2QKMB

The crystal structure of fission yeast mrna decapping enzyme dcp1-dcp2 complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
266
structure length
266
Chain Sequence
MSFTNATFSQVLDDLSARFILNLPAEEQSSVERLCFQIEQAHWFYEDFIRAQNDQLPSLGLRVFSAKLFAHCPLLWKWSKVHEEAFDDFLRYKTRIPVRGAIMLDMSMQQCVLVKGWKASSGWGFPKGKIDKDESDVDCAIREVYEETGFDCSSRINPNEFIDMTIRGQNVRLYIIPGISLDTRFESRTRKEISKIEWHNLMDLPTFKKNKPQTMKNKFYMVIPFLAPLKKWIKKRNIANNTTKEKNISVDVDADASSQLLSLLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of dcp2 recognition and activation by dcp1.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase
molecule keywords SPBC3B9.21 protein
total genus 80
structure length 266
sequence length 266
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00293 NUDIX NUDIX domain
B PF05026 DCP2 Dcp2, box A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1050 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2qkmB01
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2qkmB02
1QVJA 2QJTA 2YVOA 3I9XA 1MP2A 5BONA 1KTGA 2YVMA 1NFSA 3X0MA 2I8UA 2A8TA 1K2EA 2DSCA 3CNGA 1V8SA 1V8RA 3U53A 5I8UA 3MGMA 1PUNA 1Q27A 2G73A 2YVPA 2B06A 2FKBA 3BAPA 4HVYA 1G9QA 1V8VA 4ILQA 4S2VA 5FSNA 5GHJA 1VIQA 2GT2A 3BHOA 4KYXA 3L85A 3Q91A 1V8IA 2G74A 2GT4A 3ID9A 1MQWA 3A6TA 2RRKA 3A6SA 3O8SA 1JKNA 1SOIA 1VHZA 3H95A 3O52A 3ZR1A 3FSPA 4KG3A 5BS6A 5DEQA 1KT9A 1VHGA 4N1UA 2B0VA 3DUPA 5FSMA 3DKUA 5GHOA 1VCDA 1MK1A 4KG4A 1VRLA 1TUMA 2A8RA 2KDWA 3P6YA 3F6AA 1SZ3A 5GHMA 1V8LA 1RYAA 3F13A 1I9AA 2FVVA 3ACAA 3N9UA 1VK6A 1X83A 3SONA 3G0QA 3O69A 3FFUA 5C7QA 2QJOA 3I7UA 2I8TA 2O1CA 3GG6A 4V14A 1GA7A 1V8TA 2I6KA 3A6VA 3Q2SA 1NQZA 2JVBA 3QSJA 5FSOA 3X0KA 3X0JA 3P5TA 5FSKA 1V8WA 2PNYA 1V8MA 2YVNA 5DPKA 2CL3A 1PUQA 5FSIA 1PPVA 4IJXA 3GRNA 4ZG0A 1SJYA 3GZ8A 2DSDA 1IRYA 1VIUA 1F3YA 4ICKA 3FCMA 5GHIA 3X0LA 5FSLA 5ANTA 4DYWA 2A8QA 3FK9A 2A6TA 2B2KA 2O5FA 3GZ5A 5DD4A 3KVHA 2W4EA 3BM4A 2XSQA 4JZSA 2Q9PA 1PUSA 4NFWA 2J8QA 4K6EA 4YPHA 3MDIA 2A8SA 3X0QA 5ISYA 5ANWA 3AC9A 1KHZA 2AZWA 3MDGA 4NFXA 4KTBA 3HHJA 5C8LA 1HX3A 4YPRA 5LPGA 2GB5A 2VNPA 3OGAA 1NQYA 2VNQA 1NFZA 4C9WA 3FJYA 3X0OA 2ICKA 1R67A 3COUA 5C7TA 1RRQA 2O5WA 1MQEA 1OW2A 1Q33A 1XSBA 3O6ZA 5HZXA 4JZVA 3X0RA 1PPWA 4JZTA 3RH7A 3O61A 4JZUA 4S2YA 4HFQA 1XSCA 1SU2A 3Q93A 5GHNA 1PVFA 5CFJA 4MPOA 4YOQA 3MCFA 3EXQA 3X0SA 3Q2TA 1G0SA 3N77A 3SMDA 3Q1PA 1U20A 1XSAA 3HYQA 3X0IA 2FMLA 3EF5A 2ICJA 5DDGA 2DUKA 1K26A 2DSBA 3EEUA 1MUTA 2DHOA 3X0NA 3GZ6A 1X51A 2YYHA 3A6UA 3J7Ye 1V8UA 2A8PA 5GHQA 3X0PA 1VC9A 4S2XA 5ANUA 1JRKA 1HZTA 3E57A 3WHWA 3ZR0A 3I7VA 1V8NA 1Q54A 2R5WA 3EESA 3GWYA 5IW4A 2PQVA 4N1TA 1RRSA 1X84A 2KDVA 5ANSA 4C9XA 5IW5A 3SHDA 2QKLB 2QKMB 1PPXA 3Q4IA 4S2WA 1V8YA 1VC8A 3R03A 1MR2A 5GHPA 5ANVA 5CFIA
chains in the Genus database with same CATH superfamily
1BBYA 2DO7A 2STWA 6PAXA 1B1BA 2WAFA 4GDFA 3CCLI 3TKYA 5LRSA 4HF1A 2WAEA 3HZJA 2DA7A 1Y1WJ 1D0XA 4OIPF 4XLHA 2EJRA 3SXYA 4Q4ZF 2G73A 1NK2P 2B06A 5TISC 4IXAA 4XLNF 4HVYA 1FBQA 1V8VA 3QU6A 5FSNA 3H3ZA 3NARA 2HDCA 3HIFA 4NB5A 1WSUA 4KJZA 2RRKA 1RZ4A 5CVIA 3ZMVA 2HOTA 4XIDA 2V79A 3AL0C 4N1UA 1Y8RB 2VC0A 4HF0A 4UVAA 1H0MA 4Y33A 3K70C 1ZK8A 1WPKA 5K7ZA 2KDWA 4ZYGA 5IP6A 3GTKJ 1XCVA 2KIMA 3S1NJ 3RQIA 1TBXA 3D5LA 2JA2A 3C1DA 3WHBA 1U5TC 3FFUA 4BQOA 3ZMZA 2LREA 5IYBJ 1Q1VA 3CLOA 5HLTA 1TQMA 3H1CA 2XKOA 4M73A 3PNVA 3O6BB 4UB8C 3J81K 2DXIA 2EWNA 3CUQA 3BR5A 4RBOA 1F3YA 2FBKA 2QENA 4E7LA 5D6FA 2O8KA 3FCMA 4M6YA 4FX0A 1HW5A 2ZSHB 4OWRB 3EYIA 2O5FA 3GZ5A 3DBHB 1DPRA 2W85A 1XGNA 2DFFA 4XMYA 3BQZA 4NFWA 3JAMZ 2CUEA 2M0CA 3X0QA 1XTAA 2EFOA 2J5PA 3AC9A 2M7AA 3TMOA 1KYWA 4CCKA 5EG0B 1JHFA 2FBIA 5HS7A 1J2XA 4J01A 1O3QA 2OA4A 2ZXWH 1QHHD 3DTEA 4E6KG 2D5VA 3FM3A 4EATA 3W6VA 1OPCA 1SFEA 1ZKGA 3MKZA 5HZXA 3L9FA 1FOXA 3X0RA 5BNGA 5BOXA 1XDUA 1IN6A 2YS9A 1SU2A 2EPFA 1T08B 1G4DA 1PVFA 2VXDA 2QVOA 1BC7C 3W2AA 1OYYA 1HW2A 3VYSB 1Z91A 2C6YA 3BCAA 1Z3YA 4ZTJA 4AU7A 2ZFWA 1K61A 2LY2A 2QSFX 2XGXA 4MEXF 4Q47A 5M5YJ 3BLYA 4OMYA 1E2XA 3NQOA 1JKOC 1XGOA 3OYLA 1I39A 3W6JB 1SFOJ 3ABTA 3E97A 4E7KA 2X1EA 2M4GA 3F0CA 1XCBA 2DW4A 4BQAA 4XKVA 2UWMA 1T6SA 1YIJI 2QKLB 3CUOA 5DCMA 3Q4IA 1ZR4A 3KP7A 1LEBA 3DWLE 2ZJQF 2ZBKA 1B9MA 3I53A 3P5JA 3L09A 4I0AA 1CGPA 4II3A 5KAIC 1AWCA 2BYVE 2DK8A 1IRGA 2P6SA 3SYTA 2E5NA 3ISPA 3WTUC 1X19A 3EETA 3S2WA 2CMPA 2XAQA 2QA4I 3G1OA 1D8KA 2LY1A 3HRUA 3I59A 4DQ2A 5ICFA 3BHOA 4M9ZA 1F5TA 2GT4A 3PUFA 5FROA 1OYIA 5CVUA 1FYLA 1B72B 4CCOA 1I50J 2M9HA 3WU0A 3BWGA 2V26A 4KG4A 1D5VA 3J7ZI 4FTHA 2IGKA 4WXHA 3F21A 1V8LA 1BIAA 3IWZA 1HC8A 4ZZDA 1V5GA 3TW6A 3E6MA 1ZG1A 2K40A 1S7AA 3EYYA 1S72I 2EA4A 3D5SC 2M8GX 3EPZA 3U21A 5FSKA 1AU7A 2YVNA 5A2QK 1J7KA 4BKXA 5HNFA 1YW7A 2EK5A 2R4GA 2FXAA 2VB6A 2EA2A 1I5ZA 1WCMJ 4BHPA 4WF2A 5E18F 5GHIA 2A05A 2OU2A 3O8HA 3KEYA 2FOWA 1X1BA 1Z0XA 4B43A 1WJEA 3IP4B 4AYBN 4RAFA 3KVHA 4UV8A 2LBFA 3O8GA 5E1XA 4JX4A 3JTGA 5DCFA 4A3CJ 4U88A 2KKOA 2ETHA 2M2EA 2HKOA 2O5RA 2CRGA 5ILUA 2XV4S 3BG5A 1ETWA 1VZ0A 1NQYA 2DT5A 4M71A 5D5XB 3X0OA 2GZWA 3LAPA 2O03A 1OW2A 4I7HA 2Z9OA 2Y30A 3ZQ7A 4JZTA 3RH7A 4EEFG 1PDNC 3KX2A 1U9NA 4AVZA 2JVHA 3OWTA 5F27A 3Q93A 2ZMEB 1P9QC 4LIUA 3L00A 1B72A 3QQAA 3Q1PA 3HYQA 2HGCA 3HSEA 2Y0SN 2M1BA 2RN7A 2DFHA 3A03A 1MNEA 1R23A 2WB1N 2CUJA 1OKRA 3OL4A 2LRDA 1X84A 4Y17A 3DEWA 2KDVA 4YRVA 4XL9A 3GBGA 4UUTA 4E4HA 3J7YJ 1R71A 4EMSA 2BOLA 4KIFA 4UNOA 4S2WA 3KP3A 2ECCA 2A68F 4IOCF 3CLQA 3CCUI 1OISA 1X2MA 3TBIA 3I3LA 3FK6A 3AL0B 4GGGA 2EV0A 4RA2A 2ZJ2A 4HQEA 3VODA 4HX4A 3W2WA 2Q1ZB 5E3LA 2ZJRF 4I98B 4A69C 1O4XA 1I1GA 1W5CC 3DLLF 4S2VA 3PFIA 3BROA 1MBKA 3MAJA 5DS9A 1UELB 1ZAOA 1USTA 3A6SA 3KYLA 1QNTA 3IUOA 4IRHA 1TWGJ 2K4BA 4BJ5C 2HZDA 3ONQA 4QIWN 1F36A 2VJIA 4IO9F 3DUPA 1RI7A 4FX4A 2DOEA 1W36C 1VCDA 1B9NA 1XGMA 2FRHA 4R1HA 3V7CA 4RGUA 5IY5H 1RETA 5CVRA 3GZNB 4KN7X 5F0CA 1VQOI 2FVVA 3KPHA 1X83A 3OY9A 3HOVJ 2DCEA 4OIQF 4D7NA 2H1LA 3K1MA 3K4JA 2XRNA 2B7EA 2O1CA 2BBYA 2JWTA 1ZRCA 4IOAF 2KZVA 2K9LA 2NNNA 4HV5A 3KYCB 4Y4RA 3PM1A 1XMAA 3FKJA 5KHDA 1LNWA 3DPTA 4D7MA 1ZREA 1YIOA 2L3DA 1FIAA 1TQIA 2D2WA 1P2FA 4DOZA 4A5NA 3IL2A 3I55I 3VYUB 5BPDA 2EFPA 2V1NA 3IH2A 3OR1C 3ZGKA 4K6EA 2MBFA 4E7IA 3KIOA 4C2MJ 1W36D 1J0RA 5DM6F 4EJOA 1KHZA 5J8FA 2BHZA 2Z5UA 4NFXA 5GAGJ 1MDMA 1IUYA 5C8LA 2MLGA 5EG0A 2AS5F 4IKFA 1BIBA 4DW6A 1MQEA 4RAZA 2P6TA 1OR7C 5KK1A 2CG4A 3LSPA 1IXCA 3CDIA 5LBQA 4KYWA 2EIKH 3CC4I 4EV0A 2KLOA 3S15J 4BBRJ 4BU2A 1V5FA 1Z21A 1MMSA 5K5OA 2BY1A 1IXSB 3FXKA 3A02A 1K78A 5TGTA 1IRFA 1UCRA 3G73A 1O57A 4EQQA 2DQLA 4CUGA 1MUTA 1TWFJ 1BA5A 2ICWG 2PX9A 2R7SA 2ZMEC 3X0PA 2MA3A 3ZR0A 4NDLA 3CCJI 5LHIA 1S5LC 4KFCA 1YS6A 1X4PA 4PGHA 2CUFA 1ETKA 5IP9J 3H5RA 3PUBA 3M8JA 4B1RA 3JTHA 4GO1A 3A0BC 2XB5A 4G94A 2QSHX 1MR2A 1WZ2A 1Y39A 4F7ZA 5LD2C 3WODF 4U0VA 3S3OA 5BONA 3FZVA 1R4NB 3DFGA 4HG2A 3OMYA 4XORA 1VNDA 2OF7A 3U9GA 2R7FA 2OUMA 2PLYA 2B63J 2WY7Q 3MQ0A 3CF5F 2MYSA 2L54A 3E3VA 3PIOF 3MZYA 3KEOA 4RAGA 4IHTA 1MQWA 1V8IA 1DP3A 1TP4A 2VC1A 1C0WA 2JVGA 2D45A 4LK1F 2KRHA 4BY7J 3GO5A 3GTJJ 4V2GA 3QP5A 4OMZA 3EDPA 1SD5A 1SZ3A 2KPMA 1USSA 2EZIA 2KFDA 1WH5A 3QAHA 3T1BA 3ZN0A 4CZZA 3V8LA 2VBYA 3QU3A 1GT0C 4LG0A 1TWAJ 4DYCA 3PQKA 2DFIA 4M3FA 5HLHA 5L3FA 1HF0A 4C3IJ 2R92J 4BE0A 4Y15A 1HDDC 1D1CA 1KYZA 4PFOA 3HC7A 5E3MA 4IHXA 3JSPA 4FCYA 2K3FA 4XQFA 2Q2EB 4EM0B 4LGWA 1VIUA 4HAMA 4MFEA 3RZOJ 5K7FA 2CYYA 4JBAA 5FKNA 2A6TA 2IW5A 3DKWA 5JLWA 3E7LA 1K6YA 2CW0F 3OV8A 1ZLJA 1KZHA 3L2RA 1AHDP 1ZLKA 1IDYA 3VPRA 2VT2A 4NQWA 2WWYA 2IAIA 4LG0B 4ENMA 1I6HJ 2E2JJ 3U1KA 5LGTA 2JSCA 4RB0A 1ZGAA 2KZGA 3HGYA 2DOAA 3ZQIA 2EBIA 3GFLA 2DBBA 2EIJH 3C3WA 1VF9A 5E3NA 1CF7A 5CVJA 3RDIA 3OGAA 4EJVA 4HDVA 1IJWC 1R67A 5J6XA 4IX7A 5C7TA 4HYEA 2O5WA 2DOFA 1REPC 3PQJA 4JX5A 4X1EA 4BHCA 1DUXC 2DT7B 1IV6A 3F8BA 4HV6A 2RDPA 4XM3A 1DGWY 3R60A 1QVTA 5CVVA 3CC7I 1OYWA 4ESFA 1AKHB 2W24A 5IT9Z 5FLVA 3FMSA 5CFJA 2HQRA 3CJQB 1UJ8A 3N77A 2K27A 3EF5A 1UHWA 1PP8F 2A3SA 1P4AA 2VKHA 3BQYA 1XG1A 2CQ7A 4A0ZA 3MKWB 2V9PA 1W0TA 2GM4A 3OYEA 1JUSA 5GAHJ 1ZQ3P 3B6AA 2EILH 3P9KA 2VT3A 1JT6A 1ORKA 3ZMUA 2L7KA 2PMZN 4B48A 1W7PB 1MGTA 1SANA 3C18A 1W7PA 3LSKA 5IP7J 4IVNA 1NH3A 3CCMI 2DU9A 3HL2A 1O7FA 4A12A 4XLPF 3F8NA 3KP6A 4EJTA 5CKTA 1XMXA 5E3OA 2IJLA 5FRMA 2H8RA 2XAGA 4AIDA 3CNGA 1UB9A 2GWRA 2D1HA 3K1PA 4PDKA 1KONA 2FD5A 3RPUA 3SQNA 2YVPA 5H20A 4HSRA 