A;  1SFX A;  3HJE A;  2BXZ A;  3G2B A;  5L3C A;  2MH9 A;  4BJ6 C;  2BZT A;  2PX9 A;  2AO9 A;  4E4H A;  3VYT B;  3X0I A;  1P7I A;  2GA2 A;  1V5F A;  4RLQ A;  1V4R A;  1UG0 A;  2JPB A;  4HG2 A;  1Q54 A;  2R92 J;  4XLE A;  4C2U A;  4DYR A;  1U6G A;  1E2X A;  1YX3 A;  3R6S A;  4X0G A;  3WTY C;  5FKL A;  1K4T A;  2QM3 A;  5TGT A;  1B8I A;  4M3E A;  1J7K A;  2DDB A;  4BDY A;  2P7C B;  3FJY A;  3I5U A;  1Z6R A;  5CQE A;  4A3J J;  3Q1P A;  1F1Z A;  2V4J C;  4IHT A;  1MUT A;  3I64 A;  3G4S I;  4C9X A;  4D5F A;  5FRN A;  3G6E I;  3REO A;  2KP6 A;  1K6Y A;  1R5G A;  1VCD A;  4F91 B;  2ADU A;  2A68 F;  2W4E A;  3C1D A;  5FSM A;  2QLZ A;  3OYF A;  2K9S A;  2MG4 A;  3F72 A;  2UV1 A;  1VQ5 I;  4UVB A;  2PQV A;  5CPR B;  3BHO A;  2NS0 A;  2ZNY A;  5DS9 A;  2HZT A;  5HLG A;  3BQY A;  4CXF A;  2L5Q A;  2M30 A;  1D5V A;  1T39 A;  4WX9 A;  4OAY A;  3JRB A;  1HQC A;  4ENN A;  1V8U A;  3BAP A;  2HXO A;  3FBI B;  2VJ4 A;  4FX4 A;  4XSZ F;  3B73 A;  2ZSH B;  4L5E A;  2O5F A;  4Y15 A;  2XAH A;  1B72 B;  1MP2 A;  1G3S A;  1SEU A;  1S5L C;  4C2M J;  3VOD A;  1FMW A;  3P6Y A;  1S7O A;  2H94 A;  3HUG A;  3CMY A;  1LQ1 A;  2LTP A;  4A5N A;  3OYK A;  1YTY A;  3TO9 A;  3TMO A;  2H8R A;  3RYP A;  2V79 A;  5K1Y A;  1YIJ I;  2QUF A;  2Y75 A;  2O9L A;  1BI2 A;  2DYS H;  5I8U A;  5EG0 A;  1QZY A;  5DUI A;  5HDK A;  1MND A;  3DTE A;  2XRL A;  4NFX A;  1OCZ H;  1WVR A;  2KFD A;  1HW2 A;  4AUX A;  4A3C J;  2KZG A;  1J0R A;  2R7S A;  2YUS A;  4L9N A;  2E1O A;  3LL7 A;  1R5H A;  1TTY A;  2ZO4 A;  4V2G A;  2OU2 A;  4F3Q A;  1L0O C;  3C18 A;  3R60 A;  5D5X B;  2ID3 A;  2BHZ A;  3PSI A;  4HOB A;  3KP3 A;  2AHQ A;  1T0F A;  3K7A J;  3S2W A;  3ZMZ A;  5HOO A;  5GHQ A;  1N77 A;  2R7W A;  1KQ9 A;  3ABM H;  1FYM A;  4MEX F;  1PPX A;  4KIF A;  1R71 A;  1PVF A;  4D1Q A;  1POG A;  1SMT A;  4U0Y A;  1Z9C A;  1SD6 A;  1JT6 A;  1Z6T A;  2M34 A;  3NEU A;  4XLH A;  1VC8 A;  2PLY A;  4AVZ A;  1E3O C;  3MEX A;  2IP2 A;  1XG1 A;  3HOV J;  4ZZL A;  1I3A A;  1V8N A;  5H20 A;  2GIV A;  4F55 A;  5HDN A;  1MBF A;  2EWN A;  5GP9 A;  4YFX F;  1XSB A;  3U2R A;  1IRY A;  2VNQ A;  3EES A;  2ZME B;  3IUO A;  2VON A;  4GCV A;  4N4N B;  5CJ9 A;  3HOS A;  3RJP A;  3WG7 H;  1MZB A;  4M9Z A;  5F0H A;  2R5Z A;  3ZP5 A;  2HQN A;  4BQO A;  2COB A;  5ICE A;  3S1M J;  1T56 A;  2OCE A;  2A6H F;  3OIO A;  2KRF A;  2G74 A;  3T8R A;  3MDG A;  3AG1 H;  3F8N A;  5E1X A;  1YO5 C;  1FOX A;  1U5T B;  3DU6 A;  3QOP A;  1VK6 A;  1V8W A;  2A8Q A;  4UVA A;  1FNN A;  3SYT A;  5D8L B;  3A6U A;  2O03 A;  1PPV A;  2OZ6 A;  4M3B A;  3H9J A;  5J47 A;  3CMA I;  2GOM A;  4M71 A;  2L9V A;  2X4H A;  5IW4 A;  4RM3 A;  1X1C A;  3BG5 A;  1XCB A;  5L3D A;  1F5T A;  1NFS A;  1H89 C;  1E3H A;  3L09 A;  3LST A;  1QPI A;  1MMS A;  3RQI A;  2VOO A;  2KIM A;  2DUK A;  2AXT C;  3GLX A;  5M5Y J;  5J1U A;  2XF5 A;  1GVJ A;  3PO3 J;  1V5G A;  5B3S H;  2YVN A;  1ETQ A;  2EIL H;  3AKZ A;  2HNH A;  2Q9P A;  3ZQC A;  3CCY A;  1K78 A;  2UWM A;  2KQR A;  4II2 A;  1AKH A;  1ZH5 A;  3COU A;  2P81 A;  5E3N A;  2R5Z B;  2QA4 I;  3KP2 A;  1J75 A;  2XSD C;  2Y2Z A;  2EFP A;  4ILQ A;  2BGC A;  4LIU A;  3AG4 H;  4Y7N J;  5BPI A;  2AZW A;  2CW7 A;  4WXD A;  1V54 H;  3OYD A;  1Z3Y A;  3E7L A;  1O4X A;  2IA1 A;  1R9T J;  1Z7L A;  1VHZ A;  2M0M A;  5K5R A;  4G6Q A;  2K9M A;  1YOV B;  1TQP A;  3TO7 A;  3L85 A;  2Y0M A;  4BQQ A;  3DLL F;  3ML6 A;  2QQA A;  1DGW Y;  4EGZ A;  5FKK A;  5EF6 A;  3BLY A;  3TED A;  4S04 A;  4N1T A;  4DQ2 A;  3MVP A;  2Z5U A;  1HDP A;  1QZZ A;  4KN7 X;  3FMR A;  4OWR B;  3KZY A;  4LOC A;  5ANS A;  1P92 A;  1JUS A;  2P0W A;  2EV5 A;  3A0B C;  2IGK A;  4JOM A;  3BR1 A;  2L7K A;  1JHH A;  2ZFU A;  2OF7 A;  1JJ6 C;  5CVJ A;  5LFA A;  2R93 J;  2F4O B;  2Q1Z B;  5C3E J;  1HCR A;  4MTE A;  4ZDO A;  2IJL A;  1EV7 A;  3ASN H;  3JRH A;  2QKL B;  2XPW A;  2ZXH A;  5J4Y A;  3FK6 A;  1A5J A;  4JK1 X;  2JJ7 A;  3K1N A;  2X1E A;  3COA C;  4BE0 A;  2EIK H;  3TOA A;  4WWC A;  3LWF A;  2J5P A;  3CJQ B;  2L7M P;  2MC3 A;  2VN2 A;  4PFP A;  3WGG A;  1O7F A;  4F93 B;  1A6I A;  3O6Z A;  2KJC A;  1KU3 A;  2CO5 A;  2MSY A;  1PPW A;  3O8H A;  5BPD A;  1D8K A;  