2WV1A 4PGGA 2CV1A 4AM3A 3GYHX 2O0YA 4XKCA 2QEXI 1VIQA 2A5WA 3QYBA 1Z1DA 3O8SA 4S05A 2EFWA 2F6CA 3OS0A 3A6TA 3I4MJ 2K9QA 1FWZA 4R79A 3CCQI 5D5WB 2E34A 3S93A 3CP8A 4II2A 1JKQC 1B59A 1W4MA 1MK1A 2ESNA 4A2UA 4DBQA 3J80K 5J1UA 2K7LA 3RPUD 1VRLA 3P6YA 3LSIA 3H9GA 5FFXA 1QGPA 1FEXA 2QLZA 1MMGA 4XR6A 4GYGA 2E1CA 4NC7A 4JK1X 3QPLA 2X6XA 1T0FC 5HNHA 3GG6A 3U53A 3ULQB 1A6IA 4AIHA 4LB5A 3X0JA 2IA2A 1NQZA 1U2WA 2XAJA 3GFMA 3RKXA 1UFMA 2E7XA 2RV8A 2W82A 3RZDJ 3SFZA 2H1KA 2FQ4A 2EIMH 1IAWA 4G8XA 2R7XA 3VYRB 3RQ4A 2HTSA 1YFHA 1Z05A 2X4HA 4HEA2 4XLCA 2A8QA 1X3ZB 3SFIA 1LPQA 3Q3SA 1ZELA 1MSFC 2CO5A 3E5QA 2G0EA 1O3SA 1XB4A 3J7AY 2VQCA 4G7HF 2MG4A 2MSYA 2VKVA 5FGMA 1R1UA 2MC4A 2A69F 1HKTA 1ZG5A 3AFHA 2VNPA 3ZN1A 2XF7A 4UXNA 3ZQLA 4LITA 1XGSA 3TW7A 3F8FA 4J7HA 2IGOA 1FY7A 5EGOA 2DDAA 3FXOA 3A0HC 3ZQGA 4OAYA 2I8DA 2L01A 3HRSA 3ERED 2XF5A 1SVOA 5EEGA 4IHVA 2RQPA 1EH7A 3BTJA 3U1DA 2X6WA 3CCYA 1T95A 3EUHA 3SDGA 1YX3A 3JRIA 5HVQC 2R5WA 3BOQA 3GFIA 2XRLA 3K7AJ 5IW5A 1A5JA 3BPVA 3G2BA 3E6CC 1PPXA 4MTEA 3S16J 3BG6A 3FHZA 1JJ6C 2PQ8A 2OC6A 2NVXJ 1KA8A 1EH8A 2P4WA 3T8RA 2YU3A 2JT1A 5HODA 1NK3P 2YUSA 3L2WA 1CF7B 1JTXA 5HLGA 2I8UA 2DODA 1R9TJ 1ETQA 3TP3A 3I58A 3WGIA 2VODA 4HNTA 2CU7A 1A35A 3FXMA 2QM3A 4UVCA 5DUKA 3GTQJ 1YYVA 1ETXA 5J47A 2XGDA 2KIUA 3CP2A 3DF8A 4IHSA 4UB6C 4MGRA 2ZXHA 3CTAA 1G6NA 1KQ0A 4ZZLA 1AA7A 2KIFA 2M3AA 1MJBA 1VHGA 2XAUA 1F4KA 2DI3A 2PI0A 1BR4A 2P0WA 3GLLA 1H89C 2XC7A 5F1JA 4U0WA 2OV7A 4LD5A 3SJMA 5LEKA 3IC7A 4Q5SF 1IRXA 3LA3A 2R5YB 3WG7H 4FQGA 3ZOBA 1RESA 1ZYRF 4HPQA 3HXLA 1WGXA 3MMYB 3OS1A 5AIQA 4I0BA 4KT5C 4AVPA 4V19K 4V14A 5FO5A 4UUVA 3WTVC 1GA7A 2PNYA 2QQBA 2P8TA 3QYFA 3R6SA 4MFDA 4ENNA 5FKMA 2WB1A 1PUQA 3CMMA 5DYMA 5LGNA 2H09A 4IQ4A 1ERDA 5KAFC 4HRIA 4DYWA 3R0AA 1K4SA 1R22A 4NQWB 2HEOA 2Y9YA 2A6EF 4AWXB 1IRZA 5FRNA 2J8QA 1HDPA 4Q48A 3PNYA 4M3GA 3QWLA 5E8GA 3ELKA 5ISYA 2PMZA 1YO5C 2OJED 1HKSA 2E1OA 3HPHA 4RGXA 2LFBA 2NS7A 2ELJA 2VJ5A 2OQGA 2O7OA 3QODA 1W7PD 1S9HA 1FNNA 1BOAA 3HSFA 4ZYHA 3LOCA 1N78A 1V4RA 4JZUA 2L02A 1A36A 2W7NA 2FSWA 4L9JA 4LOCA 3HOZJ 3RIRA 1E0EA 3RCOA 4M72A 2LKPA 3RYPA 3BZKA 4F55A 4XRFA 2ICJA 4BNCA 4MQ9F 2DHOA 4KISA 1GHCA 3X0NA 1E3PA 2CH0A 2L2OA 4XLAA 1JRKA 5ANUA 5GTIC 2XUBA 3MKYB 3AG1H 3S1RJ 4V2FA 4HA8A 2OQRA 2HVQA 1ITYA 1TT0A 3TOBA 5ANSA 1XX5A 2COMA 5CQEA 4FETA 4DYQA 2IPQX 2YR2A 4ABZA 4EGZA 4BDYA 1VC8A 5HS8A 1KU7A 2DJIA 1W0UA 1X4OA 3SZPA 1HA8A 1MP2A 5JHFA 2CFOA 2UUZA 1KTGA 3DBLB 2M8EA 3OS2A 2K9NA 1NTCA 5FD6A 2RREA 3ECHA 4E7ZA 3VSKA 3ABKH 1P6RA 1FT9A 3K2AA 3CZ6A 2L4AA 3HB9A 4KYXA 1D1AA 1D3YA 1OCZH 1V5EA 4A6DA 1AOYA 3A01A 2TCTA 5GADJ 3AG2H 5B1AH 2Y9ZA 4CXFA 5FLXZ 3OYGA 4QSHA 5J8CA 3E6BA 5IOZA 1IG7A 4U7BA 2JUGA 4JQFA 4XN0A 3P9CA 1OJLA 2IGMA 1GV2A 1QZZA 4F91B 1XSVA 2R0QC 3N9UA 2YPRA 3LSJA 3QOPA 1MKMA 1T2KA 4N0BA 3JRCA 3AAFA 1T8IA 2FUG2 2ME0A 4WXCA 2QYOA 4BH9A 3ABLH 4C2TA 3H92A 1JKRC 1ONVA 5CFIA 3X0KA 5KNLA 2QCOA 3M3YJ 2JA7J 3RI4A 2EB7A 3WTYC 5DPKA 5AONA 5FSIA 1R6RA 3BG9A 3JRGA 1IRYA 4YIFA 2IS6A 4GYIA 2ISYA 3L2CA 2HQ5A 3X0LA 1Z77A 2UXXA 4GCVA 2P5LC 4JP0A 1MSEC 1GXPA 1R36A 3L1PA 2ADUA 2JQ7A 2XSQA 4A3DJ 5E17F 4IPAA 3EUAA 2RNGA 2DDBA 3DLAA 5JVTA 4N4NB 4BAYA 2VL8A 2V9KA 2WA0A 1WJAA 2M87A 2MGQA 1R4MB 3I71A 1YTYA 2KRFA 1TW3A 2V9VA 1A31A 2EZHA 2VNQA 1G3YA 4JYKA 1D5YA 1R7JA 3LWFA 2M7BA 1YW9A 2X1CA 3BCBA 3CCRI 2XIGA 4L5IA 4D9JA 2CGPA 4BE2A 1K7AA 1Y8QB 2BY0A 3H3UA 2PEXA 2LVSA 2CJJA 4WWCA 4A93J 4DZJA 3LNQA 3REOA 1F43A 4YOQA 3X0SA 5TJJA 3S3NA 4G6TB 3K69A 4LJZF 4IRIA 4OAZA 1LFBA 1G3WA 5J3LA 3JRBA 3DU6A 4DZPA 2A8PA 2IXSA 3SDBA 1VC9A 1V54H 1HZTA 2MFZA 4BQQA 1Q54A 1MJAA 1R5HA 1UZCA 2F5DA 3PNTA 2CQKA 2CQQA 2R93J 1YJ9I 1E17A 1FMVA 3FBIB 1M1EB 4MHGA 4ZJZA 4C9XA 2ZFUA 3SHDA 1PYVA 4MQVA 2BVMA 1SFKA 4U7DA 2LTPA 4G6QA 2GIVA 4NNJA 3K0LA 5L3DA 1EF4A 4OINF 2E1MB 3HUGB 1NFSA 4IF4A 2YVMA 3FM5A 3X0MA 3NEUA 5EYRA 1VQLI 3MGMA 3BJAA 1RRJA 1G3TA 2LLKA 3BAPA 1ETYA 4W1UA 2JUCA 1FZPB 3LSGA 1FYKA 1WJ5A 3K70D 1SOIA 1XDSA 2KJBA 2LK2A 3DEUA 1T39A 5E8IA 3ZQHA 1QBJA 5J1RA 4BE1A 2P81A 3HBLA 3VOEA 1PUFA 3G1LA 3DKUA 4J19A 2ZCWA 3D0SA 1YQAA 4H4KC 4O5VA 5FD5A 5GP9A 2OCEA 4BEHB 3CMAI 3PIPF 5EEAA 3ECOA 3IWFA 2GA1A 4RLFA 2NOGA 3LQRA 2I5UA 1RUOA 4Y7NJ 1YJNI 5EZHA 2QJOA 3I7UA 4YFXF 2HU9A 5FSLA 2XGCA 2PG4A 1A04A 2R7VA 4E7SA 3L2UA 3B73A 1V8WA 1V8MA 4LIVA 2VJJA 2OPTA 2ID6A 4F3QA 1TQPA 4N9IA 2BEOA 2Y69H 2JTVA 2HKXA 4LLGF 2XPUA 5ANTA 4D1QA 2LBFB 3H0DA 3HDDA 1K78B 4B3XA 3BM4A 4YPHA 5LRRA 3KE2A 1PUSA 4UUSB 5AIPA 1FLIA 2DTZA 3T8TA 4FISA 1G2HA 1FP2A 3WU2C 2O61A 3S1QJ 2OTLI 3P7NA 3IKTA 2YU9J 1SFUA 1HX3A 4BXUA 3LA2A 4P5OA 1K79A 2O3FA 4RMNA 5IPAA 4XRSA 2VASA 1MH4A 1RPWA 3M9AA 3WGGA 2UZKA 2ICKA 4A6EA 4MIMA 4EJWA 3JW4A 3F3XA 4HLXA 4S2YA 4NBQA 4B3AA 1MJ9A 1MNDA 1QHGA 3MCFA 4IHWA 3WTXC 3NWSA 3S32A 4J7GA 2GOMA 1MW7A 4A3MJ 4L5EA 1BL0A 1Z67A 4FHTA 4YIRX 1VQ5I 3PO2J 3OYDA 3M4OJ 2DUKA 4CDGA 3H9QA 3IAS2 3PO3J 3QPHA 5LHGA 3BR2A 3BR6A 1MBHA 1SMTA 2NAZA 5F6FA 3L2VA 4CCJA 2LD5A 2PQVA 4N1TA 3VDXA 3A01B 2KJCA 3QPTA 2JJ7A 2TRTA 4M6XA 3GTLJ 3HSRA 4X0GA 5C4JJ 5D8LB 4EVIA 1SD4A 4A3KJ 2HPIA 1ACIA 3MZ8A 2XSJC 1LKXA 4ASNA 2GXBA 1J9IA 1WRJA 2CUZA 2DA5A 3LAJA 3G6EI 3FXRA 2ZNZA 1SD6A 4CCLA 5FKLA 1B8IA 3HTUA 4KIBA 4I02A 4ILQA 4IRGA 3I5UA 1VTNC 1B8IB 3T5XA 2CSOA 1ZARA 3RKYA 4CZCA 5ICCA 1Q1HA 1GDTA 1S29A 3CJNA 2LYCA 4KT6A 5ED4A 3WTSC 2P5KA 5JI6A 2DT6A 3F23A 3GW2A 1FJLA 4RDUA 1U0JA 1P7IA 5A2QZ 2FA5A 5GHMA 2LH9A 5CJ9A 3HOTA 3H0GJ 5IYCJ 3X2QH 1DDNA 4BXXJ 3HUGA 2CWEA 3D1NI 3G4SI 3GXOA 5IYDJ 5FLXK 3S17J 1RNLA 1BJAA 4OIRF 3P5TA 2V1UA 4OIOF 1FIPA 4UVBA 1SJYA 1DP7P 2FF4A 2AHQA 3WTWC 3GLXA 2EV5A 2X48A 2FNAA 3DPLC 3M8FA 2HOAA 1OMIA 1WHUA 2G7HA 4ZYAA 3FXJA 1TNTA 1MBGA 4S0HB 1X3UA 3JRFA 2K9MA 2GIZA 2R7WA 4M9SA 3GTMJ 3EUKL 4CYDA 2NVUB 4PJNA 2DFEA 3RKQA 3CDHA 1G8XA 1O3RA 4I09A 2JZYA 2OD5A 3MN2A 2JMWA 3KCCA 4CSWA 1WI3A 3LMMA 1JTYA 1XMKA 3M7GA 5DUIA 3FJYA 4HLYA 2ELHA 2HPMA 1FOYA 5HDNA 3KLNA 1FPQA 2DQRA 1BR1A 4DBRA 1U3EM 3LSMA 2Y75A 1VI0A 2ESHA 1XPXA 2JA8J 4XONA 3ZPLA 5ERIA 2PMHA 3I64A 2IVMA 3GMEA 4L5JA 1F1ZA 2OBPA 1K26A 2DSBA 3EEUA 2VQGA 2XVCA 2K5CA 1APLC 1VQ6I 3J7Ye 1V8UA 4LFUA 2V4JC 4HW0A 2M0MA 4ZC3A 1FOWA 3WHWA 2LY9A 2MD0A 3ESWB 2ECBA 2W00A 2FQ3A 2E7WA 2XPWA 5EF6A 5H2FC 1LVKA 5GAEJ 1XD7A 2A5YB 1QU3A 1LFPA 4A3LJ 1V8YA 2X6OA 3OIQA 1J75A 2XPVA 3T0YA 1X58A 3HOSA 4E7HA 2F5FA 3HJEA 2FE3A 3I9XA 3B02A 2M30A 4U87A 5LHHA 1FSHA 3IKVA 3OOUA 3GUDA 1CQTA 2VLAA 2HYGD 4IEJA 1TZLA 3KLOA 2H27A 1FBUA 3CQZJ 2Y0SA 3FMRA 3Q9SA 1LFUP 3P9IA 4F92B 1KQ8A 2OAZA 3ID9A 3S14J 3M1CA 3WE3A 4AC0A 1DU6A 2L0KA 5FKOA 2QQ9A 1YRNA 2K4JA 1MIJA 5K5QA 1KT9A 1HLVA 3QYEA 2OZUA 5GHOA 3F8MA 4C3JJ 4HBLA 4A0YA 1WJDA 2DN0A 3WTTC 1Y0UA 1EJ9A 2PN6A 4I99C 2LF7A 4B47A 4HNVA 2VE8A 3ZMSA 3C2HA 1I1SA 1TWHJ 4XNFA 2ZC2A 5C44J 3DQVC 3W6KB 4W97A 2LG4A 2QBYB 2MC3A 2I8TA 2CQXA 3RTRA 1IV8A 5FSOA 1IZ1A 1IGNA 3E5XA 3PSIA 2VJ4A 2G9WA 4AYBA 2VBZA 2HZTA 3PFYA 4BXFA 5EZGA 3JCUC 4WX9A 2RGVA 2B9SA 3HRMA 4I6ZA 3KFWX 5DD4A 5DCMB 2PMUA 1F9NA 2XGEA 1MMAA 1R1VA 4HX7A 4E70A 3BTCA 2Z33A 1VQ8I 2PBIA 3TO6A 4BBSJ 2QF7A 4XK4A 4ANJA 4KTBA 1Y0NA 4XICA 5LPGA 2GB5A 4YPRA 2R7UA 4C9WA 1RRQA 2EINH 3DPUA 4KICA 4N4OB 1YS7A 5M3FJ 3N05A 3RPQA 2LC2A 3W2VA 5JR3A 4PJJA 3OYAA 3CJRB 4HFQA 1XSCA 4GXOA 1ZH5A 5HLIA 4CHUA 2E35A 2HTJA 4Z2YA 3A4CA 2FU4A 5KVRA 5BPIA 1QZEA 2ZXIA 5EEHA 4ZDLA 1SEUA 1WQ2A 3GEZA 2Y0MA 4PSXA 2KISA 2BXYA 3QRFF 1P4WA 3E0JB 5JHUA 2YYHA 4O6JA 3A6UA 2ID3A 4OOIA 3FXLA 1FTZA 2DMNA 4PK4A 1T33A 1BN5A 1IUFA 3DEEA 1QA6A 4QPQA 4BQNA 2JPCA 2M4KA 1UMQA 2AXTC 1S3JA 2X1DA 4B8XA 5E1WA 4F52A 4RB3C 4PCQA 2F2EA 1ZRDA 2WAQN 2HYFA 1ON2A 2WTEA 2ME6A 1QVUA 2DJNA 1NHAA 5E79C 2YX7A 4A3GJ 4A5MA 1QVJA 3IRQA 5TRDA 3ABUA 3BPXA 2AXLA 3VFZA 4DGWB 2DPDA 3F6OA 2VXZA 3MEXA 4PJ0C 2F5EA 3BG7A 4YELA 1IN8A 3CMYA 1DGRM 1N75A 1KGSA 4ZYEA 4AUXA 1K4TA 3JRAA 1EH6A 3FXQA 4UV9A 4WK8F 1WI9A 5D4SA 2Q0OA 1R5GA 3ZR1A 3H95A 2DA3A 5LGUA 3HOXJ 2WADA 2PJRB 3WU1B 4BDZA 4EM2A 3RSNA 1EA3A 2M34A 2A6HF 1RYAA 1D0YA 2FBHA 1O3TA 3V7SA 1ETVA 1SMYF 3G0QA 2HNHA 5C7QA 3BR1A 3A6VA 1V55H 1TWCJ 3TP0A 1RR8C 4ZG0A 1L0OC 1ODDA 3KP5A 1OCOH 4M74A 2BY2A 2MLKA 4NUBA 2KP6A 2E1MC 2V1XA 3FK9A 1VQ4I 4QTRA 3TO7A 2DA2A 4G12A 5H6QA 1MMNA 3V8JA 3BDDA 1ENHA 3J81Z 2W4EA 4M9XA 4BGDA 2UV1A 3MDIA 2A8SA 4N9HA 4XSZF 2O6GE 3S2DJ 2EZKA 2UXNA 2F4MB 1XC5A 3GX4X 3WHCA 1V3FA 2EQRA 2E1NA 3HHJA 2R3SA 1KU2A 3Q0VA 4J00A 3R4KA 2LMDA 5E1ZB 1ZHFA 1OQYA 2R5ZA 1J5YA 2LOOA 2K85A 1MDMB 3H3VK 3CUQB 2DK5A 4HDUA 4P9FA 1Z6TA 1FX7A 4LK0F 3MVPA 2R5YA 4AIJA 3C7JA 3E1SA 4HX8A 2JRTA 5L3BA 2JRMA 2W57A 4G7ZF 5BQTA 1G0SA 4EJUA 1SAXA 2FMLA 4P1WA 3ZP5A 4MTDA 5DDGA 4KMFA 3BC8A 2V6CA 3AG4H 4CGZA 3TGNA 4RS8A 1S6LA 4QLCU 1X51A 3VYTB 4XRSG 2COBA 2ZB9A 1VQKI 1O7LA 3M07A 1U5TB 1ZTRA 3HEFA 3K2ZA 1VFCA 3FXUA 2DA6A 2BV6A 4NHJA 3HGGA 2E19A 1STZA 2NS0A 2RKHA 1IDZA 4E7JA 1IN5A 2E36A 1X1PA 3E6DA 3X0IA 4A3BJ 3F22A 4FT8A 3GTOJ 3I56I 3ASOH 3H36A 5J4VA 3ZMTA 1V8RA 1VQPI 2K86A 1WJBA 3WGHA 5J1YA 3J80Z 3UNGC 4BS9A 4S04A 3QPSA 2DYSH 2WBMA 2GT2A 2XSDC 1FP1D 4AIKA 4A3JJ 4AD9A 1IW7F 1FBSA 1GXQA 4KN4X 4L0ZB 2VN2A 4ENJA 4CYCA 3MFKA 4DJAA 1I27A 3JAMK 5DEQA 4A0XA 2X51A 3N4MA 1JXSA 2QGUA 3FISA 3OYKA 3BY6A 4XBFA 3H9JA 2CV2A 4C9YA 3W3CA 2LF8A 4L9VA 4Y52J 3LSHA 5JVGF 3C2GA 2DMUA 2LDUA 2IRFG 1G3SA 3L7WA 2P5VA 4X6AJ 3A2KA 2WY8Q 5B5EC 4YG2F 4P9UA 1UG0A 2K02A 5K7HA 2E5ZA 1MBJA 1Z3XA 2CL3A 1X1CA 4IJXA 2BGCA 2VBXA 2Q8KA 5F0HA 5D6EA 2DSDA 2DMTA 2VQHA 1B6AA 5FB2A 4C3HJ 2GQQA 3F8CA 5DTDA 3ZQQA 4KMUX 1R1TA 2BZTA 3BR3A 3EQLF 3M8EA 3AKZA 3Q9VA 1ZR2A 2O8XA 2E2HJ 4YFNF 3G3ZA 1FC3A 1HOMA 3DKYA 5FKKA 2AO9A 3JRDA 4HSTA 3V42A 2X9DA 3MDGA 2AZWA 2GA2A 1JHHA 1JI8A 4WXDA 3KEQA 4P55A 2VKDA 2R7QA 1ZRFA 3HOUJ 2Z99A 2Q2EA 1XSBA 4JZVA 1UHMA 4BACA 4RM2A 3CF2A 1P92A 2W4SA 2Y31A 5M3MJ 2ZJPF 1B4AA 1PVEA 1YE9A 5FLMJ 2OTJI 1BC8C 3BZCA 1JGSA 1SAUA 4P96A 3CJTB 3H5AA 2D1VA 3Q2TA 1PUFB 2L7FP 3PL8A 1IXRC 3SMDA 1XSAA 2PJPA 1OCRH 1RIOH 3MKLA 1WH7A 4C30A 2A61A 2LKXA 2WAQA 4G7OF 2J5OA 2MD5A 3K4KA 3KZZA 2RNJA 5C4XJ 3OYFA 3EESA 3FKIJ 3FK7A 3IH4A 3H5NA 1MBEA 1LDJA 2F4OB 1Z7UA 4RAYA 2NVTJ 3K6GA 2NRAC 1AKHA 3OR2C 1UAAA 3UKGA 1GLNA 3NAUA 1D0ZA 3K4BA 1YITI 2A07F 1TLHB 2GXAA 1GUUA 1YG2A 2GXGA 4KDPA 2FMYA 1V8SA 5I8UA 2TDXA 1EKEA 3VEPA 2KRCA 1ZGJA 1QRYA 2QUFA 1FYMA 1DPUA 2VONA 3FIWA 4XOTA 2BY3A 2O9LA 3L85A 4ETSA 3OOPA 2QZ8A 3O52A 5ICGA 5JLXA 4BY1J 2F5CA 2IT0A 3CC2I 5BS6A 4PUSA 2B0VA 1HBXG 2X0LA 2FOKA 5ILVA 4XLEA 3FMQA 3E5UA 3HOWJ 4CCNA 1HKQA 2IEKA 3AG3H 4LMYA 4RB1A 3ACAA 1VK6A 2K9SA 5D5VB 4L9TA 2LSOA 2EV6A 1LE8A 2NVQJ 1HCRA 1V8TA 2JVBA 3OYIA 4FE7A 4M3DA 1I3AA 2EFQA 3CCEI 1ETOA 2KDOA 3S1MJ 3FDYA 3GZ8A 3BG3A 1H8AC 3K4MA 1WVRA 1XSDA 1U9OA 3HM5A 1BI1A 2IGNA 2X6YA 2B2KA 3I4NJ 5J40A 1OCTC 1ZGWA 2H6CA 4HQMA 4JZSA 3ZQCA 4HOBA 3OSGA 1SVMA 4M6VA 2BXZA 4PJLA 1NG7A 3CUQC 3OYMA 2F48A 3BT9A 4PJMA 1TW2A 5ICEA 2JA6J 5LLQA 3F6VA 5BMZA 1MBFA 3RYRA 4QPOA 1IF1A 1ON1A 2L9NA 5L3GA 4Y13A 1U8BA 2MABA 1LDDA 4TV7A 5IOYA 4HNUA 1MMDA 2GAUA 4LG3A 4ZTFA 1LUJB 5M5XJ 1IN4A 5CPRB 1DU0A 2HDWA 4I76A 4M3BA 2CW8A 2QQAA 3S2HJ 1HSTA 4PZJA 4ZH4F 3QOEA 4GFBA 3DCFA 5F1RA 2XDVA 2LKSA 1OLTA 1HW1A 1YOVB 3K10A 2STTA 2H94A 2KT0A 1H88C 5K1YA 2DMQA 2H6BA 3DV8A 4KNYA 1K6OA 1IO2A 4ENKA 4S2XA 2PFBA 2XAFA 3PJRA 3HKZN 1IC8A 1D1BA 1FOKA 3QP6A 2DA1A 4IJAA 2XHKA 3TDUC 1K83J 2KDZA 1NG6A 1UHSA 3NWTA 5B1BH 1U5TA 1BJZA 2NOJB 2W84A 3Q0WA 1W5TA 1P7JA 1LB2A 1G59A 1H9TA 2NS8A 3HRTA 2JPBA 5B3SH 1LEAA 2CW7A 2VE9A 2V6EA 2QJTA 3VWBA 3RJPA 4RM3A 2F5VA 2XASA 4HF2A 3ZMDA 3DBRB 1LDKB 3FWEA 1EV7A 5EDNA 1K2EA 2A8TA 2LR8A 2MW8A 2HDDA 3B6CA 1Q27A 5CYVA 5LFAA 2MH9A 3O3KA 3FX3A 4CH7A 3SEQA 4A3FJ 3HG9A 4PFPA 1JKNA 1POGA 1XN7A 3TQNA 3ZRGA 1ULYA 2BE5F 2M5WA 3PSFA 2VI6A 3VB2A 4GRIA 2VOOA 3LA7A 4NC6A 5FSMA 3VSLA 1RR7A 2ZKZA 5JFRA 3CCSI 1TUMA 2ZXJA 4L0YB 2A8RA 1KU9A 3SEZA 2LP0A 2ISZA 2VUMJ 3F13A 1Y1VJ 5FFZA 4EM1A 4XSXF 2HYJA 3FHNA 1T38A 2HQNA 1FTTA 1JGGA 2I6KA 3Q2SA 5B66C 2XB0X 1PP7U 2FJ1A 4OU0A 4F93B 4XRMA 2R5ZB 2VPLA 2L9VA 4FE4A 2DYRH 1QPIA 4IQJA 2R7RA 5CLSA 3OYNA 1VQ9I 4MEYF 1TL8A 3BP8A 4M3EA 1X1AA 4ICKA 2JSPA 1PJRA 3I9V2 4ESJA 3HHGA 4CA0A 2R7DA 3DXJF 1H9GA 1Y6IA 1S8NA 3D5RC 3IAM2 2XAHA 2IS4A 4RLQA 2DLLA 2Q9PA 3BJ6A 4NC8A 2CS3A 4WCGA 3HKZA 3I0TA 5HOOA 4G6DA 3GFJA 4YEJA 1ZN2A 4ON0A 2XF6A 1YW8A 2KIQA 3LSRA 5DM7F 3CMEI 3O6ZA 3F9KA 3HYIA 1GV5A 2VIXA 2CQNA 2W1OA 2IP2A 4PSWA 5K5RA 3JREA 1Z6RA 1TC3C 1WFXA 2RVCA 1BI0A 4XKBA 4DYRA 4EGYA 1BI3A 3OL3A 5IT3A 3V7RA 2FNPA 2HOEA 1WKMA 3BJOA 1BR2A 1E3HA 4QWQA 2F4IA 4IHYA 2HI3A 1TNSA 2AQFA 3N97A 1BW6A 2E60A 1V8NA 4RGRA 2DPUA 2BHYA 5IW4A 2QQ8A 2L5QA 3DU5A 5ILSA 4KITB 2FX0A 4YIIA 2QKMB 2HQAA 4CICA 2GLOA 3WTZA 3R03A 2EH3A 5GHPA 3I4PA 3S3MA 2MH2A 4BL0B 5HS9A 3ABMH 2HOSA 1MD0A 4O3MA 2YSRA 2X85A 1MH3A 3GF2A 1PUNA 1JE8A 4RGSA 3S8PA 5FJ8J 1LE8B 1HSJA 5D8KB 4Y3OA 2NYXA 3Q91A 2G74A 1LVAA 5M5WJ 2H8WA 3DP7A 2V1DA 5HDGA 5GTHC 3FSPA 2QWWA 1JUPA 1JT0A 4KG3A 2P7CB 4K2EA 3V4GA 2NVYJ 5EJCA 2DAOA 3G71I 3SZTA 1Z7LA 1OFCX 2L7MP 2QSGX 3GWZA 2PJRA 3F6AA 4G9YA 1A6QA 4CCMA 2CFXA 2OZ6A 3TL4X 1R49A 1I9AA 1WWXA 1WJFA 3CDLA 2B0LA 3IRRA 3O69A 1IN7A 3LL7A 3COAC 3JR9A 3TOAA 1TTYA 3QSJA 4BUPA 5F0FA 1JUMA 2EFNA 3ASNH 4A3IJ 3KETA 1PPVA 2VKEA 4KUMA 3DTKA 3IV5A 1R00A 1P4XA 5D4RA 5KCMA 1U6GA 1RUNA 1BM9A 4ITVA 4Z6YA 2Z3YA 3ZR8X 5GPAA 1QQIA 2JA5J 3JSOA 4FASD 2VOPA 3SHFA 5L3EA 3DKXA 1MNMC 1FMWA 3LFKA 3HTSB 5E20A 1SVLA 3F72A 2EZLA 1NFZA 4ZDPA 2JK3A 2IBDA 1YRNB 3COUA 3FBNB 5F04A 3J7AO 2BVLA 2M45A 2R7TA 1PPWA 3K9TA 3L2QA 1QO0D 5DD8A 3O61A 1SD7A 3G1MA 3M1EA 1X1DA 2V7FA 4HZFA 1YJWI 2HFHA 3HPGA 4BYYA 3MZHA 5GHNA 2HS5A 1HXDA 1BW5A 4MPOA 2L4MA 4CO8A 1RKWA 1U20A 1Z9CA 4MO7A 2QBYA 2KL4A 1GVJA 3OIOA 4XN3A 2HXIA 3CD6I 3WG9A 2I10A 3K1NA 3KP2A 3CCVI 1W5SA 2GBYA 4XOPA 3GZ6A 2HVRA 3MD2A 2OCCH 5GHQA 3HHHA 2N8GA 3E57A 3I7VA 3BTLA 4I01A 4MLOA 4DNCA 2K3PA 1FSEA 1OCCH 4I2OA 4KA4A 3U2RA 2W48A 3CO7C 5H6RA 1Y56A 3Q0UA 1ZG3A 1YX5A 4LLLA 1RC9A 3K4LA 2ZNYA 3GCMA 4B4CA 5CQGA 3C2BA 2KMUA 1VQNI 5ANVA 3V8KA 3EUHC 4L9NA 5C3EJ 1SC7A 3IH3A 2ZMEA 2YVOA 1GVDA 2BW3A 2Z2SB 2Z1DA 4BEHA 4D5FA 1I3QJ 1YLFA 3ZXSA 3KP4A 2VPRA 1VQMI 2DSCA 2BW3B 2KHMA 3LFUA 2L7ZA 1XS9A 3OYBA 2FKBA 4U0YA 5DV5A 5L3CA 1G9QA 5GHJA 4D5CA 2ZO4A 3I54A 1LQ1A 5IT9K 4DIQA 2ZSIB 1QZYA 4XKWA 1X2NA 1D8JA 1WJCA 3MWMA 4JX6A 3OYJA 2IS1A 1VHZA 2DA4A 4XLFA 3OSFA 2E71A 1KU3A 3BR0A 3H35A 2IS2A 3GVAA 3OYHA 2W25A 4H0EA 4UY8I 2LNBA 2XKPA 5F08A 3K4CA 5EGOB 2ELKA 1OR7A 1TT5B 3Q5FA 2FEZA 5F64A 5LEJA 1SFXA 4UUSA 1R5ID 5GPCA 3OYCA 3ML6A 3SONA 1DQUA 1T98A 2R7OA 4R8HA 2E2IJ 3TDZC 2XROA 2Y48A 1UG2A 1YHQI 2WV0A 2NNYA 4MNUA 2HVSA 2RQQA 4ESBA 1JJ8C 5HDKA 1YI2I 3A1YA 1S7EA 2KQRA 2CV0A 3GRNA 3BZ6A 1R58A 3JRHA 2P7VB 2ACJA 4ZDOA 3KZYA 9ANTA 1L3LA 4JOMA 3OIPA 1OCPA 3SZGA 1I6XA 3FF5A 4B09A 2Z16A 1HQCA 1N77A 1MZBA 5ANWA 3R0JA 1BI2A 3NRVA 4YFKF 3ROUA 1JKPC 1S7OA 2L9SA 2L9RA 4B44A 2R7ZJ 4D0PA 4C2UA 3CO6C 3BTIA 1E3OC 3IHUA 4IL6C 3GTGJ 2HXOA 3KYDB 3ZCOA 2G7UA 2CZRA 1RKTA 3GTPJ 2RAEA 4BJ6C 2Y2ZA 1BOBA 3ERMA 1Q33A 1X3WB 1W1WE 3K4NA 4A3EJ 2DMPA 2JN6A 1J09A 5D5UB 1U78A 2WC2A 1T0FA 2AQEA 2GOXB 2RC4A 3KZIC 3R61A 1J59A 1U8RA 4KIGA 3WE2A 3EXQA 1PUEE 1N25A 4ZYDA 3ZQFA 5J4YA 3HOYJ 2IA1A 3MCZA 3I59B 3LSTA 2YX4A 1XSXA 4IZZA 4RB2C 2VQLA 2HWVA 2DTRA 3TEDA 4LLNA 1QPMA 3DTIA 1KQ9A 3LQQA 4CYCB 3GWYA 4UHTA 2HR3A 1RRSA 3UR3C 2NXNB 3RKWA 1LJ9A 4LB6B 3TO9A 4BHBA 4BJTA 2VBWA 1VQ7I 4L18B 1T56A 3O2PE 3CESA 2IA0A
chains in the Genus database with same CATH topology