1XSA A;  4YII A;  2F6C A;  3ASO H;  2M8E A;  4RBO A;  1Z0X A;  3CJT B;  5FSN A;  2WY8 Q;  1L3L A;  3OOU A;  4HW0 A;  1G0S A;  2GZW A;  5H6Q A;  2N8G A;  4NUB A;  2EH3 A;  1P2F A;  4PSW A;  5AON A;  4OIO F;  1QU3 A;  3GEZ A;  4HX7 A;  4QPQ A;  5J6X A;  4IPA A;  5HLT A;  2CQX A;  1WI3 A;  4RLF A;  3LSR A;  3MDI A;  1YJ9 I;  4I2O A;  3H0D A;  3BR2 A;  3FDY A;  3HKZ N;  3IH4 A;  2KIF A;  2R4G A;  3BPV A;  3P7N A;  4KMU X;  2KIU A;  2R7Q A;  2JVB A;  4MNU A;  3PJR A;  3PSF A;  4RAG A;  2I5U A;  3W2V A;  5DCM A;  2A69 F;  1OR7 C;  1UJ8 A;  4O6J A;  4D7N A;  4XOT A;  5F64 A;  1X83 A;  3OS2 A;  1LFU P;  1SVO A;  5FRM A;  4A3K J;  3ZMT A;  2LY2 A;  1DUX C;  5B66 C;  1V8T A;  2FBI A;  2NOG A;  3V7C A;  1GA7 A;  3QP5 A;  3FWE A;  2DOE A;  1ODD A;  1WJF A;  2F5C A;  1JUM A;  3I59 A;  4HA8 A;  2CV2 A;  2MYS A;  5E3O A;  2HQR A;  1SD7 A;  5IYD J;  1RI7 A;  1PYV A;  4BHC A;  2C6Y A;  2EFW A;  1YRN B;  4HYE A;  3SFI A;  3CCR I;  3X0L A;  1MK1 A;  2ESH A;  3DEU A;  4HQE A;  2ZNZ A;  5CVR A;  2HI3 A;  3O8S A;  3GME A;  2MLG A;  5E3M A;  1EKE A;  3BG9 A;  3QRF F;  3I4P A;  5C7T A;  4AYB A;  2W7N A;  3CCM I;  2WV1 A;  3F8F A;  3RPU D;  4Z6Y A;  2M3A A;  2MD0 A;  3LQR A;  3ZR0 A;  2MC4 A;  3CLO A;  3QPH A;  2ZC2 A;  1G3Y A;  4E7I A;  2ZJ2 A;  2CS3 A;  1WJC A;  2IGN A;  4C30 A;  3SZP A;  3FM3 A;  4A3L J;  1MMG A;  2GA1 A;  4UUS B;  1TLH B;  2DDA A;  4A69 C;  3FMS A;  2VNP A;  5DEQ A;  1LFB A;  3CES A;  1A04 A;  2B0L A;  2VC0 A;  3MN2 A;  4RS8 A;  3V7S A;  1HA8 A;  3U1D A;  3S3N A;  3CO6 C;  5D5W B;  2KKO A;  2IBD A;  4MTD A;  3BPX A;  2L54 A;  1SOI A;  1ZYR F;  2FOK A;  5E17 F;  3K4K A;  1CF7 B;  1FZP B;  3G0Q A;  2AXL A;  3LQQ A;  3M8E A;  2X48 A;  4E7J A;  4XK4 A;  1UST A;  4MO7 A;  5JVT A;  1X3W B;  1T38 A;  1HXD A;  5C7Q A;  4XIC A;  1BM9 A;  1APL C;  2Q8K A;  1I50 J;  3OYA A;  1DPU A;  5JFR A;  3W6V A;  2ECB A;  5D5V B;  4M74 A;  4R79 A;  3I58 A;  2FMY A;  2VKH A;  3DBR B;  2MLK A;  3IAM 2;  5E18 F;  3K4N A;  1T98 A;  2V26 A;  1MMD A;  1U5T A;  4KA4 A;  3CCQ I;  1X2M A;  1ETO A;  3H9Q A;  4B1R A;  1GXP A;  4U7D A;  2VKD A;  1R58 A;  3UR3 C;  1GLN A;  1QVJ A;  3F8M A;  3M7G A;  1YX5 A;  3L2V A;  1MQE A;  5IP6 A;  3N77 A;  5EEA A;  1S7E A;  2Q2E A;  1VQL I;  2XAU A;  3IHU A;  2DA3 A;  3C3W A;  1HKS A;  5AIQ A;  3K4M A;  2O6G E;  3GTM J;  1ETY A;  5F27 A;  4IRG A;  5KHD A;  2GAU A;  4HF1 A;  1N25 A;  2JUG A;  3HUG B;  1KYW A;  1RKT A;  1RPW A;  3TDU C;  4LB5 A;  2CW8 A;  1ERD A;  3CCV I;  1Y0N A;  5IY5 H;  2BY1 A;  2PN6 A;  3X0O A;  4YIF A;  2LRD A;  2MH2 A;  2AS5 F;  1X1D A;  4QSH A;  3X0M A;  2D45 A;  4BXU A;  4ENJ A;  3ZQ7 A;  1Y56 A;  3Q4I A;  4BH9 A;  3H3U A;  4M9S A;  3BTC A;  4RGS A;  2E35 A;  4E6K G;  4FAS D;  4KIG A;  1U78 A;  1SFE A;  4BU2 A;  4JZV A;  2RNJ A;  4P9F A;  2CW0 F;  3KVH A;  1X1B A;  2CFO A;  3ABT A;  1OLT A;  2DW4 A;  1T33 A;  3I53 A;  4JP0 A;  4UHT A;  2K86 A;  1RC9 A;  3SMD A;  3BZ6 A;  2CV1 A;  3E6D A;  1VHG A;  3SDG A;  1MBJ A;  5LHG A;  2RVC A;  3PNT A;  4MEY F;  3Q0U A;  1OCC H;  4G8X A;  2JWT A;  1K79 A;  5DV5 A;  2DMP A;  3FCM A;  2QSF X;  3WE2 A;  3CJN A;  4P1W A;  1YW9 A;  3TBI A;  2R7V A;  4ESF A;  1ETW A;  5HNF A;  3ID9 A;  5GPA A;  4EJW A;  1R4M B;  1X2N A;  2LP0 A;  3HYQ A;  4HF0 A;  3QU3 A;  4YPH A;  5DD4 A;  3F8C A;  1VQN I;  1LDD A;  2CQN A;  4V19 K;  4CGZ A;  4M72 A;  2E1N A;  2P6T A;  1D5Y A;  4K6E A;  1O3Q A;  3AAF A;  4KG4 A;  1JKO C;  2K40 A;  4HV5 A;  2PNY A;  5J4V A;  5KNL A;  4HST A;  3FMQ A;  2FSW A;  3DPT A;  2ME6 A;  3X2Q H;  3J81 K;  1MJ9 A;  4U0W A;  1VQK I;  3LA2 A;  3HHG A;  3N97 A;  2K85 A;  2VXZ A;  1D0X A;  5L3E A;  3S16 J;  3ZRG A;  1WQ2 A;  2LFB A;  1U2W A;  1YS6 A;  2Z99 A;  2HQA A;  2OCC H;  3CMM A;  3NWS A;  4QWQ A;  3HPH A;  4PSX A;  4G94 A;  1W7P D;  3FX3 A;  1P4W A;  2BY3 A;  1W36 D;  3Q2S A;  1W4M A;  4J00 A;  1MJA A;  1CQT A;  3DPU A;  1XS9 A;  1O3S A;  3BR0 A;  4DYW A;  3DP7 A;  1ZEL A;  4X6A J;  5LGU A;  3K69 A;  3HOX J;  2FJ1 A;  1K2E A;  3D0S A;  4ABZ A;  1YLF A;  4NQW B;  4WF2 A;  1XMX A;  2BW3 B;  3UNG C;  2HGC A;  2XV4 S;  3I71 A;  2OD5 A;  5EZG A;  3EUH A;  3CCS I;  3O69 