5FRMA 2HPIA 2WAFA 2XSJC 1LKXA 2CUZA 3CNGA 2WAEA 1V8SA 5I8UA 1D0XA 1KONA 4XLHA 4CCLA 2KRCA 2G73A 2YVPA 4HSRA 2B06A 2CV1A 4HVYA 1V8VA 4XKCA 4ILQA 5FSNA 1VIQA 4XOTA 2A5WA 3QYBA 3L85A 3O8SA 4CZCA 2F6CA 4KJZA 3OS0A 2RRKA 3A6TA 3O52A 4R79A 2LYCA 4KT6A 5BS6A 3S93A 4PUSA 3CP8A 2DT6A 4II2A 3AL0C 2B0VA 4N1UA 4Y33A 3K70C 1MK1A 1U0JA 4XLEA 4DBQA 1VRLA 3RPUD 2KDWA 3P6YA 4CCNA 5GHMA 3LSIA 2LH9A 3H9GA 3HOTA 1MMGA 3ACAA 4XR6A 1VK6A 3D5LA 2JA2A 4NC7A 3FFUA 2X6XA 1T0FC 4BQOA 5HNHA 3GG6A 3U53A 2LREA 1V8TA 3X0JA 1NQZA 5HLTA 3OYIA 2JVBA 3P5TA 2W82A 3PNVA 2KDOA 2DXIA 1SJYA 3FDYA 3GZ8A 1F3YA 4E7LA 2R7XA 3K4MA 3VYRB 3RQ4A 3FCMA 4XLCA 2IGNA 2ZSHB 3DPLC 2X6YA 4HEA2 4OWRB 2A8QA 2B2KA 2O5FA 3GZ5A 4ZYAA 4XMYA 1ZELA 4JZSA 4NFWA 2K9MA 3X0QA 2R7WA 3J7AY 3EUKL 2M7AA 4PJLA 1NG7A 2VQCA 4PJNA 3TMOA 3OYMA 4CCKA 3AC9A 4PJMA 1G8XA 2MC4A 4J01A 3AFHA 2VNPA 4CSWA 3LMMA 4QPOA 2L9NA 1QHHD 2XF7A 3DTEA 4E6KG 3FJYA 4LITA 4EATA 2MABA 5HZXA 4HNUA 3MKZA 1MMDA 2HPMA 4LG3A 4ZTFA 3X0RA 5CPRB 4J7HA 2HDWA 2CW8A 2IGOA 1BR1A 4DBRA 3LSMA 1SU2A 3QOEA 2VXDA 3W2AA 1PVFA 4XONA 4OAYA 3VYSB 2I8DA 2XDVA 3BCAA 1OLTA 1Z3YA 4ZTJA 3K10A 2XF5A 4AU7A 2LY2A 1K26A 2DSBA 2X6WA 3BLYA 3EEUA 2VQGA 2K5CA 3J7Ye 1T95A 3OYLA 1V8UA 1YX3A 4S2XA 5HVQC 2V4JC 4ZC3A 2M0MA 3PJRA 3WHWA 1D1BA 2MD0A 2R5WA 4E7KA 2X1EA 2M4GA 2W00A 1NG6A 3NWTA 2UWMA 2NOJB 4XKVA 1LVKA 5IW5A 3G2BA 2QKLB 1PPXA 3Q4IA 3BG6A 1QU3A 1LFPA 1G59A 1V8YA 3DWLE 3OIQA 2OC6A 2CW7A 3HOSA 4E7HA 2V6EA 2QJTA 3VWBA 4II3A 4U87A 3I9XA 4RM3A 2F5VA 3OOUA 3SYTA 3L2WA 2E5NA 2VLAA 1LDKB 2I8UA 2A8TA 1K2EA 1X19A 1TZLA 2CMPA 1Q27A 5CKTA 4HNTA 2LY1A 5LFAA 2Y0SA 4CH7A 4F92B 3SEQA 3BHOA 3CP2A 3HG9A 4PFPA 1JKNA 2GT4A 3ID9A 3M1CA 3ZRGA 5FROA 2ZXHA 1AA7A 2M3AA 3PSFA 4GRIA 1KT9A 1VHGA 2XAUA 3QYEA 5FSMA 1BR4A 2P0WA 3VSLA 4CCOA 5GHOA 2XC7A 2OV7A 2V26A 4KG4A 1TUMA 2A8RA 1WJDA 1IRXA 3SEZA 4B47A 2IGKA 1V8LA 3C2HA 4XNFA 3F13A 1V5GA 4HPQA 3HXLA 3DQVC 3MMYB 3OS1A 2LG4A 3FHNA 4V14A 2I8TA 1GA7A 2I6KA 3RTRA 3Q2SA 5FSOA 2VPLA 4F93B 3D5SC 3EPZA 3U21A 2PNYA 5FSKA 2YVNA 3QYFA 4IQJA 1PUQA 2R7RA 2WB1A 5HNFA 3OYNA 3CMMA 3PSIA 2R4GA 2VJ4A 4AYBA 2VB6A 4IQ4A 3PFYA 4BXFA 1X1AA 1ERDA 4ICKA 2JSPA 5GHIA 1PJRA 3I9V2 4HRIA 4DYWA 3KEYA 4CA0A 4NQWB 5DD4A 1Y6IA 1X1BA 2IS4A 3D5RC 3IAM2 4RLQA 1WJEA 3IP4B 4B43A 3KVHA 1MMAA 2LBFA 5FRNA 2Q9PA 4NC8A 2J8QA 2CS3A 3PNYA 3HKZA 5ISYA 2PMZA 2O5RA 5HOOA 4ANJA 4KTBA 3HPHA 4YPRA 5LPGA 2GB5A 4YEJA 1VZ0A 2R7UA 2ELJA 2VJ5A 2XF6A 1NQYA 3X0OA 4C9WA 3QODA 1RRQA 1S9HA 4N4OB 3DPUA 1OW2A 3O6ZA 3F9KA 2W1OA 2VIXA 4PSWA 4JZTA 1N78A 3N05A 3RH7A 2LC2A 3KX2A 3W2VA 4JZUA 4PJJA 3OYAA 4AVZA 2JVHA 3OWTA 3CJRB 1WFXA 2W7NA 4HFQA 1XSCA 3Q93A 4XKBA 1P9QC 4LIUA 3A4CA 3OL3A 3Q1PA 3HYQA 1E0EA 2ZXIA 4ZDLA 3RCOA 1BR2A 2ICJA 4F55A 2F4IA 4PSXA 2DHOA 4KISA 3E0JB 2AQFA 2YYHA 3A6UA 3X0NA 2CH0A 2L2OA 4PK4A 4XLAA 1JRKA 5ANUA 2E60A 1MNEA 3MKYB 1V8NA 3DEEA 2CUJA 4QPQA 5IW4A 4BQNA 2HVQA 2LRDA 3OL4A 2L5QA 3DU5A 1TT0A 1X84A 2M4KA 4KITB 4YRVA 2KDVA 2X1DA 4XL9A 5ANSA 3GBGA 5CQEA 4FETA 4E4HA 2BOLA 2QKMB 2HQAA 4F52A 4S2WA 4BDYA 1VC8A 3R03A 5GHPA 2DJIA 3S3MA 1QVJA 1X4OA 3TBIA 4BL0B 3I3LA 3AL0B 1HA8A 5JHFA 1MP2A 2CFOA 2UUZA 1KTGA 4DGWB 2X85A 3OS2A 2VXZA 3BG7A 4YELA 2RREA 2Q1ZB 3W2WA 1PUNA 1DGRM 3S8PA 4E7ZA 1N75A 3VSKA 4Y3OA 3CZ6A 4S2VA 4KYXA 1D1AA 3Q91A 2G74A 1UELB 1V5EA 3A6SA 3KYLA 3ZR1A 3H95A 3IUOA 3FSPA 2WADA 4KG3A 4BJ5C 2HZDA 3ONQA 2PJRB 3OYGA 2VJIA 3DUPA 1Z7LA 1W36C 4U7BA 4BDZA 1VCDA 2PJRA 2JUGA 4JQFA 4XN0A 3RSNA 1EA3A 3F6AA 2IGMA 4CCMA 1RYAA 4F91B 3TL4X 1D0YA 1I9AA 2FVVA 1WJFA 3N9UA 1X83A 3OY9A 2DCEA 3G0QA 3K4JA 2HNHA 3O69A 2FUG2 5C7QA 3LL7A 2O1CA 3A6VA 4C2TA 3QSJA 5CFIA 2KZVA 1D0ZA 3X0KA 2K9LA 5KNLA 4BUPA 4Y4RA 5DPKA 5FSIA 1PPVA 1R6RA 3FKJA 3DPTA 5KHDA 4ZG0A 1IRYA 2IS6A 3DTKA 4NUBA 2KP6A 3X0LA 2E1MC 5KCMA 3FK9A 4DOZA 1MMNA 4ITVA 3VYUB 2V1NA 2W4EA 3ZR8X 4BGDA 2XSQA 2UV1A 3OR1C 3ZGKA 4K6EA 3MDIA 3EUAA 2RNGA 2A8SA 4E7IA 3DLAA 4FASD 1W36D 4N4NB 2VL8A 2V9KA 1KHZA 2WA0A 1WJAA 4NFXA 3DKXA 1FMWA 3HHJA 5C8LA 4J00A 2VNQA 1NFZA 4ZDPA 2LOOA 3COUA 3FBNB 4IKFA 2M7BA 1MQEA 2X1CA 3BCBA 2BVLA 2R7TA 4D9JA 1OR7C 1PPWA 4BE2A 3L2QA 3O61A 2KLOA 1X1DA 2V7FA 4BU2A 1V5FA 3HPGA 3E1SA 5GHNA 1Z21A 4MPOA 4YOQA 3X0SA 1G0SA 1U20A 3S3NA 2FMLA 5TGTA 2KL4A 4G6TB 4P1WA 4XN3A 4OAZA 5DDGA 3BC8A 4CUGA 1MUTA 4XOPA 3GZ6A 2HVRA 1X51A 3DU6A 3MD2A 3VYTB 5GHQA 2A8PA 2R7SA 2IXSA 3SDBA 1VC9A 3X0PA 1HZTA 3E57A 3ZR0A 2MFZA 3I7VA 4BQQA 1Q54A 3PNTA 4MLOA 2K3PA 1X4PA 1Y56A 1FMVA 3FBIB 4C9XA 4ZJZA 3H5RA 1YX5A 2ZFUA 1PYVA 3PUBA 2BVMA 3K4LA 3M8JA 4E7JA 3SHDA 5CQGA 1SFKA 2KMUA 1MR2A 5ANVA 3X0IA 5LD2C 3EUHC 2YVOA 2BW3A 4NNJA 2Z2SB 2Z1DA 4BEHA 3S3OA 5BONA 3ZXSA 2E1MB 3HUGB 4HG2A 1NFSA 2YVMA 3X0MA 3OMYA 2DSCA 2BW3B 2KHMA 4XORA 1V8RA 1WJBA 3LFUA 3MGMA 3OYBA 2FKBA 2OUMA 3UNGC 4BS9A 3BAPA 1G9QA 2WY7Q 5GHJA 2WBMA 2GT2A 2MYSA 4DIQA 2ZSIB 3LSGA 4XKWA 1V8IA 1MQWA 1WJ5A 3K70D 1WJCA 2IS1A 1DP3A 3OYJA 1SOIA 1VHZA 4XLFA 4DJAA 5DEQA 2X51A 4BE1A 2JVGA 3H35A 2IS2A 2KRHA 3OYKA 3OYHA 3DKUA 3H9JA 4H4KC 2CV2A 3K4CA 4BEHB 4C9YA 1SZ3A 2KPMA 3W3CA 3LSHA 4RLFA 3C2GA 3OYCA 3SONA 1DQUA 3A2KA 2R7OA 2WY8Q 1GLNA 2QJOA 3I7UA 2HU9A 5FSLA 1UG0A 4BE0A 2R7VA 4E7SA 3L2UA 2HVSA 1D1CA 2RQQA 4PFOA 2E5ZA 1V8MA 3HC7A 4LIVA 1V8WA 1Z3XA 2VJJA 3A1YA 2CL3A 1X1CA 2KQRA 2CV0A 4IJXA 3GRNA 4F3QA 2Q2EB 4XQFA 2DSDA 1VIUA 2VQHA 4ZDOA 3ZQQA 5ANTA 4D1QA 4JOMA 2LBFB 2A6TA 3H0DA 3AKZA 3OIPA 1K6YA 3L2RA 3SZGA 4B3XA 3BM4A 4YPHA 1PUSA 2Z16A 3DKYA 1N77A 4HSTA 3V42A 5ANWA 3MDGA 2AZWA 2DOAA 2L9SA 4B44A 1JI8A 4C2UA 1HX3A 3OGAA 4P5OA 2VKDA 2R7QA 4RMNA 2ICKA 2VASA 1R67A 3ZCOA 4IX7A 5C7TA 2CZRA 2O5WA 1Q33A 1XSBA 4BJ6C 4JZVA 1BOBA 4BACA 4RM2A 3CF2A 3K4NA 2W4SA 2DT7B 1J09A 4XM3A 4S2YA 1DGWY 1YE9A 1SAUA 2AQEA 2GOXB 3H5AA 5CFJA 1MNDA 1QHGA 3MCFA 3EXQA 3Q2TA 3CJQB 3NWSA 3S32A 3PL8A 3N77A 4J7GA 3SMDA 2GOMA 1XSAA 1MW7A 3EF5A 2VKHA 3MKWB 2DUKA 3OYDA 4C30A 3OYEA 2WAQA 3H9QA 3IAS2 3K4KA 4IZZA 2L7KA 2VQLA 3OYFA 4B48A 3EESA 3GWYA 3L2VA 4CCJA 3DTIA 2PQVA 4N1TA 3H5NA 3VDXA 1RRSA 3UR3C 3LSKA 4BJTA 3HL2A 3K6GA 3OR2C 1UAAA 3CESA 4X0GA 3K4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVJ A;  2QJT A;  2YVO A;  3I9X A;  1MP2 A;  5BON A;  1KTG A;  2YVM A;  1NFS A;  3X0M A;  2I8U A;  2A8T A;  1K2E A;  2DSC A;  3CNG A;  1V8S A;  1V8R A;  3U53 A;  5I8U A;  3MGM A;  1PUN A;  1Q27 A;  2G73 A;  2YVP A;  2B06 A;  2FKB A;  3BAP A;  4HVY A;  1G9Q A;  1V8V A;  4ILQ A;  4S2V A;  5FSN A;  5GHJ A;  1VIQ A;  2GT2 A;  3BHO A;  4KYX A;  3L85 A;  3Q91 A;  1V8I A;  2G74 A;  2GT4 A;  3ID9 A;  1MQW A;  3A6T A;  2RRK A;  3A6S A;  3O8S A;  1JKN A;  1SOI A;  1VHZ A;  3H95 A;  3O52 A;  3ZR1 A;  3FSP A;  4KG3 A;  5BS6 A;  5DEQ A;  1KT9 A;  1VHG A;  4N1U A;  2B0V A;  3DUP A;  5FSM A;  3DKU A;  5GHO A;  1VCD A;  1MK1 A;  4KG4 A;  1VRL A;  1TUM A;  2A8R A;  2KDW A;  3P6Y A;  3F6A A;  1SZ3 A;  5GHM A;  1V8L A;  1RYA A;  3F13 A;  1I9A A;  2FVV A;  3ACA A;  3N9U A;  1VK6 A;  1X83 A;  3SON A;  3G0Q A;  3O69 A;  3FFU A;  5C7Q A;  2QJO A;  3I7U A;  2I8T A;  2O1C A;  3GG6 A;  4V14 A;  1GA7 A;  1V8T A;  2I6K A;  3A6V A;  3Q2S A;  1NQZ A;  2JVB A;  3QSJ A;  5FSO A;  3X0K A;  3X0J A;  3P5T A;  5FSK A;  1V8W A;  2PNY A;  1V8M A;  2YVN A;  5DPK A;  2CL3 A;  1PUQ A;  5FSI A;  1PPV A;  4IJX A;  3GRN A;  4ZG0 A;  1SJY A;  3GZ8 A;  2DSD A;  1IRY A;  1VIU A;  1F3Y A;  4ICK A;  3FCM A;  5GHI A;  3X0L A;  5FSL A;  5ANT A;  4DYW A;  2A8Q A;  3FK9 A;  2A6T A;  2B2K A;  2O5F A;  3GZ5 A;  5DD4 A;  3KVH A;  2W4E A;  3BM4 A;  2XSQ A;  4JZS A;  2Q9P A;  1PUS A;  4NFW A;  2J8Q A;  4K6E A;  4YPH A;  3MDI A;  2A8S A;  3X0Q A;  5ISY A;  5ANW A;  3AC9 A;  1KHZ A;  2AZW A;  3MDG A;  4NFX A;  4KTB A;  3HHJ A;  5C8L A;  1HX3 A;  4YPR A;  5LPG A;  2GB5 A;  2VNP A;  3OGA A;  1NQY A;  2VNQ A;  1NFZ A;  4C9W A;  3FJY A;  3X0O A;  2ICK A;  1R67 A;  3COU A;  5C7T A;  1RRQ A;  2O5W A;  1MQE A;  1OW2 A;  1Q33 A;  1XSB A;  3O6Z A;  5HZX A;  4JZV A;  3X0R A;  1PPW A;  4JZT A;  3RH7 A;  3O61 A;  4JZU A;  4S2Y A;  4HFQ A;  1XSC A;  1SU2 A;  3Q93 A;  5GHN A;  1PVF A;  5CFJ A;  4MPO A;  4YOQ A;  3MCF A;  3EXQ A;  3X0S A;  3Q2T A;  1G0S A;  3N77 A;  3SMD A;  3Q1P A;  1U20 A;  1XSA A;  3HYQ A;  3X0I A;  2FML A;  3EF5 A;  2ICJ A;  5DDG A;  2DUK A;  1K26 A;  2DSB A;  3EEU A;  1MUT A;  2DHO A;  3X0N A;  3GZ6 A;  1X51 A;  2YYH A;  3A6U A;  3J7Y e;  1V8U A;  2A8P A;  5GHQ A;  3X0P A;  1VC9 A;  4S2X A;  5ANU A;  1JRK A;  1HZT A;  3E57 A;  3WHW A;  3ZR0 A;  3I7V A;  1V8N A;  1Q54 A;  2R5W A;  3EES A;  3GWY A;  5IW4 A;  2PQV A;  4N1T A;  1RRS A;  1X84 A;  2KDV A;  5ANS A;  4C9X A;  5IW5 A;  3SHD A;  2QKL B;  2QKM B;  1PPX A;  3Q4I A;  4S2W A;  1V8Y A;  1VC8 A;  3R03 A;  1MR2 A;  5GHP A;  5ANV A;  5CFI A; 
#chains in the Genus database with same CATH topology