A;  1PP8 F;  4UUT A;  3OGA A;  2LMD A;  3WTT C;  2FNA A;  3H0G J;  3MZY A;  4P96 A;  3OYL A;  5F04 A;  2A8P A;  2QEN A;  3EYY A;  4N9H A;  2L01 A;  2WY7 Q;  3VSL A;  2PQ8 A;  3CLQ A;  4NNJ A;  4W1U A;  3X0J A;  3EXQ A;  1XB4 A;  2L9S A;  4ICK A;  5HNH A;  2KT0 A;  3WHC A;  1LE8 A;  1YHQ I;  2LYC A;  3K4J A;  2P5V A;  2V1U A;  4DGW B;  2R5Y B;  5KAF C;  1KGS A;  2RV8 A;  2D1V A;  4U7B A;  2HYG D;  2DA5 A;  2FQ4 A;  4XKW A;  1HDD C;  3SZG A;  1OPC A;  3QQA A;  2M8G X;  4Y13 A;  2O8X A;  3MFK A;  3E6C C;  2RDP A;  5LHI A;  2NVY J;  4OIQ F;  3HRU A;  3CDL A;  4LG3 A;  2ELH A;  1KQ8 A;  5K5O A;  2B2K A;  3KYD B;  2F4I A;  3MKW B;  3IL2 A;  5K7H A;  4XLA A;  1TWF J;  2WWY A;  2NVU B;  2VBY A;  4M6Y A;  2BW3 A;  2CU7 A;  1RNL A;  3QOE A;  3CF2 A;  1XMA A;  2KDO A;  5FSL A;  2XAS A;  4XN0 A;  4JX6 A;  1H88 C;  5HLI A;  4HDU A;  3GUD A;  2VT3 A;  3M1C A;  1NQY A;  5M5X J;  3BR6 A;  3E5Q A;  4BXF A;  3ZPL A;  1IN6 A;  2E7W A;  2EPF A;  1W36 C;  5EEG A;  3RKX A;  4EJU A;  1D1B A;  1EF4 A;  5JR3 A;  1BBY A;  1PDN C;  1X4O A;  1O7L A;  2IPQ X;  1MSE C;  1DGR M;  4B43 A;  2XB5 A;  3TW6 A;  2Z1D A;  3FM5 A;  1YQA A;  2LSO A;  1VQ8 I;  1JTX A;  2NXN B;  2R7D A;  1B8I B;  1T2K A;  1S9H A;  2J5O A;  1XGO A;  1ZLJ A;  2HS5 A;  2Y0S N;  4JBA A;  1O3R A;  1K26 A;  2ICJ A;  3I7V A;  2GIZ A;  1Z77 A;  2DA7 A;  2DPU A;  2PJR B;  1G2H A;  2O1C A;  4Y17 A;  4RM2 A;  3S8P A;  1Y39 A;  2R3S A;  2CV0 A;  4BAY A;  2KDZ A;  1VQ6 I;  4HQM A;  1IJW C;  3O8G A;  1U8R A;  1ZRE A;  1MKM A;  2M7B A;  3L2C A;  1VZ0 A;  1JKP C;  2XAQ A;  2HOT A;  2CQQ A;  4KYX A;  1G9Q A;  3I4M J;  1V55 H;  2M0C A;  4S2Y A;  2BOL A;  3QYE A;  1KYZ A;  4BS9 A;  3ZXS A;  4DW6 A;  1MH3 A;  1WPK A;  4ZJZ A;  2P7V B;  4A3I J;  1T8I A;  3NAU A;  1ETX A;  1BR1 A;  4FT8 A;  5FLM J;  4CHU A;  4A3B J;  1MQW A;  2G7U A;  1T08 B;  1U3E M;  1HF0 A;  1VI0 A;  1T6S A;  1SC7 A;  3H3V K;  3ZQF A;  3WHB A;  5C4J J;  2KHM A;  3BZC A;  4MPO A;  3GWY A;  3MAJ A;  3WOD F;  1I6X A;  1NK2 P;  1MBE A;  4OMY A;  2HOA A;  4TV7 A;  1N75 A;  3RYR A;  5D8K B;  5B1A H;  4UNO A;  2HEO A;  3I9V 2;  3EUH C;  4PZJ A;  4PFO A;  4ZTJ A;  3P9I A;  3FBN B;  2OBP A;  1TWA J;  3TQN A;  1W1W E;  1LDJ A;  4IL6 C;  2KMU A;  4ZYA A;  3HG9 A;  4EM1 A;  1IDY A;  3I56 I;  1HW1 A;  1ZGW A;  2NRA C;  4HX4 A;  3GZ8 A;  1R00 A;  3KZI C;  3S32 A;  3QSJ A;  2EIJ H;  1S6L A;  3GRN A;  1YRN A;  5F0C A;  4HNV A;  5BON A;  3ABU A;  1BI3 A;  1OYY A;  2VPL A;  1OYI A;  3S3O A;  2QQ9 A;  2DSD A;  2I10 A;  5LEK A;  4C2T A;  3CUQ A;  4MFE A;  1H0M A;  2YYH A;  2X1D A;  2CSO A;  3HPG A;  4A3E J;  4IF4 A;  1G8X A;  1S3J A;  5CYV A;  2K02 A;  2LBF A;  5DYM A;  1V8I A;  4Y3O A;  5HDG A;  2YU3 A;  3KPH A;  1I6H J;  4RGU A;  5DTD A;  1X3U A;  2R5W A;  1DDN A;  3KE2 A;  2CMP A;  3I55 I;  1NG6 A;  3V8L A;  3RKQ A;  1BC8 C;  1A36 A;  3EUA A;  2FD5 A;  1YIO A;  4IKF A;  1R1T A;  2XRO A;  4V14 A;  3JAM Z;  2DQR A;  1KA8 A;  3MZ8 A;  2PMZ N;  5IPA A;  2IT0 A;  4UB8 C;  2VOP A;  1BW6 A;  4IHS A;  2NNY A;  3S3M A;  3EET A;  3C7J A;  4L9V A;  5FRO A;  2GB5 A;  4E7Z A;  4Z2Y A;  3K2Z A;  5ICF A;  4CYC B;  3HSE A;  2Z2S B;  3ZR1 A;  3RI4 A;  2JA6 J;  1IXS B;  4B47 A;  2NVX J;  2R7F A;  3HSF A;  1UHW A;  3WU1 B;  2BE5 F;  4PK4 A;  3RIR A;  2JMW A;  3ELK A;  5CVI A;  4LLL A;  2V1N A;  5DM7 F;  5ICC A;  1VQ4 I;  2NS7 A;  2L9N A;  3BTL A;  3W3C A;  3S15 J;  2B7E A;  4EQQ A;  2F5D A;  4W97 A;  4PJJ A;  4MQV A;  1NH3 A;  3LSH A;  3SZT A;  3HKZ A;  1REP C;  1SFU A;  4OIR F;  1F9N A;  3WTZ A;  1S29 A;  4KIB A;  5K7Z A;  1IRG A;  2M87 A;  3E5U A;  3VYR B;  3J7Z I;  2HYJ A;  3RPQ A;  4I98 B;  5HVQ C;  4E7L A;  1SAN A;  3NWT A;  3WG9 A;  3KIO A;  4NB5 A;  4I99 C;  1JKQ C;  4IQJ A;  1VIQ A;  3RQ4 A;  4IRI A;  3TOB A;  1XCV A;  2YX4 A;  2VC1 A;  3PNY A;  1V8V A;  2FRH A;  5F08 A;  5HZX A;  3AL0 C;  4GGG A;  2DK5 A;  1IXC A;  1R67 A;  4S05 A;  3G73 A;  5M5W J;  1UMQ A;  1KHZ A;  2F4M B;  2O61 A;  1IXR C;  4KJZ A;  4EJV A;  2EA4 A;  2Q2E B;  4N9I A;  5GAH J;  5J8F A;  3G3Z A;  2DOF A;  1EH6 A;  2EZH A;  2O5R A;  3CCE I;  1U0J A;  3GTP J;  4NC7 A;  1JRK A;  3OYM A;  3SDB A;  