 1BBY A;  2DO7 A;  2STW A;  6PAX A;  1B1B A;  2WAF A;  4GDF A;  3CCL I;  3TKY A;  5LRS A;  4HF1 A;  2WAE A;  3HZJ A;  2DA7 A;  1Y1W J;  1D0X A;  4OIP F;  4XLH A;  2EJR A;  3SXY A;  4Q4Z F;  2G73 A;  1NK2 P;  2B06 A;  5TIS C;  4IXA A;  4XLN F;  4HVY A;  1FBQ A;  1V8V A;  3QU6 A;  5FSN A;  3H3Z A;  3NAR A;  2HDC A;  3HIF A;  4NB5 A;  1WSU A;  4KJZ A;  2RRK A;  1RZ4 A;  5CVI A;  3ZMV A;  2HOT A;  4XID A;  2V79 A;  3AL0 C;  4N1U A;  1Y8R B;  2VC0 A;  4HF0 A;  4UVA A;  1H0M A;  4Y33 A;  3K70 C;  1ZK8 A;  1WPK A;  5K7Z A;  2KDW A;  4ZYG A;  5IP6 A;  3GTK J;  1XCV A;  2KIM A;  3S1N J;  3RQI A;  1TBX A;  3D5L A;  2JA2 A;  3C1D A;  3WHB A;  1U5T C;  3FFU A;  4BQO A;  3ZMZ A;  2LRE A;  5IYB J;  1Q1V A;  3CLO A;  5HLT A;  1TQM A;  3H1C A;  2XKO A;  4M73 A;  3PNV A;  3O6B B;  4UB8 C;  3J81 K;  2DXI A;  2EWN A;  3CUQ A;  3BR5 A;  4RBO A;  1F3Y A;  2FBK A;  2QEN A;  4E7L A;  5D6F A;  2O8K A;  3FCM A;  4M6Y A;  4FX0 A;  1HW5 A;  2ZSH B;  4OWR B;  3EYI A;  2O5F A;  3GZ5 A;  3DBH B;  1DPR A;  2W85 A;  1XGN A;  2DFF A;  4XMY A;  3BQZ A;  4NFW A;  3JAM Z;  2CUE A;  2M0C A;  3X0Q A;  1XTA A;  2EFO A;  2J5P A;  3AC9 A;  2M7A A;  3TMO A;  1KYW A;  4CCK A;  5EG0 B;  1JHF A;  2FBI A;  5HS7 A;  1J2X A;  4J01 A;  1O3Q A;  2OA4 A;  2ZXW H;  1QHH D;  3DTE A;  4E6K G;  2D5V A;  3FM3 A;  4EAT A;  3W6V A;  1OPC A;  1SFE A;  1ZKG A;  3MKZ A;  5HZX A;  3L9F A;  1FOX A;  3X0R A;  5BNG A;  5BOX A;  1XDU A;  1IN6 A;  2YS9 A;  1SU2 A;  2EPF A;  1T08 B;  1G4D A;  1PVF A;  2VXD A;  2QVO A;  1BC7 C;  3W2A A;  1OYY A;  1HW2 A;  3VYS B;  1Z91 A;  2C6Y A;  3BCA A;  1Z3Y A;  4ZTJ A;  4AU7 A;  2ZFW A;  1K61 A;  2LY2 A;  2QSF X;  2XGX A;  4MEX F;  4Q47 A;  5M5Y J;  3BLY A;  4OMY A;  1E2X A;  3NQO A;  1JKO C;  1XGO A;  3OYL A;  1I39 A;  3W6J B;  1SFO J;  3ABT A;  3E97 A;  4E7K A;  2X1E A;  2M4G A;  3F0C A;  1XCB A;  2DW4 A;  4BQA A;  4XKV A;  2UWM A;  1T6S A;  1YIJ I;  2QKL B;  3CUO A;  5DCM A;  3Q4I A;  1ZR4 A;  3KP7 A;  1LEB A;  3DWL E;  2ZJQ F;  2ZBK A;  1B9M A;  3I53 A;  3P5J A;  3L09 A;  4I0A A;  1CGP A;  4II3 A;  5KAI C;  1AWC A;  2BYV E;  2DK8 A;  1IRG A;  2P6S A;  3SYT A;  2E5N A;  3ISP A;  3WTU C;  1X19 A;  3EET A;  3S2W A;  2CMP A;  2XAQ A;  2QA4 I;  3G1O A;  1D8K A;  2LY1 A;  3HRU A;  3I59 A;  4DQ2 A;  5ICF A;  3BHO A;  4M9Z A;  1F5T A;  2GT4 A;  3PUF A;  5FRO A;  1OYI A;  5CVU A;  1FYL A;  1B72 B;  4CCO A;  1I50 J;  2M9H A;  3WU0 A;  3BWG A;  2V26 A;  4KG4 A;  1D5V A;  3J7Z I;  4FTH A;  2IGK A;  4WXH A;  3F21 A;  1V8L A;  1BIA A;  3IWZ A;  1HC8 A;  4ZZD A;  1V5G A;  3TW6 A;  3E6M A;  1ZG1 A;  2K40 A;  1S7A A;  3EYY A;  1S72 I;  2EA4 A;  3D5S C;  2M8G X;  3EPZ A;  3U21 A;  5FSK A;  1AU7 A;  2YVN A;  5A2Q K;  1J7K A;  4BKX A;  5HNF A;  1YW7 A;  2EK5 A;  2R4G A;  2FXA A;  2VB6 A;  2EA2 A;  1I5Z A;  1WCM J;  4BHP A;  4WF2 A;  5E18 F;  5GHI A;  2A05 A;  2OU2 A;  3O8H A;  3KEY A;  2FOW A;  1X1B A;  1Z0X A;  4B43 A;  1WJE A;  3IP4 B;  4AYB N;  4RAF A;  3KVH A;  4UV8 A;  2LBF A;  3O8G A;  5E1X A;  4JX4 A;  3JTG A;  5DCF A;  4A3C J;  4U88 A;  2KKO A;  2ETH A;  2M2E A;  2HKO A;  2O5R A;  2CRG A;  5ILU A;  2XV4 S;  3BG5 A;  1ETW A;  1VZ0 A;  1NQY A;  2DT5 A;  4M71 A;  5D5X B;  3X0O A;  2GZW A;  3LAP A;  2O03 A;  1OW2 A;  4I7H A;  2Z9O A;  2Y30 A;  3ZQ7 A;  4JZT A;  3RH7 A;  4EEF G;  1PDN C;  3KX2 A;  1U9N A;  4AVZ A;  2JVH A;  3OWT A;  5F27 A;  3Q93 A;  2ZME B;  1P9Q C;  4LIU A;  3L00 A;  1B72 A;  3QQA A;  3Q1P A;  3HYQ A;  2HGC A;  3HSE A;  2Y0S N;  2M1B A;  2RN7 A;  2DFH A;  3A03 A;  1MNE A;  1R23 A;  2WB1 N;  2CUJ A;  1OKR A;  3OL4 A;  2LRD A;  1X84 A;  4Y17 A;  3DEW A;  2KDV A;  4YRV A;  4XL9 A;  3GBG A;  4UUT A;  4E4H A;  3J7Y J;  1R71 A;  4EMS A;  2BOL A;  4KIF A;  4UNO A;  4S2W A;  3KP3 A;  2ECC A;  2A68 F;  4IOC F;  3CLQ A;  3CCU I;  1OIS A;  1X2M A;  3TBI A;  3I3L A;  3FK6 A;  3AL0 B;  4GGG A;  2EV0 A;  4RA2 A;  2ZJ2 A;  4HQE A;  3VOD A;  4HX4 A;  3W2W A;  2Q1Z B;  5E3L A;  2ZJR F;  4I98 B;  4A69 C;  1O4X A;  1I1G A;  1W5C C;  3DLL F;  4S2V A;  3PFI A;  3BRO A;  1MBK A;  3MAJ A;  5DS9 A;  1UEL B;  1ZAO A;  1UST A;  3A6S A;  3KYL A;  1QNT A;  3IUO A;  4IRH A;  1TWG J;  2K4B A;  4BJ5 C;  2HZD A;  3ONQ A;  4QIW N;  1F36 A;  2VJI A;  4IO9 F;  3DUP A;  1RI7 A;  4FX4 A;  2DOE A;  1W36 C;  1VCD A;  1B9N A;  1XGM A;  2FRH A;  4R1H A;  3V7C A;  4RGU A;  5IY5 H;  1RET A;  5CVR A;  3GZN B;  4KN7 X;  5F0C A;  1VQO I;  2FVV A;  3KPH A;  1X83 A;  3OY9 A;  3HOV J;  2DCE A;  4OIQ F;  4D7N A;  2H1L A;  3K1M A;  3K4J A;  2XRN A;  2B7E A;  2O1C A;  2BBY A;  2JWT A;  1ZRC A;  4IOA F;  2KZV A;  2K9L A;  2NNN A;  4HV5 A;  3KYC B;  4Y4R A;  3PM1 A;  1XMA A;  3FKJ A;  5KHD A;  1LNW A;  3DPT A;  4D7M A;  1ZRE A;  1YIO A;  2L3D A;  1FIA A;  1TQI A;  2D2W A;  1P2F A;  4DOZ A;  4A5N A;  3IL2 A;  3I55 I;  3VYU B;  5BPD A;  2EFP A;  2V1N A;  3IH2 A;  3OR1 C;  3ZGK A;  4K6E A;  2MBF A;  4E7I A;  3KIO A;  4C2M J;  1W36 D;  1J0R A;  5DM6 F;  4EJO A;  1KHZ A;  5J8F A;  2BHZ A;  2Z5U A;  4NFX A;  5GAG J;  1MDM A;  1IUY A;  5C8L A;  2MLG A;  5EG0 A;  2AS5 F;  4IKF A;  1BIB A;  4DW6 A;  1MQE A;  4RAZ A;  2P6T A;  1OR7 C;  5KK1 A;  2CG4 A;  3LSP A;  1IXC A;  3CDI A;  5LBQ A;  4KYW A;  2EIK H;  3CC4 I;  4EV0 A;  2KLO A;  3S15 J;  4BBR J;  4BU2 A;  1V5F A;  1Z21 A;  1MMS A;  5K5O A;  2BY1 A;  1IXS B;  3FXK A;  3A02 A;  1K78 A;  5TGT A;  1IRF A;  1UCR A;  3G73 A;  1O57 A;  4EQQ A;  2DQL A;  4CUG A;  1MUT A;  1TWF J;  1BA5 A;  2ICW G;  2PX9 A;  2R7S A;  2ZME C;  3X0P A;  2MA3 A;  3ZR0 A;  4NDL A;  3CCJ I;  5LHI A;  1S5L C;  4KFC A;  1YS6 A;  1X4P A;  4PGH A;  2CUF A;  1ETK A;  5IP9 J;  3H5R A;  3PUB A;  3M8J A;  4B1R A;  3JTH A;  4GO1 A;  3A0B C;  2XB5 A;  4G94 A;  2QSH X;  1MR2 A;  1WZ2 A;  1Y39 A;  4F7Z A;  5LD2 C;  3WOD F;  4U0V A;  3S3O A;  5BON A;  3FZV A;  1R4N B;  3DFG A;  4HG2 A;  3OMY A;  4XOR A;  1VND A;  2OF7 A;  3U9G A;  2R7F A;  2OUM A;  2PLY A;  2B63 J;  2WY7 Q;  3MQ0 A;  3CF5 F;  2MYS A;  2L54 A;  3E3V A;  3PIO F;  3MZY A;  3KEO A;  4RAG A;  4IHT A;  1MQW A;  1V8I A;  1DP3 A;  1TP4 A;  2VC1 A;  1C0W A;  2JVG A;  2D45 A;  4LK1 F;  2KRH A;  4BY7 J;  3GO5 A;  3GTJ J;  4V2G A;  3QP5 A;  4OMZ A;  3EDP A;  1SD5 A;  1SZ3 A;  2KPM A;  1USS A;  2EZI A;  2KFD A;  1WH5 A;  3QAH A;  3T1B A;  3ZN0 A;  4CZZ A;  3V8L A;  2VBY A;  3QU3 A;  1GT0 C;  4LG0 A;  1TWA J;  4DYC A;  3PQK A;  2DFI A;  4M3F A;  5HLH A;  5L3F A;  1HF0 A;  4C3I J;  2R92 J;  4BE0 A;  4Y15 A;  1HDD C;  1D1C A;  1KYZ A;  4PFO A;  3HC7 A;  5E3M A;  4IHX A;  3JSP A;  4FCY A;  2K3F A;  4XQF A;  2Q2E B;  4EM0 B;  4LGW A;  1VIU A;  4HAM A;  4MFE A;  3RZO J;  5K7F A;  2CYY A;  4JBA A;  5FKN A;  2A6T A;  2IW5 A;  3DKW A;  5JLW A;  3E7L A;  1K6Y A;  2CW0 F;  3OV8 A;  1ZLJ A;  1KZH A;  3L2R A;  1AHD P;  1ZLK A;  1IDY A;  3VPR A;  2VT2 A;  4NQW A;  2WWY A;  2IAI A;  4LG0 B;  4ENM A;  1I6H J;  2E2J J;  3U1K A;  5LGT A;  2JSC A;  4RB0 A;  1ZGA A;  2KZG A;  3HGY A;  2DOA A;  3ZQI A;  2EBI A;  3GFL A;  2DBB A;  2EIJ H;  3C3W A;  1VF9 A;  5E3N A;  1CF7 A;  5CVJ A;  3RDI A;  3OGA A;  4EJV A;  4HDV A;  1IJW C;  1R67 A;  5J6X A;  4IX7 A;  5C7T A;  4HYE A;  2O5W A;  2DOF A;  1REP C;  3PQJ A;  4JX5 A;  4X1E A;  4BHC A;  1DUX C;  2DT7 B;  1IV6 A;  3F8B A;  4HV6 A;  2RDP A;  4XM3 A;  1DGW Y;  3R60 A;  1QVT A;  5CVV A;  3CC7 I;  1OYW A;  4ESF A;  1AKH B;  2W24 A;  5IT9 Z;  5FLV A;  3FMS A;  5CFJ A;  2HQR A;  3CJQ B;  1UJ8 A;  3N77 A;  2K27 A;  3EF5 A;  1UHW A;  1PP8 F;  2A3S A;  1P4A A;  2VKH A;  3BQY A;  1XG1 A;  2CQ7 A;  4A0Z A;  3MKW B;  2V9P A;  1W0T A;  2GM4 A;  3OYE A;  1JUS A;  5GAH J;  1ZQ3 P;  3B6A A;  2EIL H;  3P9K A;  2VT3 A;  1JT6 A;  1ORK A;  3ZMU A;  2L7K A;  2PMZ N;  4B48 A;  1W7P B;  1MGT A;  1SAN A;  3C18 A;  1W7P A;  3LSK A;  5IP7 J;  4IVN A;  1NH3 A;  3CCM I;  2DU9 A;  3HL2 A;  1O7F A;  4A12 A;  4XLP F;  3F8N A;  3KP6 A;  4EJT A;  5CKT A;  1XMX A;  5E3O A;  2IJL A;  5FRM A;  2H8R A;  2XAG A;  4AID A;  3CNG A;  1UB9 A;  2GWR A;  2D1H A;  3K1P A;  4PDK A;  1KON A;  2FD5 A;  3RPU A;  3SQN A;  2YVP A;  5H20 A;  4HSR A;  2WV1 A;  4PGG A;  2CV1 A;  4AM3 A;  3GYH X;  2O0Y A;  4XKC A;  2QEX I;  1VIQ A;  2A5W A;  3QYB A;  1Z1D A;  3O8S A;  4S05 A;  2EFW A;  2F6C A;  3OS0 A;  3A6T A;  3I4M J;  2K9Q A;  1FWZ A;  4R79 A;  3CCQ I;  5D5W B;  2E34 A;  3S93 A;  3CP8 A;  4II2 A;  1JKQ C;  1B59 A;  1W4M A;  1MK1 A;  2ESN A;  4A2U A;  4DBQ A;  3J80 K;  5J1U A;  2K7L A;  3RPU D;  1VRL A;  3P6Y A;  3LSI A;  3H9G A;  5FFX A;  1QGP A;  1FEX A;  2QLZ A;  1MMG A;  4XR6 A;  4GYG A;  2E1C A;  4NC7 A;  4JK1 X;  3QPL A;  2X6X A;  1T0F C;  5HNH A;  3GG6 A;  3U53 A;  3ULQ B;  1A6I A;  4AIH A;  4LB5 A;  3X0J A;  2IA2 A;  1NQZ A;  1U2W A;  2XAJ A;  3GFM A;  3RKX A;  1UFM A;  2E7X A;  2RV8 A;  2W82 A;  3RZD J;  3SFZ A;  2H1K A;  2FQ4 A;  2EIM H;  1IAW A;  4G8X A;  2R7X A;  3VYR B;  3RQ4 A;  2HTS A;  1YFH A;  