3P5J A;  4IOC F;  1BI0 A;  2PBI A;  3K6G A;  3WTU C;  1IC8 A;  3FXR A;  4FIS A;  1R1U A;  5H6R A;  1X84 A;  1MBH A;  1AU7 A;  4BYY A;  1QRY A;  2KIS A;  1FX7 A;  2K27 A;  1ORK A;  3BJO A;  5JI6 A;  1HLV A;  2OQR A;  3HGG A;  2NVT J;  2ZXJ A;  1P7J A;  4BJT A;  2GXG A;  3H9G A;  4ZYE A;  4CUG A;  4Y4R A;  1NK3 P;  2E71 A;  3MD2 A;  1FYL A;  3I59 B;  4PJ0 C;  1XGS A;  1W7P B;  3DEE A;  2EB7 A;  1HZT A;  3HYI A;  2VKE A;  4AWX B;  3S93 A;  1IO2 A;  4XKV A;  3OYN A;  3GFJ A;  4IOA F;  2CG4 A;  2DFE A;  2VQC A;  2B9S A;  4I02 A;  4KIT B;  2KRH A;  1ONV A;  3GXO A;  1ON2 A;  5BOX A;  4EV0 A;  2A3S A;  3A1Y A;  1Z05 A;  1OCP A;  2PFB A;  4YPR A;  2ZJR F;  4G12 A;  2JK3 A;  1GVD A;  2HOE A;  3A6S A;  4CZC A;  1LDK B;  1GV2 A;  2KRC A;  1G6N A;  3TGN A;  2ZME C;  3V8J A;  2A61 A;  1MR2 A;  3FHZ A;  3CJR B;  1OYW A;  2JPC A;  3W6K B;  1UEL B;  1BR2 A;  4JYK A;  4CO8 A;  1IN8 A;  3QPT A;  3LSJ A;  3KFW X;  1QHG A;  2VL8 A;  3H92 A;  4CDG A;  4IVN A;  2HDW A;  2P4W A;  1B1B A;  5E1W A;  3WTX C;  2OAZ A;  3L9F A;  3OYE A;  4BBS J;  1UCR A;  2ISY A;  1BW5 A;  3VYU B;  5JHF A;  1EH8 A;  2DTR A;  3ZQL A;  1SZ3 A;  1ETK A;  2Y48 A;  2YVP A;  1JI8 A;  2LK2 A;  2Y30 A;  3OMY A;  1J5Y A;  1X1P A;  3ZQI A;  2HVR A;  2LRE A;  2NYX A;  3IP4 B;  3WU0 A;  5D6F A;  1IV6 A;  3HHH A;  1MJB A;  4CZZ A;  4IX7 A;  4N1U A;  5KK1 A;  4DOZ A;  3I3L A;  1QZE A;  2V6C A;  4RAZ A;  4A0X A;  1UHS A;  4ZTF A;  2M45 A;  3E0J B;  3HXL A;  4D0P A;  2K4B A;  2E60 A;  1PVE A;  5HS8 A;  4QPO A;  2LH9 A;  1IRZ A;  3R03 A;  4J01 A;  4K2E A;  1RZ4 A;  1FWZ A;  5IT9 K;  1J59 A;  3M3Y J;  2STT A;  5FLX Z;  1BJZ A;  1FTT A;  1VFC A;  2EQR A;  2L7F P;  4XRF A;  4YEL A;  4A3G J;  3MCF A;  4XNF A;  1XSX A;  1TNS A;  2IA2 A;  2XPV A;  2QJO A;  1CGP A;  4AIJ A;  4JZS A;  3JW4 A;  2QZ8 A;  5HS7 A;  4L0Z B;  4HVY A;  4AIH A;  3Q91 A;  5GHM A;  3Q2T A;  2H27 A;  4NHJ A;  2PG4 A;  1QA6 A;  5GTI C;  1QNT A;  3FXQ A;  1LUJ B;  2LD5 A;  3FXJ A;  2RGV A;  2V6E A;  2XGD A;  2FBH A;  2Y9Z A;  3PQK A;  3BT9 A;  3HOT A;  4RB1 A;  3HB9 A;  2YS9 A;  2CUJ A;  1ENH A;  4GO1 A;  3CO7 C;  3OYG A;  4FQG A;  1ZAR A;  4U88 A;  3N4M A;  4KFC A;  3WGI A;  5D4R A;  2GQQ A;  1OCR H;  2LBF B;  3HHJ A;  3G1O A;  1LEA A;  5D4S A;  5IOY A;  4S2V A;  3HIF A;  5TIS C;  1E3P A;  1TT5 B;  1USS A;  2IAI A;  4HBL A;  4DBQ A;  1JT0 A;  3IRR A;  4HRI A;  3CZ6 A;  4S0H B;  4FHT A;  2I6K A;  1KU9 A;  3K0L A;  1O57 A;  2VQG A;  3G1L A;  3OV8 A;  3F22 A;  1G4D A;  1DPR A;  2ELJ A;  3EPZ A;  1TW2 A;  1Q27 A;  3C2G A;  4CCM A;  4CCO A;  3LNQ A;  4A12 A;  3Q9S A;  3JR9 A;  2QJT A;  2Y31 A;  4NFW A;  1FJL A;  3KX2 A;  2CRG A;  1S72 I;  4D9J A;  5LD2 C;  4LB6 B;  4A2U A;  1VQ7 I;  2E2H J;  2J8Q A;  2L7Z A;  1P9Q C;  2X6Y A;  3V4G A;  3L2W A;  2YR2 A;  3MMY B;  5HOD A;  4ZDP A;  4XOR A;  4KUM A;  3PFY A;  2RN7 A;  3JRC A;  2XVC A;  2ICW G;  4PDK A;  5IOZ A;  1R1V A;  3BC8 A;  3BR3 A;  3EQL F;  1IN7 A;  2FU4 A;  1ON1 A;  2DQL A;  2HTJ A;  2I8D A;  3F6V A;  3I0T A;  5HLH A;  3MKY B;  3FSP A;  1YG2 A;  3L7W A;  2YX7 A;  2KDV A;  2ZXI A;  2VJ5 A;  1B9M A;  1RKW A;  3MKZ A;  5ISY A;  2YU9 J;  4RB0 A;  5C44 J;  3GZ5 A;  3KET A;  5CVU A;  2ZKZ A;  4ETS A;  2IS1 A;  2XGE A;  3K4C A;  5KCM A;  2LNB A;  2ISZ A;  1SJY A;  2HYF A;  2IGO A;  4OU0 A;  2DMN A;  3EUK L;  3GYH X;  2WB1 A;  5L3F A;  4CCN A;  1FOK A;  2GT4 A;  1ZKG A;  1KQ0 A;  4UUS A;  4IJA A;  2KJB A;  3D5L A;  2K4J A;  5LHH A;  3I54 A;  1YIT I;  1PUS A;  2DA6 A;  3DLA A;  3L2U A;  1BIA A;  5L3G A;  5GHI A;  3GFM A;  4A6E A;  1WZ2 A;  2EJR A;  3CME I;  2HVS A;  4UUV A;  1AOY A;  1Q1V A;  1BOA A;  2GM4 A;  4A0Y A;  3DCF A;  2M1B A;  1MBK A;  5FKM A;  1Z7U A;  2R7U A;  1WJ5 A;  2DJN A;  5ANT A;  1LFP A;  3HGY A;  3LSK A;  1SVL A;  2HXI A;  1MNE A;  3F8B A;  2D5V A;  4GRI A;  5IT9 Z;  2B06 A;  1MH4 A;  2KLO A;  4ZH4 F;  2GXA A;  3W6J B;  2D2W A;  3RKY A;  4LK1 F;  4A3F J;  4CH7 A;  2Z33 A;  3MZH A;  2FA5 A;  2DA4 A;  2ZSI B;  1Q33 A;  3JTG A;  5AIP A;  4KNY A;  4PJN A;  2CJJ A;  1FC3 A;  1U9N A;  2XAJ A;  2DMU A;  2PEX A;  1B9N A;  4A3M J;  4G7H F;  4GXO A;  3GWZ A;  2EZK A;  3J7Y