1Z05 A;  2X4H A;  4HEA 2;  4XLC A;  2A8Q A;  1X3Z B;  3SFI A;  1LPQ A;  3Q3S A;  1ZEL A;  1MSF C;  2CO5 A;  3E5Q A;  2G0E A;  1O3S A;  1XB4 A;  3J7A Y;  2VQC A;  4G7H F;  2MG4 A;  2MSY A;  2VKV A;  5FGM A;  1R1U A;  2MC4 A;  2A69 F;  1HKT A;  1ZG5 A;  3AFH A;  2VNP A;  3ZN1 A;  2XF7 A;  4UXN A;  3ZQL A;  4LIT A;  1XGS A;  3TW7 A;  3F8F A;  4J7H A;  2IGO A;  1FY7 A;  5EGO A;  2DDA A;  3FXO A;  3A0H C;  3ZQG A;  4OAY A;  2I8D A;  2L01 A;  3HRS A;  3ERE D;  2XF5 A;  1SVO A;  5EEG A;  4IHV A;  2RQP A;  1EH7 A;  3BTJ A;  3U1D A;  2X6W A;  3CCY A;  1T95 A;  3EUH A;  3SDG A;  1YX3 A;  3JRI A;  5HVQ C;  2R5W A;  3BOQ A;  3GFI A;  2XRL A;  3K7A J;  5IW5 A;  1A5J A;  3BPV A;  3G2B A;  3E6C C;  1PPX A;  4MTE A;  3S16 J;  3BG6 A;  3FHZ A;  1JJ6 C;  2PQ8 A;  2OC6 A;  2NVX J;  1KA8 A;  1EH8 A;  2P4W A;  3T8R A;  2YU3 A;  2JT1 A;  5HOD A;  1NK3 P;  2YUS A;  3L2W A;  1CF7 B;  1JTX A;  5HLG A;  2I8U A;  2DOD A;  1R9T J;  1ETQ A;  3TP3 A;  3I58 A;  3WGI A;  2VOD A;  4HNT A;  2CU7 A;  1A35 A;  3FXM A;  2QM3 A;  4UVC A;  5DUK A;  3GTQ J;  1YYV A;  1ETX A;  5J47 A;  2XGD A;  2KIU A;  3CP2 A;  3DF8 A;  4IHS A;  4UB6 C;  4MGR A;  2ZXH A;  3CTA A;  1G6N A;  1KQ0 A;  4ZZL A;  1AA7 A;  2KIF A;  2M3A A;  1MJB A;  1VHG A;  2XAU A;  1F4K A;  2DI3 A;  2PI0 A;  1BR4 A;  2P0W A;  3GLL A;  1H89 C;  2XC7 A;  5F1J A;  4U0W A;  2OV7 A;  4LD5 A;  3SJM A;  5LEK A;  3IC7 A;  4Q5S F;  1IRX A;  3LA3 A;  2R5Y B;  3WG7 H;  4FQG A;  3ZOB A;  1RES A;  1ZYR F;  4HPQ A;  3HXL A;  1WGX A;  3MMY B;  3OS1 A;  5AIQ A;  4I0B A;  4KT5 C;  4AVP A;  4V19 K;  4V14 A;  5FO5 A;  4UUV A;  3WTV C;  1GA7 A;  2PNY A;  2QQB A;  2P8T A;  3QYF A;  3R6S A;  4MFD A;  4ENN A;  5FKM A;  2WB1 A;  1PUQ A;  3CMM A;  5DYM A;  5LGN A;  2H09 A;  4IQ4 A;  1ERD A;  5KAF C;  4HRI A;  4DYW A;  3R0A A;  1K4S A;  1R22 A;  4NQW B;  2HEO A;  2Y9Y A;  2A6E F;  4AWX B;  1IRZ A;  5FRN A;  2J8Q A;  1HDP A;  4Q48 A;  3PNY A;  4M3G A;  3QWL A;  5E8G A;  3ELK A;  5ISY A;  2PMZ A;  1YO5 C;  2OJE D;  1HKS A;  2E1O A;  3HPH A;  4RGX A;  2LFB A;  2NS7 A;  2ELJ A;  2VJ5 A;  2OQG A;  2O7O A;  3QOD A;  1W7P D;  1S9H A;  1FNN A;  1BOA A;  3HSF A;  4ZYH A;  3LOC A;  1N78 A;  1V4R A;  4JZU A;  2L02 A;  1A36 A;  2W7N A;  2FSW A;  4L9J A;  4LOC A;  3HOZ J;  3RIR A;  1E0E A;  3RCO A;  4M72 A;  2LKP A;  3RYP A;  3BZK A;  4F55 A;  4XRF A;  2ICJ A;  4BNC A;  4MQ9 F;  2DHO A;  4KIS A;  1GHC A;  3X0N A;  1E3P A;  2CH0 A;  2L2O A;  4XLA A;  1JRK A;  5ANU A;  5GTI C;  2XUB A;  3MKY B;  3AG1 H;  3S1R J;  4V2F A;  4HA8 A;  2OQR A;  2HVQ A;  1ITY A;  1TT0 A;  3TOB A;  5ANS A;  1XX5 A;  2COM A;  5CQE A;  4FET A;  4DYQ A;  2IPQ X;  2YR2 A;  4ABZ A;  4EGZ A;  4BDY A;  1VC8 A;  5HS8 A;  1KU7 A;  2DJI A;  1W0U A;  1X4O A;  3SZP A;  1HA8 A;  1MP2 A;  5JHF A;  2CFO A;  2UUZ A;  1KTG A;  3DBL B;  2M8E A;  3OS2 A;  2K9N A;  1NTC A;  5FD6 A;  2RRE A;  3ECH A;  4E7Z A;  3VSK A;  3ABK H;  1P6R A;  1FT9 A;  3K2A A;  3CZ6 A;  2L4A A;  3HB9 A;  4KYX A;  1D1A A;  1D3Y A;  1OCZ H;  1V5E A;  4A6D A;  1AOY A;  3A01 A;  2TCT A;  5GAD J;  3AG2 H;  5B1A H;  2Y9Z A;  4CXF A;  5FLX Z;  3OYG A;  4QSH A;  5J8C A;  3E6B A;  5IOZ A;  1IG7 A;  4U7B A;  2JUG A;  4JQF A;  4XN0 A;  3P9C A;  1OJL A;  2IGM A;  1GV2 A;  1QZZ A;  4F91 B;  1XSV A;  2R0Q C;  3N9U A;  2YPR A;  3LSJ A;  3QOP A;  1MKM A;  1T2K A;  4N0B A;  3JRC A;  3AAF A;  1T8I A;  2FUG 2;  2ME0 A;  4WXC A;  2QYO A;  4BH9 A;  3ABL H;  4C2T A;  3H92 A;  1JKR C;  1ONV A;  5CFI A;  3X0K A;  5KNL A;  2QCO A;  3M3Y J;  2JA7 J;  3RI4 A;  2EB7 A;  3WTY C;  5DPK A;  5AON A;  5FSI A;  1R6R A;  3BG9 A;  3JRG A;  1IRY A;  4YIF A;  2IS6 A;  4GYI A;  2ISY A;  3L2C A;  2HQ5 A;  3X0L A;  1Z77 A;  2UXX A;  4GCV A;  2P5L C;  4JP0 A;  1MSE C;  1GXP A;  1R36 A;  3L1P A;  2ADU A;  2JQ7 A;  2XSQ A;  4A3D J;  5E17 F;  4IPA A;  3EUA A;  2RNG A;  2DDB A;  3DLA A;  5JVT A;  4N4N B;  4BAY A;  2VL8 A;  2V9K A;  2WA0 A;  1WJA A;  2M87 A;  2MGQ A;  1R4M B;  3I71 A;  1YTY A;  2KRF A;  1TW3 A;  2V9V A;  1A31 A;  2EZH A;  2VNQ A;  1G3Y A;  4JYK A;  1D5Y A;  1R7J A;  3LWF A;  2M7B A;  1YW9 A;  2X1C A;  3BCB A;  3CCR I;  2XIG A;  4L5I A;  4D9J A;  2CGP A;  4BE2 A;  1K7A A;  1Y8Q B;  2BY0 A;  3H3U A;  2PEX A;  2LVS A;  2CJJ A;  4WWC A;  4A93 J;  4DZJ A;  3LNQ A;  3REO A;  1F43 A;  4YOQ A;  3X0S A;  5TJJ A;  3S3N A;  4G6T B;  3K69 A;  4LJZ F;  4IRI A;  4OAZ A;  1LFB A;  1G3W A;  5J3L A;  3JRB A;  3DU6 A;  4DZP A;  2A8P A;  2IXS A;  3SDB A;  1VC9 A;  1V54 H;  1HZT A;  2MFZ A;  4BQQ A;  1Q54 A;  1MJA A;  1R5H A;  1UZC A;  2F5D A;  3PNT A;  2CQK A;  2CQQ A;  2R93 J;  1YJ9 I;  1E17 A;  1FMV A;  3FBI B;  1M1E B;  4MHG A;  4ZJZ A;  4C9X A;  2ZFU A;  3SHD A;  1PYV A;  4MQV A;  2BVM A;  1SFK A;  4U7D A;  2LTP A;  4G6Q A;  2GIV A;  4NNJ A;  3K0L A;  5L3D A;  1EF4 A;  4OIN F;  2E1M B;  3HUG B;  1NFS A;  4IF4 A;  2YVM A;  3FM5 A;  3X0M A;  3NEU A;  5EYR A;  1VQL I;  3MGM A;  3BJA A;  1RRJ A;  1G3T A;  2LLK A;  3BAP A;  1ETY A;  4W1U A;  2JUC A;  1FZP B;  3LSG A;  1FYK A;  1WJ5 A;  3K70 D;  1SOI A;  1XDS A;  2KJB A;  2LK2 A;  3DEU A;  1T39 A;  5E8I A;  3ZQH A;  1QBJ A;  5J1R A;  4BE1 A;  2P81 A;  3HBL A;  3VOE A;  1PUF A;  3G1L A;  3DKU A;  4J19 A;  2ZCW A;  3D0S A;  1YQA A;  4H4K C;  4O5V A;  5FD5 A;  5GP9 A;  2OCE A;  4BEH B;  3CMA I;  3PIP F;  5EEA A;  3ECO A;  3IWF A;  2GA1 A;  4RLF A;  2NOG A;  3LQR A;  2I5U A;  1RUO A;  4Y7N J;  1YJN I;  5EZH A;  2QJO A;  3I7U A;  4YFX F;  2HU9 A;  5FSL A;  2XGC A;  2PG4 A;  1A04 A;  2R7V A;  4E7S A;  3L2U A;  3B73 A;  1V8W A;  1V8M A;  4LIV A;  2VJJ A;  2OPT A;  2ID6 A;  4F3Q A;  1TQP A;  4N9I A;  2BEO A;  2Y69 H;  2JTV A;  2HKX A;  4LLG F;  2XPU A;  5ANT A;  4D1Q A;  2LBF B;  3H0D A;  3HDD A;  1K78 B;  4B3X A;  3BM4 A;  4YPH A;  5LRR A;  3KE2 A;  1PUS A;  4UUS B;  5AIP A;  1FLI A;  2DTZ A;  3T8T A;  4FIS A;  1G2H A;  1FP2 A;  3WU2 C;  2O61 A;  3S1Q J;  2OTL I;  3P7N A;  3IKT A;  2YU9 J;  1SFU A;  1HX3 A;  4BXU A;  3LA2 A;  4P5O A;  1K79 A;  2O3F A;  4RMN A;  5IPA A;  4XRS A;  2VAS A;  1MH4 A;  1RPW A;  3M9A A;  3WGG A;  2UZK A;  2ICK A;  4A6E A;  4MIM A;  4EJW A;  3JW4 A;  3F3X A;  4HLX A;  4S2Y A;  4NBQ A;  4B3A A;  1MJ9 A;  1MND A;  1QHG A;  3MCF A;  4IHW A;  3WTX C;  3NWS A;  3S32 A;  4J7G A;  2GOM A;  1MW7 A;  4A3M J;  4L5E A;  1BL0 A;  1Z67 A;  4FHT A;  4YIR X;  1VQ5 I;  3PO2 J;  3OYD A;  3M4O J;  2DUK A;  4CDG A;  3H9Q A;  3IAS 2;  3PO3 J;  3QPH A;  5LHG A;  3BR2 A;  3BR6 A;  1MBH A;  1SMT A;  2NAZ A;  5F6F A;  3L2V A;  4CCJ A;  2LD5 A;  2PQV A;  4N1T A;  3VDX A;  3A01 B;  2KJC A;  3QPT A;  2JJ7 A;  2TRT A;  4M6X A;  3GTL J;  3HSR A;  4X0G A;  5C4J J;  5D8L B;  4EVI A;  1SD4 A;  4A3K J;  2HPI A;  1ACI A;  3MZ8 A;  2XSJ C;  1LKX A;  4ASN A;  2GXB A;  1J9I A;  1WRJ A;  2CUZ A;  2DA5 A;  3LAJ A;  3G6E I;  3FXR A;  2ZNZ A;  1SD6 A;  4CCL A;  5FKL A;  1B8I A;  3HTU A;  4KIB A;  4I02 A;  4ILQ A;  4IRG A;  3I5U A;  1VTN C;  1B8I B;  3T5X A;  2CSO A;  1ZAR A;  3RKY A;  4CZC A;  5ICC A;  1Q1H A;  1GDT A;  1S29 A;  3CJN A;  2LYC A;  4KT6 A;  5ED4 A;  3WTS C;  2P5K A;  5JI6 A;  2DT6 A;  3F23 A;  3GW2 A;  1FJL A;  4RDU A;  1U0J A;  1P7I A;  5A2Q Z;  2FA5 A;  5GHM A;  2LH9 A;  5CJ9 A;  3HOT A;  3H0G J;  5IYC J;  3X2Q H;  1DDN A;  4BXX J;  3HUG A;  2CWE A;  3D1N I;  3G4S I;  3GXO A;  5IYD J;  5FLX K;  3S17 J;  1RNL A;  1BJA A;  4OIR F;  3P5T A;  2V1U A;  4OIO F;  1FIP A;  4UVB A;  1SJY A;  1DP7 P;  2FF4 A;  2AHQ A;  3WTW C;  3GLX A;  2EV5 A;  2X48 A;  2FNA A;  3DPL C;  3M8F A;  2HOA A;  1OMI A;  1WHU A;  2G7H A;  4ZYA A;  3FXJ A;  1TNT A;  1MBG A;  4S0H B;  1X3U A;  3JRF A;  2K9M A;  2GIZ A;  2R7W A;  4M9S A;  3GTM J;  3EUK L;  4CYD A;  2NVU B;  4PJN A;  2DFE A;  3RKQ A;  3CDH A;  1G8X A;  1O3R A;  4I09 A;  2JZY A;  2OD5 A;  3MN2 A;  2JMW A;  3KCC A;  4CSW A;  1WI3 A;  3LMM A;  1JTY A;  1XMK A;  3M7G A;  5DUI A;  3FJY A;  4HLY A;  2ELH A;  2HPM A;  1FOY A;  5HDN A;  3KLN A;  1FPQ A;  2DQR A;  1BR1 A;  4DBR A;  1U3E M;  3LSM A;  2Y75 A;  1VI0 A;  2ESH A;  1XPX A;  2JA8 J;  4XON A;  3ZPL A;  5ERI A;  2PMH A;  3I64 A;  2IVM A;  3GME A;  4L5J A;  1F1Z A;  2OBP A;  1K26 A;  2DSB A;  3EEU A;  2VQG A;  