e;  3RKW A;  3SHD A;  1WCM J;  2PMU A;  3E6M A;  2BXY A;  2FXA A;  1AKH B;  1IGN A;  2H6B A;  4D5C A;  5K5Q A;  4RGX A;  4HLY A;  2P8T A;  3GG6 A;  3VPR A;  3IRQ A;  1MNM C;  1MGT A;  2DI3 A;  1V5E A;  3J7A O;  3S14 J;  4MIM A;  5KVR A;  3FIS A;  3HC7 A;  5A2Q Z;  2ME0 A;  3V8K A;  3JRD A;  1NQZ A;  5ERI A;  4HZF A;  5GHO A;  3W2W A;  4FTH A;  3GTQ J;  4XRS A;  2X6W A;  1RR8 C;  2E1M B;  6PAX A;  1VQP I;  4H4K C;  3LSG A;  2BYV E;  3FK9 A;  4DJA A;  3FKI J;  4KMF A;  5FB2 A;  1H9T A;  3H35 A;  3K2A A;  3AFH A;  2DOA A;  4DYQ A;  3H1C A;  3LSM A;  2M7A A;  3ESW B;  1V8L A;  3KEQ A;  4KT5 C;  2WTE A;  3DTI A;  4LGW A;  3DKW A;  1XDS A;  2KZV A;  4YRV A;  4DYC A;  5E3L A;  1JKN A;  2KIQ A;  5LEJ A;  5GAE J;  1Y8R B;  2DMT A;  2ZJQ F;  3GF2 A;  2W4S A;  4YG2 F;  5CVV A;  1OCO H;  3M07 A;  1FOY A;  1ZG3 A;  1P6R A;  4JZT A;  5F0F A;  1WHU A;  3K1M A;  1PUN A;  3H36 A;  3RZO J;  1MDM B;  1V8Y A;  3JRI A;  2XRN A;  4UV9 A;  1IN5 A;  2G9W A;  4XLF A;  3U1K A;  1IAW A;  1JHF A;  2R5Y A;  1YW7 A;  3BP8 A;  1WJE A;  3GFL A;  3IWZ A;  3BG7 A;  2JUC A;  2VAS A;  4FX0 A;  4XLP F;  5BMZ A;  3B6A A;  3Q0W A;  3SEQ A;  1ULY A;  3BJA A;  5JLW A;  1VQO I;  4A6D A;  4F92 B;  2GOX B;  4BGD A;  3LMM A;  3OR1 C;  2E2I J;  4GFB A;  4JZU A;  4RMN A;  2JSP A;  2QKM B;  4HPQ A;  4EVI A;  1W7P A;  4ENM A;  3SJM A;  5D5U B;  2UXX A;  3BZK A;  3GTL J;  2JA2 A;  3ERM A;  4MLO A;  1B72 A;  4AIK A;  2XKP A;  5LRR A;  1ZRF A;  4B8X A;  1MW7 A;  2OA4 A;  4KIC A;  3VOE A;  2W85 A;  3DUP A;  4G7O F;  3OSF A;  3BM4 A;  4U0V A;  4HAM A;  3GTJ J;  3AG2 H;  4BHB A;  2STW A;  3DF8 A;  3OY9 A;  4ASN A;  5ILS A;  2ZCW A;  4DZP A;  1YJN I;  2R0Q C;  2VOD A;  2H1L A;  2XGC A;  1F4K A;  1LEB A;  1GT0 C;  1KTG A;  3B6C A;  1ZGA A;  3J7Y J;  3KP6 A;  4NC8 A;  1VTN C;  2LKS A;  3QYB A;  1OMI A;  4XON A;  1BIB A;  3RZD J;  4MGR A;  1FYK A;  4UY8 I;  2WA0 A;  4ZYD A;  2DTZ A;  2W57 A;  3OOP A;  2DU9 A;  3BRO A;  2HWV A;  3KYC B;  5FD5 A;  3K10 A;  3FXU A;  2JZY A;  3P9K A;  4A3D J;  2EK5 A;  4CYC A;  1I1S A;  1TUM A;  5FGM A;  3PM1 A;  1IN4 A;  1ETV A;  5K7F A;  3ZQG A;  2W00 A;  1KZH A;  3LSP A;  5FLV A;  2WAQ N;  3CF5 F;  3GZ6 A;  1R5I D;  3HSR A;  1ITY A;  3ACA A;  2KPM A;  1ZR4 A;  4EJT A;  3ECO A;  1DP7 P;  1NFZ A;  3NAR A;  2LOO A;  4GYG A;  1D1A A;  2VI6 A;  4EEF G;  1H8A C;  3GCM A;  3ZMD A;  5CFI A;  3L2R A;  5DPK A;  2XHK A;  3ZOB A;  2EIN H;  2DN0 A;  1R49 A;  1QVT A;  2HZD A;  2CWE A;  3GBG A;  4BUP A;  2IEK A;  2EZI A;  2EZL A;  3OIP A;  4XMY A;  1BR4 A;  1J2X A;  4WCG A;  3CDH A;  2IS4 A;  3T8T A;  1ZG5 A;  2H6C A;  2ZME A;  4HX8 A;  4OIN F;  3DU5 A;  3TO6 A;  5A2Q K;  4L5I A;  4AID A;  2K3F A;  1JGG A;  1HSJ A;  1NG7 A;  3E5X A;  2HPM A;  4BAC A;  1P4X A;  3WTS C;  2W24 A;  4U87 A;  3ISP A;  3E57 A;  1D0Y A;  4PCQ A;  3N9U A;  1RIO H;  5HS9 A;  4I0A A;  1Y0U A;  2XAF A;  3IH3 A;  4N4O B;  1E0E A;  2HVQ A;  1ZLK A;  2CUZ A;  2O0Y A;  2KDW A;  3SXY A;  5J1Y A;  4L0Y B;  1B6A A;  3A0H C;  3I9X A;  4O5V A;  4KDP A;  4E7S A;  3LOC A;  2EFO A;  3CP2 A;  5M3M J;  5JVG F;  1WH5 A;  2FUG 2;  5EJC A;  2XF7 A;  4IHW A;  3A6V A;  1DU0 A;  4M73 A;  3LAJ A;  2PJR A;  4FCY A;  2QEX I;  3GTK J;  3FK7 A;  3HTU A;  3A4C A;  2DAO A;  3E6B A;  1R4N B;  1W5S A;  2YPR A;  2BY2 A;  2HDD A;  2BBY A;  3VWB A;  5CQG A;  1K78 B;  2L9R A;  2WB1 N;  3L00 A;  4ITV A;  1U20 A;  2HPI A;  1U5T C;  1FY7 A;  2X9D A;  4M3F A;  4XRS G;  3MGM A;  4DNC A;  1TT0 A;  4FE4 A;  4QTR A;  2XKO A;  2A8S A;  4KT6 A;  4RAY A;  1XSC A;  1ZHF A;  1FT9 A;  1QHH D;  2L4A A;  2PMH A;  1TQM A;  1XSV A;  2HFH A;  2VJJ A;  3WE3 A;  2OTL I;  1YI2 I;  2EV0 A;  2DA1 A;  3C2B A;  2LY1 A;  4ZZD A;  4HFQ A;  2XF6 A;  2OJE D;  3LSI A;  3M9A A;  4QIW N;  4KTB A;  2R7R A;  2WAE A;  3RTR A;  3ECH A;  1G59 A;  1K83 J;  3LFK A;  4DZJ A;  1WSU A;  3GFI A;  3SON A;  1R36 A;  2CFX A;  2WAF A;  3BG6 A;  4L9J A;  1VQM I;  2DMQ A;  3V42 A;  5IP7 J;  2DYR H;  3ZMU A;  1JE8 A;  2AQF A;  3QYF A;  2G0E A;  2ID6 A;  3H5A A;  4LG0 A;  3RPU A;  5DDG A;  4BNC A;  1FSE A;  2AQE A;  3GTG J;  2W1O A;  3DQV C;  1J09 A;  1LVK A;  1FBS A;  1Z91 A;  1UAA A;  3HOY J;  1G3W A;  3Q93 A;  5C8L A;  5BQT A;  5IYB J;  2Y0S A;  3D1N I;  4XR6 A;  4CCJ A;  4LFU A;  2G73 A;  2LVS A;  1TNT A;  3X0Q A;  2FNP A;  1WRJ A;  2ZXW H;  2R7O A;  3VYS B;  3Q5F A;  3S17 J;  4BEH A;  1MMN A;  4NBQ A;  5C4X J;  4WK8 F;  2GBY A;  4C9Y A;  3S2H J;  1QBJ A;  1TP4 A;  1YJW I;  3X0S A;  4KN4 X;  3ZR8 X;  2W48 A;  3S1R J;  1KU2 A;  3BOQ A;  3L2Q A;  5CKT A;  5E8I A;  1A35 A;  1K4S A;  3IH2 A;  3G71 I;  4JX5 A;  2K9N A;  2WAQ A;  5J1R A;  1XGM A;  2UZK A;  1RRS A;  1C0W A;  2V9K A;  4R1H A;  3WTV C;  2LF8 A;  1AWC A;  3DKX A;  1XN7 A;  4MHG A;  3HM5 A;  4HV6 A;  3DTK A;  3ERE D;  3HBL A;  2HKO A;  1BL0 A;  1TWH J;  4OOI A;  1QO0 D;  4C3I J;  1HKT A;  4F52 A;  1ZR2 A;  5F1R A;  1ZRC A;  1XX5 A;  2JN6 A;  1RRJ A;  2FF4 A;  4BJ5 C;  5B5E C;  3HRM A;  3B02 A;  1Z1D A;  4OAZ A;  4Q5S F;  4RGR A;  4IO9 F;  4C9W A;  2X1C A;  3U21 A;  2L3D A;  1GDT A;  3E3V A;  2LKX A;  1SAU A;  1LNW A;  2LKP A;  3PIP F;  4H0E A;  1I1G A;  5JLX A;  3V7R A;  2KL4 A;  2QCO A;  4EMS A;  1UB9 A;  3E1S A;  3K70 C;  2FE3 A;  1QPM A;  4BL0 B;  3MWM A;  3ONQ A;  2LC2 A;  4I01 A;  2DA2 A;  3KP5 A;  1LVA A;  3BY6 A;  2VUM J;  3J7A Y;  4M6X A;  4RB2 C;  1XDU A;  2JA5 J;  1KON A;  1IRX A;  3CUQ C;  2XDV A;  3E97 A;  2F48 A;  3BQZ A;  4NC6 A;  2O7O A;  1A6Q A;  2CL3 A;  1I39 A;  4M9X A;  1I9A A;  3VSK A;  1BN5 A;  5ICG A;  3OYH A;  4Y52 J;  3C2H A;  2DJI A;  3QOD A;  2A5W A;  1TZL A;  5GAD J;  1Y1W J;  2MGQ A;  2R7X A;  1B59 A;  2DOD A;  1XPX A;  2E1M C;  2G7H A;  1A31 A;  4GDF A;  1HST A;  3IC7 A;  1V3F A;  4BKX A;  3M4O J;  2EA2 A;  3TL4 X;  3N05 A;  4KG3 A;  2WBM A;  2QSG X;  2F2E A;  2XIG A;  5FFZ A;  3OL4 A;  1IG7 A;  3SHF A;  4M3G A;  3NQO A;  3VB2 A;  4V2F A;  1U9O A;  1K7A A;  1BA5 A;  3CD6 I;  3WU2 C;  2W25 A;  3QP6 A;  1HW5 A;  1W5T A;  1I3Q J;  5E8G A;  1R22 A;  1YFH A;  2VBZ A;  4G9Y A;  2NNN A;  3ZN1 A;  2YVO A;  2COM A;  2P5K A;  2X85 A;  2P5L C;  2JRT A;  2NVQ J;  2ZFW A;  1JTY A;  5J3L A;  1SD5 A;  3G1M A;  1VQ9 I;  3H3Z A;  4LIV A;  2NAZ A;  1B4A A;  1F36 A;  2FQ3 A;  2RRE A;  4YOQ A;  3MKL A;  3CTA A;  1SMY F;  2OTJ I;  3EF5 A;  3M8J A;  2IXS A;  2ACJ A;  2FX0 A;  4S2W A;  2ESN A;  1YS7 A;  2K5C A;  4Y33 A;  4AD9 A;  3P5T A;  4XL9 A;  2BHY A;  3FXM A;  2A07 F;  4OMZ A;  3T0Y A;  4B48 A;  2HOS A;  1EA3 A;  1W5C C;  2XC7 A;  2CUE A;  2M4K A;  2CQ7 A;  3FHN A;  3CQZ J;  3Q9V A;  3TP0 A;  3OYI A;  3BG3 A;  4AYB N;  4I6Z A;  5DCM B;  2K3P A;  3DBH B;  3J80 K;  1IF1 A;  3R61 A;  2K7L A;  1IRF A;  4J19 A;  3K4B A;  5ANU A;  5EEH A;  1MSF C;  3GTO J;  4BXX J;  1RYA A;  2H8W A;  5E20 A;  2QBY B;  3CUO A;  3ABK H;  3WTW C;  1KU7 A;  2E36 A;  1V8S A;  2V7F A;  1Z67 A;  3OS1 A;  4JQF A;  2M9H A;  4IEJ A;  3O52 A;  2VT2 A;  3ZQH A;  1ZAO A;  2JTV A;  1MBG A;  3IV5 A;  3TDZ C;  4LLN A;  3CC4 I;  2DHO A;  2HDC A;  3H95 A;  4YEJ A;  2O8K A;  3R0J A;  3RH7 A;  1LPQ A;  1VIU A;  4QLC U;  2RNG A;  3JSP A;  4J7G A;  1WGX A;  2DSB A;  1FBU A;  1GXQ A;  1Y6I A;  2A6T A;  5D6E A;  4C3J J;  3DKU A;  4PGH A;  2A5Y B;  1RET A;  4ANJ A;  2BY0 A;  3R4K A;  4EJO A;  3HDD A;  1HC8 A;  2DXI A;  4DBR A;  3QU6 A;  1SVM A;  2VKV A;  2VBX A;  2X51 A;  2IVM A;  3OYB A;  3K9T A;  3KEY A;  2B0V A;  2X6X A;  3P9C A;  4EM2 A;  3KLN A;  2L02 A;  3O3K A;  2O3F A;  1H9G A;  1Z3X A;  4Q47 A;  2CH0 A;  2H1K A;  2HKX A;  1BOB A;  1OKR A;  2BV6 A;  3ULQ B;  2RAE A;  4ZYG A; 
#chains in the Genus database with same CATH homology
 4U7B A;  3CP8 A;  1V8U A;  3BAP A;  3FBI B;  2VJ4 A;  4XKW A;  3SZG A;  4HNT A;  4CH7 A;  4HEA 2;  4BE1 A;  2XSQ A;  2ZSI B;  2ZSH B;  1Q33 A;  2O5F A;  4LG3 A;  3H5N A;  3F9K A;  2M4G A;  2B2K A;  4AU7 A;  1MP2 A;  2F4I A;  3CNG A;  1PUQ A;  3MKW B;  4PJN A;  3ZQQ A;  4XLA A;  2I8U A;  2RRK A;  1FMW A;  3P6Y A;  2FML A;  4XKB A;  2BW3 A;  3J7Y e;  3SHD A;  3QOE A;  3OYK A;  3CF2 A;  2KDO A;  3TMO A;  5FSL A;  4XN0 A;  3M1C A;  1NQY A;  3IAS 2;  3GG6 A;  4BXF A;  2CZR A;  4FET A;  5I8U A;  1W36 C;  1V5E A;  4NFX A;  1MND A;  3DTE A;  3X0N A;  3OWT A;  4ZG0 A;  3HC7 A;  1D1B A;  1NQZ A;  2R7S A;  3AC9 A;  5GHO A;  3W2W A;  3LL7 A;  4HSR A;  2X6W