2XVC A;  2K5C A;  1APL C;  1VQ6 I;  3J7Y e;  1V8U A;  4LFU A;  2V4J C;  4HW0 A;  2M0M A;  4ZC3 A;  1FOW A;  3WHW A;  2LY9 A;  2MD0 A;  3ESW B;  2ECB A;  2W00 A;  2FQ3 A;  2E7W A;  2XPW A;  5EF6 A;  5H2F C;  1LVK A;  5GAE J;  1XD7 A;  2A5Y B;  1QU3 A;  1LFP A;  4A3L J;  1V8Y A;  2X6O A;  3OIQ A;  1J75 A;  2XPV A;  3T0Y A;  1X58 A;  3HOS A;  4E7H A;  2F5F A;  3HJE A;  2FE3 A;  3I9X A;  3B02 A;  2M30 A;  4U87 A;  5LHH A;  1FSH A;  3IKV A;  3OOU A;  3GUD A;  1CQT A;  2VLA A;  2HYG D;  4IEJ A;  1TZL A;  3KLO A;  2H27 A;  1FBU A;  3CQZ J;  2Y0S A;  3FMR A;  3Q9S A;  1LFU P;  3P9I A;  4F92 B;  1KQ8 A;  2OAZ A;  3ID9 A;  3S14 J;  3M1C A;  3WE3 A;  4AC0 A;  1DU6 A;  2L0K A;  5FKO A;  2QQ9 A;  1YRN A;  2K4J A;  1MIJ A;  5K5Q A;  1KT9 A;  1HLV A;  3QYE A;  2OZU A;  5GHO A;  3F8M A;  4C3J J;  4HBL A;  4A0Y A;  1WJD A;  2DN0 A;  3WTT C;  1Y0U A;  1EJ9 A;  2PN6 A;  4I99 C;  2LF7 A;  4B47 A;  4HNV A;  2VE8 A;  3ZMS A;  3C2H A;  1I1S A;  1TWH J;  4XNF A;  2ZC2 A;  5C44 J;  3DQV C;  3W6K B;  4W97 A;  2LG4 A;  2QBY B;  2MC3 A;  2I8T A;  2CQX A;  3RTR A;  1IV8 A;  5FSO A;  1IZ1 A;  1IGN A;  3E5X A;  3PSI A;  2VJ4 A;  2G9W A;  4AYB A;  2VBZ A;  2HZT A;  3PFY A;  4BXF A;  5EZG A;  3JCU C;  4WX9 A;  2RGV A;  2B9S A;  3HRM A;  4I6Z A;  3KFW X;  5DD4 A;  5DCM B;  2PMU A;  1F9N A;  2XGE A;  1MMA A;  1R1V A;  4HX7 A;  4E70 A;  3BTC A;  2Z33 A;  1VQ8 I;  2PBI A;  3TO6 A;  4BBS J;  2QF7 A;  4XK4 A;  4ANJ A;  4KTB A;  1Y0N A;  4XIC A;  5LPG A;  2GB5 A;  4YPR A;  2R7U A;  4C9W A;  1RRQ A;  2EIN H;  3DPU A;  4KIC A;  4N4O B;  1YS7 A;  5M3F J;  3N05 A;  3RPQ A;  2LC2 A;  3W2V A;  5JR3 A;  4PJJ A;  3OYA A;  3CJR B;  4HFQ A;  1XSC A;  4GXO A;  1ZH5 A;  5HLI A;  4CHU A;  2E35 A;  2HTJ A;  4Z2Y A;  3A4C A;  2FU4 A;  5KVR A;  5BPI A;  1QZE A;  2ZXI A;  5EEH A;  4ZDL A;  1SEU A;  1WQ2 A;  3GEZ A;  2Y0M A;  4PSX A;  2KIS A;  2BXY A;  3QRF F;  1P4W A;  3E0J B;  5JHU A;  2YYH A;  4O6J A;  3A6U A;  2ID3 A;  4OOI A;  3FXL A;  1FTZ A;  2DMN A;  4PK4 A;  1T33 A;  1BN5 A;  1IUF A;  3DEE A;  1QA6 A;  4QPQ A;  4BQN A;  2JPC A;  2M4K A;  1UMQ A;  2AXT C;  1S3J A;  2X1D A;  4B8X A;  5E1W A;  4F52 A;  4RB3 C;  4PCQ A;  2F2E A;  1ZRD A;  2WAQ N;  2HYF A;  1ON2 A;  2WTE A;  2ME6 A;  1QVU A;  2DJN A;  1NHA A;  5E79 C;  2YX7 A;  4A3G J;  4A5M A;  1QVJ A;  3IRQ A;  5TRD A;  3ABU A;  3BPX A;  2AXL A;  3VFZ A;  4DGW B;  2DPD A;  3F6O A;  2VXZ A;  3MEX A;  4PJ0 C;  2F5E A;  3BG7 A;  4YEL A;  1IN8 A;  3CMY A;  1DGR M;  1N75 A;  1KGS A;  4ZYE A;  4AUX A;  1K4T A;  3JRA A;  1EH6 A;  3FXQ A;  4UV9 A;  4WK8 F;  1WI9 A;  5D4S A;  2Q0O A;  1R5G A;  3ZR1 A;  3H95 A;  2DA3 A;  5LGU A;  3HOX J;  2WAD A;  2PJR B;  3WU1 B;  4BDZ A;  4EM2 A;  3RSN A;  1EA3 A;  2M34 A;  2A6H F;  1RYA A;  1D0Y A;  2FBH A;  1O3T A;  3V7S A;  1ETV A;  1SMY F;  3G0Q A;  2HNH A;  5C7Q A;  3BR1 A;  3A6V A;  1V55 H;  1TWC J;  3TP0 A;  1RR8 C;  4ZG0 A;  1L0O C;  1ODD A;  3KP5 A;  1OCO H;  4M74 A;  2BY2 A;  2MLK A;  4NUB A;  2KP6 A;  2E1M C;  2V1X A;  3FK9 A;  1VQ4 I;  4QTR A;  3TO7 A;  2DA2 A;  4G12 A;  5H6Q A;  1MMN A;  3V8J A;  3BDD A;  1ENH A;  3J81 Z;  2W4E A;  4M9X A;  4BGD A;  2UV1 A;  3MDI A;  2A8S A;  4N9H A;  4XSZ F;  2O6G E;  3S2D J;  2EZK A;  2UXN A;  2F4M B;  1XC5 A;  3GX4 X;  3WHC A;  1V3F A;  2EQR A;  2E1N A;  3HHJ A;  2R3S A;  1KU2 A;  3Q0V A;  4J00 A;  3R4K A;  2LMD A;  5E1Z B;  1ZHF A;  1OQY A;  2R5Z A;  1J5Y A;  2LOO A;  2K85 A;  1MDM B;  3H3V K;  3CUQ B;  2DK5 A;  4HDU A;  4P9F A;  1Z6T A;  1FX7 A;  4LK0 F;  3MVP A;  2R5Y A;  4AIJ A;  3C7J A;  3E1S A;  4HX8 A;  2JRT A;  5L3B A;  2JRM A;  2W57 A;  4G7Z F;  5BQT A;  1G0S A;  4EJU A;  1SAX A;  2FML A;  4P1W A;  3ZP5 A;  4MTD A;  5DDG A;  4KMF A;  3BC8 A;  2V6C A;  3AG4 H;  4CGZ A;  3TGN A;  4RS8 A;  1S6L A;  4QLC U;  1X51 A;  3VYT B;  4XRS G;  2COB A;  2ZB9 A;  1VQK I;  1O7L A;  3M07 A;  1U5T B;  1ZTR A;  3HEF A;  3K2Z A;  1VFC A;  3FXU A;  2DA6 A;  2BV6 A;  4NHJ A;  3HGG A;  2E19 A;  1STZ A;  2NS0 A;  2RKH A;  1IDZ A;  4E7J A;  1IN5 A;  2E36 A;  1X1P A;  3E6D A;  3X0I A;  4A3B J;  3F22 A;  4FT8 A;  3GTO J;  3I56 I;  3ASO H;  3H36 A;  5J4V A;  3ZMT A;  1V8R A;  1VQP I;  2K86 A;  1WJB A;  3WGH A;  5J1Y A;  3J80 Z;  3UNG C;  4BS9 A;  4S04 A;  3QPS A;  2DYS H;  2WBM A;  2GT2 A;  2XSD C;  1FP1 D;  4AIK A;  4A3J J;  4AD9 A;  1IW7 F;  1FBS A;  1GXQ A;  4KN4 X;  4L0Z B;  2VN2 A;  4ENJ A;  4CYC A;  3MFK A;  4DJA A;  1I27 A;  3JAM K;  5DEQ A;  4A0X A;  2X51 A;  3N4M A;  1JXS A;  2QGU A;  3FIS A;  3OYK A;  3BY6 A;  4XBF A;  3H9J A;  2CV2 A;  4C9Y A;  3W3C A;  2LF8 A;  4L9V A;  4Y52 J;  3LSH A;  5JVG F;  3C2G A;  2DMU A;  2LDU A;  2IRF G;  1G3S A;  3L7W A;  2P5V A;  4X6A J;  3A2K A;  2WY8 Q;  5B5E C;  4YG2 F;  4P9U A;  1UG0 A;  2K02 A;  5K7H A;  2E5Z A;  1MBJ A;  1Z3X A;  2CL3 A;  1X1C A;  4IJX A;  2BGC A;  2VBX A;  2Q8K A;  5F0H A;  5D6E A;  2DSD A;  2DMT A;  2VQH A;  1B6A A;  5FB2 A;  4C3H J;  2GQQ A;  3F8C A;  5DTD A;  3ZQQ A;  4KMU X;  1R1T A;  2BZT A;  3BR3 A;  3EQL F;  3M8E A;  3AKZ A;  3Q9V A;  1ZR2 A;  2O8X A;  2E2H J;  4YFN F;  3G3Z A;  1FC3 A;  1HOM A;  3DKY A;  5FKK A;  2AO9 A;  3JRD A;  4HST A;  3V42 A;  2X9D A;  3MDG A;  2AZW A;  2GA2 A;  1JHH A;  1JI8 A;  4WXD A;  3KEQ A;  4P55 A;  2VKD A;  2R7Q A;  1ZRF A;  3HOU J;  2Z99 A;  2Q2E A;  1XSB A;  4JZV A;  1UHM A;  4BAC A;  4RM2 A;  3CF2 A;  1P92 A;  2W4S A;  2Y31 A;  5M3M J;  2ZJP F;  1B4A A;  1PVE A;  1YE9 A;  5FLM J;  2OTJ I;  1BC8 C;  3BZC A;  1JGS A;  1SAU A;  4P96 A;  3CJT B;  3H5A A;  2D1V A;  3Q2T A;  1PUF B;  2L7F P;  3PL8 A;  1IXR C;  3SMD A;  1XSA A;  2PJP A;  1OCR H;  1RIO H;  3MKL A;  1WH7 A;  4C30 A;  2A61 A;  2LKX A;  2WAQ A;  4G7O F;  2J5O A;  2MD5 A;  3K4K A;  3KZZ A;  2RNJ A;  5C4X J;  3OYF A;  3EES A;  3FKI J;  3FK7 A;  3IH4 A;  3H5N A;  1MBE A;  1LDJ A;  2F4O B;  1Z7U A;  4RAY A;  2NVT J;  3K6G A;  2NRA C;  1AKH A;  3OR2 C;  1UAA A;  3UKG A;  1GLN A;  3NAU A;  1D0Z A;  3K4B A;  1YIT I;  2A07 F;  1TLH B;  2GXA A;  1GUU A;  1YG2 A;  2GXG A;  4KDP A;  2FMY A;  1V8S A;  5I8U A;  2TDX A;  1EKE A;  3VEP A;  2KRC A;  1ZGJ A;  1QRY A;  2QUF A;  1FYM A;  1DPU A;  2VON A;  3FIW A;  4XOT A;  2BY3 A;  2O9L A;  3L85 A;  4ETS A;  3OOP A;  2QZ8 A;  3O52 A;  5ICG A;  5JLX A;  4BY1 J;  2F5C A;  2IT0 A;  3CC2 I;  5BS6 A;  4PUS A;  2B0V A;  1HBX G;  2X0L A;  2FOK A;  5ILV A;  4XLE A;  3FMQ A;  3E5U A;  3HOW J;  4CCN A;  1HKQ A;  2IEK A;  3AG3 H;  4LMY A;  4RB1 A;  3ACA A;  1VK6 A;  2K9S A;  5D5V B;  4L9T A;  2LSO A;  2EV6 A;  1LE8 A;  2NVQ J;  1HCR A;  1V8T A;  2JVB A;  3OYI A;  4FE7 A;  4M3D A;  1I3A A;  2EFQ A;  3CCE I;  1ETO A;  2KDO A;  3S1M J;  3FDY A;  3GZ8 A;  3BG3 A;  1H8A C;  3K4M A;  1WVR A;  1XSD A;  1U9O A;  3HM5 A;  1BI1 A;  2IGN A;  2X6Y A;  2B2K A;  3I4N J;  5J40 A;  1OCT C;  1ZGW A;  2H6C A;  4HQM A;  4JZS A;  3ZQC A;  4HOB A;  3OSG A;  1SVM A;  4M6V A;  2BXZ A;  4PJL A;  1NG7 A;  3CUQ C;  3OYM A;  2F48 A;  3BT9 A;  4PJM A;  1TW2 A;  5ICE A;  2JA6 J;  5LLQ A;  3F6V A;  5BMZ A;  1MBF A;  3RYR A;  4QPO A;  1IF1 A;  1ON1 A;  2L9N A;  5L3G A;  4Y13 A;  1U8B A;  2MAB A;  1LDD A;  4TV7 A;  5IOY A;  4HNU A;  1MMD A;  2GAU A;  4LG3 A;  4ZTF A;  1LUJ B;  5M5X J;  1IN4 A;  5CPR B;  1DU0 A;  2HDW A;  4I76 A;  4M3B A;  2CW8 A;  2QQA A;  3S2H J;  1HST A;  4PZJ A;  4ZH4 F;  3QOE A;  4GFB A;  3DCF A;  5F1R A;  2XDV A;  2LKS A;  1OLT A;  1HW1 A;  1YOV B;  3K10 A;  2STT A;  2H94 A;  2KT0 A;  1H88 C;  5K1Y A;  2DMQ A;  2H6B A;  3DV8 A;  4KNY A;  1K6O A;  1IO2 A;  4ENK A;  4S2X A;  2PFB A;  2XAF A;  3PJR A;  3HKZ N;  1IC8 A;  1D1B A;  1FOK A;  3QP6 A;  2DA1 A;  4IJA A;  2XHK A;  3TDU C;  1K83 J;  2KDZ A;  1NG6 A;  1UHS A;  3NWT A;  5B1B H;  1U5T A;  1BJZ A;  2NOJ B;  2W84 A;  3Q0W A;  1W5T A;  1P7J A;  1LB2 A;  1G59 A;  1H9T A;  2NS8 A;  3HRT A;  2JPB A;  5B3S H;  1LEA A;  2CW7 A;  2VE9 A;  2V6E A;  2QJT A;  3VWB A;  3RJP A;  4RM3 A;  2F5V A;  2XAS A;  4HF2 A;  3ZMD A;  3DBR B;  1LDK B;  3FWE A;  1EV7 A;  5EDN A;  1K2E A;  2A8T A;  2LR8 A;  2MW8 A;  2HDD A;  3B6C A;  1Q27 A;  5CYV A;  5LFA A;  2MH9 A;  3O3K A;  3FX3 A;  4CH7 A;  3SEQ A;  4A3F J;  3HG9 A;  4PFP A;  1JKN A;  1POG A;  1XN7 