A;  1X4O A;  2E1M B;  4PJL A;  1DGR M;  4H4K C;  3LSG A;  5GHP A;  4B43 A;  3FK9 A;  4DJA A;  4F3Q A;  2Z1D A;  3H35 A;  4ZC3 A;  3PSI A;  3AFH A;  2DOA A;  3LSM A;  5HOO A;  1N77 A;  5GHQ A;  2M7A A;  2R7W A;  1V8L A;  1PPX A;  1S9H A;  2HU9 A;  2ICJ A;  1K26 A;  1HX3 A;  1PVF A;  4D1Q A;  3DTI A;  3KYL A;  2PJR B;  3I7V A;  2KZV A;  2O1C A;  4RM2 A;  3S8P A;  4YRV A;  3PNV A;  2CV0 A;  4XLH A;  1VC8 A;  1JKN A;  4AVZ A;  3LFU A;  2M7B A;  2W4S A;  1VZ0 A;  3PL8 A;  1V8N A;  4JZT A;  4F55 A;  1PUN A;  2NOJ B;  3OYJ A;  1G9Q A;  1XSB A;  4KYX A;  1IRY A;  2VNQ A;  1V8Y A;  3EES A;  4S2Y A;  2BOL A;  3ZGK A;  3IUO A;  3QYE A;  4N4N B;  4BS9 A;  1X4P A;  3ZXS A;  3OYC A;  3HOS A;  1AA7 A;  4XLF A;  4ZJZ A;  4KIS A;  4BQO A;  1BR1 A;  1MQW A;  1WJE A;  3BG7 A;  2VAS A;  2ICK A;  2G74 A;  3MDG A;  4G6T B;  4J7H A;  3DU6 A;  1SFK A;  3SEQ A;  1MMA A;  2KHM A;  4MPO A;  1VK6 A;  3GWY A;  4F92 B;  1V8W A;  2GOX B;  4BGD A;  1T95 A;  3LMM A;  3OR1 C;  3ZCO A;  2A8Q A;  5GHJ A;  4JZU A;  1N75 A;  4RMN A;  2JSP A;  2QKM B;  3SYT A;  2VQL A;  3I9V 2;  3EUH C;  3A6U A;  4HPQ A;  1PPV A;  3H9J A;  4PFO A;  4ZTJ A;  3U53 A;  3FBN B;  2GOM A;  5IW4 A;  2KMU A;  4ZYA A;  3HG9 A;  4RM3 A;  1X1C A;  3AL0 B;  1NFS A;  5LPG A;  3OL3 A;  3DPL C;  3F13 A;  3D5S C;  2JA2 A;  4MLO A;  2DUK A;  5BS6 A;  3GZ8 A;  3S32 A;  3QSJ A;  1MW7 A;  2XF5 A;  3X0R A;  3GRN A;  1WJB A;  4BQN A;  2VJI A;  1V5G A;  2YVN A;  3DUP A;  3DWL E;  3OR2 C;  1D1C A;  3AKZ A;  3BM4 A;  2HNH A;  2Q9P A;  5BON A;  2VPL A;  4B3X A;  3S3O A;  2DSD A;  2UWM A;  2KQR A;  2E5Z A;  4II2 A;  4C2T A;  2DSC A;  3OY9 A;  3COU A;  2YYH A;  2X1D A;  3HPG A;  2W82 A;  3K70 D;  1G8X A;  4ILQ A;  2LBF A;  1KTG A;  4LIU A;  1V8I A;  4NC8 A;  2RQQ A;  4Y3O A;  2AZW A;  2CW7 A;  3QYB A;  4IQ4 A;  3OYD A;  1Z3Y A;  4XON A;  2R5W A;  2WA0 A;  1Z7L A;  1VHZ A;  5FSK A;  2CMP A;  2M0M A;  3PUB A;  1NG6 A;  4CA0 A;  2K9M A;  4IKF A;  3EUA A;  3K10 A;  3L85 A;  4BQQ A;  4V14 A;  4B44 A;  1DGW Y;  4BDZ A;  1WJA A;  2LG4 A;  3BLY A;  4N1T A;  1TUM A;  3S3M A;  2W00 A;  4OWR B;  2MAB A;  5FRO A;  2GB5 A;  3ACA A;  3F6A A;  4E7Z A;  5ANS A;  2K9L A;  1FMV A;  2KPM A;  3GZ6 A;  2Z2S B;  3ZR1 A;  2P0W A;  4B47 A;  1NFZ A;  2LOO A;  1X19 A;  2IGK A;  1D1A A;  4JOM A;  2R7T A;  4XOP A;  4PK4 A;  4BE2 A;  2L7K A;  1YE9 A;  2ZFU A;  4XM3 A;  5LFA A;  3OIQ A;  5CFI A;  4XN3 A;  2O5W A;  3L2R A;  3A6T A;  5ANV A;  5DPK A;  2V1N A;  2Q1Z B;  1VC9 A;  2L9N A;  3WHW A;  3W3C A;  4ZDO A;  4PJJ A;  2HZD A;  4BUP A;  3GBG A;  2QKL B;  2ZXH A;  3LSH A;  3OIP A;  4XMY A;  1BR4 A;  3HKZ A;  4LIT A;  2IS4 A;  2X1E A;  3DU5 A;  4BE0 A;  1NG7 A;  3VYR B;  1DP3 A;  2VIX A;  4PJM A;  3CJQ B;  5HVQ C;  4E7L A;  2HPM A;  4XKC A;  4BAC A;  4PFP A;  4II3 A;  3NWT A;  2OC6 A;  4IQJ A;  1VIQ A;  4U87 A;  3OS0 A;  3E57 A;  3RQ4 A;  4F93 B;  1D0Y A;  3O6Z A;  2MFZ A;  3N9U A;  1PPW A;  2GT2 A;  1XSA A;  3PNY A;  1V8V A;  2A8T A;  2F6C A;  4N4O B;  1E0E A;  5HZX A;  2HVQ A;  2CUZ A;  3AL0 C;  2KDW A;  5FSN A;  2YVM A;  2BVM A;  2VB6 A;  2WY8 Q;  1R67 A;  3I9X A;  2VXD A;  3OOU A;  4E7S A;  2DCE A;  1KHZ A;  1G0S A;  2XSJ C;  4NUB A;  4KJZ A;  2OUM A;  3CP2 A;  4PSW A;  1QU3 A;  2FUG 2;  2Q2E B;  4QPQ A;  2XF7 A;  4DIQ A;  3A6V A;  5CFJ A;  5HLT A;  2O5R A;  4RLF A;  1JRK A;  3MDI A;  1F3Y A;  1U0J A;  2PJR A;  4NC7 A;  3OYM A;  3SDB A;  3X0P A;  3H0D A;  3K6G A;  3FDY A;  3FKJ A;  2R4G A;  3A4C A;  1X84 A;  1DQU A;  2R7Q A;  2JVB A;  3VWB A;  5CQG A;  3PSF A;  4E7K A;  3PJR A;  1U20 A;  4ITV A;  3W2V A;  2HPI A;  2FKB A;  3MGM A;  1TT0 A;  1OR7 C;  2A8S A;  4KT6 A;  1XSC A;  4XOT A;  1SU2 A;  1X83 A;  4BJT A;  2VJJ A;  1QHH D;  3H9G A;  3OS2 A;  4CUG A;  4Y4R A;  5FRM A;  3MD2 A;  3SEZ A;  2LY1 A;  2LY2 A;  4HFQ A;  1V8T A;  2XF6 A;  3LSI A;  1N78 A;  4KTB A;  3DEE A;  1GA7 A;  2R7R A;  1WJF A;  1LKX A;  2WAE A;  3RTR A;  1G59 A;  1HZT A;  2CV2 A;  2MYS A;  3S93 A;  4HNU A;  4XKV A;  3OYN A;  3SON A;  1PYV A;  4XLC A;  3X0L A;  1MK1 A;  2WAF A;  3BG6 A;  2VQC A;  3O8S A;  4KIT B;  2KRH A;  2DT7 B;  3V42 A;  3D5R C;  4XQF A;  2AQF A;  3QYF A;  3H5A A;  1Z21 A;  5DDG A;  2AQE A;  3RCO A;  2W1O A;  3A1Y A;  3DQV C;  1J09 A;  1LVK A;  1UAA A;  3Q93 A;  5C7T A;  4AYB A;  5C8L A;  2W7N A;  4BEH B;  1RRQ A;  2Y0S A;  3RPU D;  1D0Z A;  4XR6 A;  4YPR A;  2M3A A;  4CCJ A;  2MD0 A;  2G73 A;  3H5R A;  3X0Q A;  3VYS B;  3A6S A;  2R7O A;  1OW2 A;  4CZC A;  1LDK B;  3I7U A;  2MC4 A;  4BEH A;  3ZR0 A;  1MMN A;  2IGM A;  4IJX A;  2JVH A;  2KRC A;  4C9Y A;  4E7I A;  2CS3 A;  1WJC A;  2IGN A;  4C30 A;  2DT6 A;  3CJR B;  1MR2 A;  3X0S A;  3ZR8 X;  5GHN A;  1UEL B;  1BR2 A;  1MMG A;  2PMZ A;  5CKT A;  3L2Q A;  1QHG A;  2VL8 A;  2HDW A;  2Z16 A;  2WAQ A;  2VNP A;  5DEQ A;  3DKY A;  1RRS A;  3CES A;  2V9K A;  1HA8 A;  3S3N A;  3OYE A;  3DKX A;  3DTK A;  3VYU B;  5JHF A;  1SZ3 A;  2YVP A;  1SOI A;  1JI8 A;  4F52 A;  3OMY A;  3K4K A;  1X51 A;  4BJ5 C;  3G0Q A;  2HVR A;  2LRE A;  4E7J A;  3X0K A;  3IP4 B;  4OAZ A;  4P5O A;  5ANW A;  2BVL A;  4C9W A;  5C7Q A;  2X1C A;  3U21 A;  4IX7 A;  4N1U A;  4DOZ A;  3I3L A;  3OYA A;  1SAU A;  4ZTF A;  1VRL A;  2A8R A;  2KL4 A;  3E0J B;  3HXL A;  4R79 A;  2IS6 A;  3K70 C;  3E1S A;  2E60 A;  4BL0 B;  3ONQ A;  2LC2 A;  2VKH A;  4QPO A;  3IAM 2;  4ZDL A;  2LH9 A;  3K4N A;  4CSW A;  4IZZ A;  3R03 A;  4J01 A;  3J7A Y;  2WAD A;  2V26 A;  3RSN A;  4S2X A;  1MMD A;  2VLA A;  3K4L A;  1KON A;  3H9Q A;  1IRX A;  2JVG A;  2VKD A;  5FSO A;  3UR3 C;  1GLN A;  1QVJ A;  4YEL A;  1YX5 A;  2XDV A;  3L2V A;  1MQE A;  3MCF A;  3N77 A;  4XNF A;  2CL3 A;  2OV7 A;  3A2K A;  2XAU A;  1I9A A;  2UUZ A;  2QJO A;  3VSK A;  3BCB A;  3K4M A;  1WFX A;  3OYH A;  3C2H A;  2DJI A;  3QOD A;  2A5W A;  1TZL A;  2R7X A;  1V8M A;  4JZS A;  4HVY A;  3Q91 A;  5GHM A;  3Q2T A;  5KHD A;  3HUG B;  2JUG A;  2E1M C;  2L2O A;  4CCK A;  2CW8 A;  1ERD A;  3TL4 X;  3N05 A;  2V6E A;  2WBM A;  2IS2 A;  4CCL A;  4KG3 A;  3OL4 A;  3HOT A;  3X0O A;  2LRD A;  1X1D A;  3EEU A;  2CUJ A;  3X0M A;  4E7H A;  3VDX A;  1Y56 A;  3OYG A;  3Q4I A;  3BCA A;  3W2A A;  1X1A A;  4E6K G;  2I8T A;  4FAS D;  2LBF B;  3HHJ A;  4BU2 A;  2YVO A;  4JZV A;  4S2V A;  3KVH A;  1X1B A;  2CFO A;  1OLT A;  2X85 A;  2VQH A;  4DBQ A;  4HRI A;  3CZ6 A;  3SMD A;  2CV1 A;  2I6K A;  2VQG A;  1VHG A;  1V8R A;  2ELJ A;  4LIV A;  3EPZ A;  2RRE A;  3C2G A;  4CCM A;  3PNT A;  4CCO A;  1Q27 A;  4YOQ A;  2QJT A;  3EF5 A;  4NFW A;  3M8J A;  2IXS A;  3KX2 A;  3FCM A;  5FSI A;  1R6R A;  4D9J A;  5LD2 C;  4P1W A;  4S2W A;  3TBI A;  2K5C A;  4Y33 A;  2R7V A;  2J8Q A;  3P5T A;  4XL9 A;  5HNF A;  3ID9 A;  4B48 A;  1P9Q C;  1EA3 A;  2X6Y A;  3L2W A;  2FVV A;  5IW5 A;  2XC7 A;  1WJD A;  3FFU A;  1KT9 A;  3HL2 A;  3MMY B;  3HYQ A;  4ZDP A;  2M4K A;  3FHN A;  4PUS A;  4XOR A;  4YPH A;  5DD4 A;  1T0F C;  3PFY A;  2E5N A;  3OYI A;  4K6E A;  3BC8 A;  2K3P A;  4KG4 A;  2PNY A;  2I8D A;  4EAT A;  1PJR A;  5KNL A;  3K4B A;  4HST A;  3MKY B;  3DPT A;  5ANU A;  3FSP A;  1RYA A;  2KDV A;  2ZXI A;  2VJ5 A;  3O61 A;  2F5V A;  3MKZ A;  2VXZ A;  5ISY A;  3G2B A;  1D0X A;  4BJ6 C;  1V8S A;  3ZRG A;  3GZ5 A;  2V7F A;  3OS1 A;  2IS1 A;  4JQF A;  4E4H A;  2HQA A;  3VYT B;  3K4C A;  3CMM A;  3NWS A;  5KCM A;  3O52 A;  3X0I A;  1SJY A;  1V5F A;  3HPH A;  4PSX A;  2IGO A;  4RLQ A;  1UG0 A;  1Q54 A;  4HG2 A;  1W36 D;  3Q2S A;  2DHO A;  3H95 A;  3EUK L;  4XLE A;  4J00 A;  4C2U A;  2WB1 A;  3DPU A;  4YEJ A;  3RH7 A;  1YX3 A;  1VIU A;  4DYW A;  4X0G A;  4CCN A;  1ZEL A;  2RNG A;  2GT4 A;  5TGT A;  1K2E A;  4J7G A;  4BDY A;  3FJY A;  5CQE A;  2DSB A;  4NQW B;  3D5L A;  3Q1P A;  1Y6I A;  2BW3 B;  2V4J C;  2A6T A;  3UNG C;  1MUT A;  4C9X A;  3DKU A;  5FRN A;  1PUS A;  2KP6 A;  1K6Y A;  3O69 A;  1VCD A;  3DLA A;  4F91 B;  3OGA A;  2W4E A;  4ANJ A;  3L2U A;  5FSM A;  3OYL A;  2A8P A;  5GHI A;  3OYF A;  2DXI A;  4DBR A;  2WY7 Q;  2UV1 A;  3VSL A;  2PQV A;  2X51 A;  4NNJ A;  5CPR B;  3OYB A;  3X0J A;  2HVS A;  3EXQ A;  3BHO A;  3KEY A;  2B0V A;  2L9S A;  4ICK A;  5HNH A;  2X6X A;  2R7U A;  1WJ5 A;  1Z3X A;  2L5Q A;  5ANT A;  1LFP A;  2CH0 A;  2LYC A;  1BOB A;  3K4J A;  3LSK A;  1MNE A;  2B06 A;  4GRI A;  4OAY A;  4DGW B;  2KLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...