A;  3TQN A;  3ZRG A;  1ULY A;  2BE5 F;  2M5W A;  3PSF A;  2VI6 A;  3VB2 A;  4GRI A;  2VOO A;  3LA7 A;  4NC6 A;  5FSM A;  3VSL A;  1RR7 A;  2ZKZ A;  5JFR A;  3CCS I;  1TUM A;  2ZXJ A;  4L0Y B;  2A8R A;  1KU9 A;  3SEZ A;  2LP0 A;  2ISZ A;  2VUM J;  3F13 A;  1Y1V J;  5FFZ A;  4EM1 A;  4XSX F;  2HYJ A;  3FHN A;  1T38 A;  2HQN A;  1FTT A;  1JGG A;  2I6K A;  3Q2S A;  5B66 C;  2XB0 X;  1PP7 U;  2FJ1 A;  4OU0 A;  4F93 B;  4XRM A;  2R5Z B;  2VPL A;  2L9V A;  4FE4 A;  2DYR H;  1QPI A;  4IQJ A;  2R7R A;  5CLS A;  3OYN A;  1VQ9 I;  4MEY F;  1TL8 A;  3BP8 A;  4M3E A;  1X1A A;  4ICK A;  2JSP A;  1PJR A;  3I9V 2;  4ESJ A;  3HHG A;  4CA0 A;  2R7D A;  3DXJ F;  1H9G A;  1Y6I A;  1S8N A;  3D5R C;  3IAM 2;  2XAH A;  2IS4 A;  4RLQ A;  2DLL A;  2Q9P A;  3BJ6 A;  4NC8 A;  2CS3 A;  4WCG A;  3HKZ A;  3I0T A;  5HOO A;  4G6D A;  3GFJ A;  4YEJ A;  1ZN2 A;  4ON0 A;  2XF6 A;  1YW8 A;  2KIQ A;  3LSR A;  5DM7 F;  3CME I;  3O6Z A;  3F9K A;  3HYI A;  1GV5 A;  2VIX A;  2CQN A;  2W1O A;  2IP2 A;  4PSW A;  5K5R A;  3JRE A;  1Z6R A;  1TC3 C;  1WFX A;  2RVC A;  1BI0 A;  4XKB A;  4DYR A;  4EGY A;  1BI3 A;  3OL3 A;  5IT3 A;  3V7R A;  2FNP A;  2HOE A;  1WKM A;  3BJO A;  1BR2 A;  1E3H A;  4QWQ A;  2F4I A;  4IHY A;  2HI3 A;  1TNS A;  2AQF A;  3N97 A;  1BW6 A;  2E60 A;  1V8N A;  4RGR A;  2DPU A;  2BHY A;  5IW4 A;  2QQ8 A;  2L5Q A;  3DU5 A;  5ILS A;  4KIT B;  2FX0 A;  4YII A;  2QKM B;  2HQA A;  4CIC A;  2GLO A;  3WTZ A;  3R03 A;  2EH3 A;  5GHP A;  3I4P A;  3S3M A;  2MH2 A;  4BL0 B;  5HS9 A;  3ABM H;  2HOS A;  1MD0 A;  4O3M A;  2YSR A;  2X85 A;  1MH3 A;  3GF2 A;  1PUN A;  1JE8 A;  4RGS A;  3S8P A;  5FJ8 J;  1LE8 B;  1HSJ A;  5D8K B;  4Y3O A;  2NYX A;  3Q91 A;  2G74 A;  1LVA A;  5M5W J;  2H8W A;  3DP7 A;  2V1D A;  5HDG A;  5GTH C;  3FSP A;  2QWW A;  1JUP A;  1JT0 A;  4KG3 A;  2P7C B;  4K2E A;  3V4G A;  2NVY J;  5EJC A;  2DAO A;  3G71 I;  3SZT A;  1Z7L A;  1OFC X;  2L7M P;  2QSG X;  3GWZ A;  2PJR A;  3F6A A;  4G9Y A;  1A6Q A;  4CCM A;  2CFX A;  2OZ6 A;  3TL4 X;  1R49 A;  1I9A A;  1WWX A;  1WJF A;  3CDL A;  2B0L A;  3IRR A;  3O69 A;  1IN7 A;  3LL7 A;  3COA C;  3JR9 A;  3TOA A;  1TTY A;  3QSJ A;  4BUP A;  5F0F A;  1JUM A;  2EFN A;  3ASN H;  4A3I J;  3KET A;  1PPV A;  2VKE A;  4KUM A;  3DTK A;  3IV5 A;  1R00 A;  1P4X A;  5D4R A;  5KCM A;  1U6G A;  1RUN A;  1BM9 A;  4ITV A;  4Z6Y A;  2Z3Y A;  3ZR8 X;  5GPA A;  1QQI A;  2JA5 J;  3JSO A;  4FAS D;  2VOP A;  3SHF A;  5L3E A;  3DKX A;  1MNM C;  1FMW A;  3LFK A;  3HTS B;  5E20 A;  1SVL A;  3F72 A;  2EZL A;  1NFZ A;  4ZDP A;  2JK3 A;  2IBD A;  1YRN B;  3COU A;  3FBN B;  5F04 A;  3J7A O;  2BVL A;  2M45 A;  2R7T A;  1PPW A;  3K9T A;  3L2Q A;  1QO0 D;  5DD8 A;  3O61 A;  1SD7 A;  3G1M A;  3M1E A;  1X1D A;  2V7F A;  4HZF A;  1YJW I;  2HFH A;  3HPG A;  4BYY A;  3MZH A;  5GHN A;  2HS5 A;  1HXD A;  1BW5 A;  4MPO A;  2L4M A;  4CO8 A;  1RKW A;  1U20 A;  1Z9C A;  4MO7 A;  2QBY A;  2KL4 A;  1GVJ A;  3OIO A;  4XN3 A;  2HXI A;  3CD6 I;  3WG9 A;  2I10 A;  3K1N A;  3KP2 A;  3CCV I;  1W5S A;  2GBY A;  4XOP A;  3GZ6 A;  2HVR A;  3MD2 A;  2OCC H;  5GHQ A;  3HHH A;  2N8G A;  3E57 A;  3I7V A;  3BTL A;  4I01 A;  4MLO A;  4DNC A;  2K3P A;  1FSE A;  1OCC H;  4I2O A;  4KA4 A;  3U2R A;  2W48 A;  3CO7 C;  5H6R A;  1Y56 A;  3Q0U A;  1ZG3 A;  1YX5 A;  4LLL A;  1RC9 A;  3K4L A;  2ZNY A;  3GCM A;  4B4C A;  5CQG A;  3C2B A;  2KMU A;  1VQN I;  5ANV A;  3V8K A;  3EUH C;  4L9N A;  5C3E J;  1SC7 A;  3IH3 A;  2ZME A;  2YVO A;  1GVD A;  2BW3 A;  2Z2S B;  2Z1D A;  4BEH A;  4D5F A;  1I3Q J;  1YLF A;  3ZXS A;  3KP4 A;  2VPR A;  1VQM I;  2DSC A;  2BW3 B;  2KHM A;  3LFU A;  2L7Z A;  1XS9 A;  3OYB A;  2FKB A;  4U0Y A;  5DV5 A;  5L3C A;  1G9Q A;  5GHJ A;  4D5C A;  2ZO4 A;  3I54 A;  1LQ1 A;  5IT9 K;  4DIQ A;  2ZSI B;  1QZY A;  4XKW A;  1X2N A;  1D8J A;  1WJC A;  3MWM A;  4JX6 A;  3OYJ A;  2IS1 A;  1VHZ A;  2DA4 A;  4XLF A;  3OSF A;  2E71 A;  1KU3 A;  3BR0 A;  3H35 A;  2IS2 A;  3GVA A;  3OYH A;  2W25 A;  4H0E A;  4UY8 I;  2LNB A;  2XKP A;  5F08 A;  3K4C A;  5EGO B;  2ELK A;  1OR7 A;  1TT5 B;  3Q5F A;  2FEZ A;  5F64 A;  5LEJ A;  1SFX A;  4UUS A;  1R5I D;  5GPC A;  3OYC A;  3ML6 A;  3SON A;  1DQU A;  1T98 A;  2R7O A;  4R8H A;  2E2I J;  3TDZ C;  2XRO A;  2Y48 A;  1UG2 A;  1YHQ I;  2WV0 A;  2NNY A;  4MNU A;  2HVS A;  2RQQ A;  4ESB A;  1JJ8 C;  5HDK A;  1YI2 I;  3A1Y A;  1S7E A;  2KQR A;  2CV0 A;  3GRN A;  3BZ6 A;  1R58 A;  3JRH A;  2P7V B;  2ACJ A;  4ZDO A;  3KZY A;  9ANT A;  1L3L A;  4JOM A;  3OIP A;  1OCP A;  3SZG A;  1I6X A;  3FF5 A;  4B09 A;  2Z16 A;  1HQC A;  1N77 A;  1MZB A;  5ANW A;  3R0J A;  1BI2 A;  3NRV A;  4YFK F;  3ROU A;  1JKP C;  1S7O A;  2L9S A;  2L9R A;  4B44 A;  2R7Z J;  4D0P A;  4C2U A;  3CO6 C;  3BTI A;  1E3O C;  3IHU A;  4IL6 C;  3GTG J;  2HXO A;  3KYD B;  3ZCO A;  2G7U A;  2CZR A;  1RKT A;  3GTP J;  2RAE A;  4BJ6 C;  2Y2Z A;  1BOB A;  3ERM A;  1Q33 A;  1X3W B;  1W1W E;  3K4N A;  4A3E J;  2DMP A;  2JN6 A;  1J09 A;  5D5U B;  1U78 A;  2WC2 A;  1T0F A;  2AQE A;  2GOX B;  2RC4 A;  3KZI C;  3R61 A;  1J59 A;  1U8R A;  4KIG A;  3WE2 A;  3EXQ A;  1PUE E;  1N25 A;  4ZYD A;  3ZQF A;  5J4Y A;  3HOY J;  2IA1 A;  3MCZ A;  3I59 B;  3LST A;  2YX4 A;  1XSX A;  4IZZ A;  4RB2 C;  2VQL A;  2HWV A;  2DTR A;  3TED A;  4LLN A;  1QPM A;  3DTI A;  1KQ9 A;  3LQQ A;  4CYC B;  3GWY A;  4UHT A;  2HR3 A;  1RRS A;  3UR3 C;  2NXN B;  3RKW A;  1LJ9 A;  4LB6 B;  3TO9 A;  4BHB A;  4BJT A;  2VBW A;  1VQ7 I;  4L18 B;  1T56 A;  3O2P E;  3CES A;  2IA0 A; 
#chains in the Genus database with same CATH homology
 5FRM A;  2HPI A;  2WAF A;  2XSJ C;  1LKX A;  2CUZ A;  3CNG A;  2WAE A;  1V8S A;  5I8U A;  1D0X A;  1KON A;  4XLH A;  4CCL A;  2KRC A;  2G73 A;  2YVP A;  4HSR A;  2B06 A;  2CV1 A;  4HVY A;  1V8V A;  4XKC A;  4ILQ A;  5FSN A;  1VIQ A;  4XOT A;  2A5W A;  3QYB A;  3L85 A;  3O8S A;  4CZC A;  2F6C A;  4KJZ A;  3OS0 A;  2RRK A;  3A6T A;  3O52 A;  4R79 A;  2LYC A;  4KT6 A;  5BS6 A;  3S93 A;  4PUS A;  3CP8 A;  2DT6 A;  4II2 A;  3AL0 C;  2B0V A;  4N1U A;  4Y33 A;  3K70 C;  1MK1 A;  1U0J A;  4XLE A;  4DBQ A;  1VRL A;  3RPU D;  2KDW A;  3P6Y A;  4CCN A;  5GHM A;  3LSI A;  2LH9 A;  3H9G A;  3HOT A;  1MMG A;  3ACA A;  4XR6 A;  1VK6 A;  3D5L A;  2JA2 A;  4NC7 A;  3FFU A;  2X6X A;  1T0F C;  4BQO A;  5HNH A;  3GG6 A;  3U53 A;  2LRE A;  1V8T A;  3X0J A;  1NQZ A;  5HLT A;  3OYI A;  2JVB A;  3P5T A;  2W82 A;  3PNV A;  2KDO A;  2DXI A;  1SJY A;  3FDY A;  3GZ8 A;  1F3Y A;  4E7L A;  2R7X A;  3K4M A;  3VYR B;  3RQ4 A;  3FCM A;  4XLC A;  2IGN A;  2ZSH B;  3DPL C;  2X6Y A;  4HEA 2;  4OWR B;  2A8Q A;  2B2K A;  2O5F A;  3GZ5 A;  4ZYA A;  4XMY A;  1ZEL A;  4JZS A;  4NFW A;  2K9M A;  3X0Q A;  2R7W A;  3J7A Y;  3EUK L;  2M7A A;  4PJL A;  1NG7 A;  2VQC A;  4PJN A;  3TMO A;  3OYM A;  4CCK A;  3AC9 A;  4PJM A;  1G8X A;  2MC4 A;  4J01 A;  3AFH A;  2VNP A;  4CSW A;  3LMM A;  4QPO A;  2L9N A;  1QHH D;  2XF7 A;  3DTE A;  4E6K G;  3FJY A;  4LIT A;  4EAT A;  2MAB A;  5HZX A;  4HNU A;  3MKZ A;  1MMD A;  2HPM A;  4LG3 A;  4ZTF A;  3X0R A;  5CPR B;  4J7H A;  2HDW A;  2CW8 A;  2IGO A;  1BR1 A;  4DBR A;  3LSM A;  1SU2 A;  3QOE A;  2VXD A;  3W2A A;  1PVF A;  4XON A;  4OAY A;  3VYS B;  2I8D A;  2XDV A;  3BCA A;  1OLT A;  1Z3Y A;  4ZTJ A;  3K10 A;  2XF5 A;  4AU7 A;  2LY2 A;  1K26 A;  2DSB A;  2X6W A;  3BLY A;  3EEU A;  2VQG A;  2K5C A;  3J7Y e;  1T95 A;  3OYL A;  1V8U A;  1YX3 A;  4S2X A;  5HVQ C;  2V4J C;  4ZC3 A;  2M0M A;  3PJR A;  3WHW A;  1D1B A;  2MD0 A;  2R5W A;  4E7K A;  2X1E A;  2M4G A;  2W00 A;  1NG6 A;  3NWT A;  2UWM A;  2NOJ B;  4XKV A;  1LVK A;  5IW5 A;  3G2B A;  2QKL B;  1PPX A;  3Q4I A;  3BG6 A;  1QU3 A;  1LFP A;  1G59 A;  1V8Y A;  3DWL E;  3OIQ A;  2OC6 A;  2CW7 A;  3HOS A;  4E7H A;  2V6E A;  2QJT A;  3VWB A;  4II3 A;  4U87 A;  3I9X A;  4RM3 A;  2F5V A;  3OOU A;  3SYT A;  3L2W A;  2E5N A;  2VLA A;  1LDK B;  2I8U A;  2A8T A;  1K2E A;  1X19 A;  1TZL A;  2CMP A;  1Q27 A;  5CKT A;  4HNT A;  2LY1 A;  5LFA A;  2Y0S A;  4CH7 A;  4F92 B;  3SEQ A;  3BHO A;  3CP2 A;  3HG9 A;  4PFP A;  1JKN A;  2GT4 A;  3ID9 A;  3M1C A;  3ZRG A;  5FRO A;  2ZXH A;  1AA7 A;  2M3A A;  3PSF A;  4GRI A;  1KT9 A;  1VHG A;  2XAU A;  3QYE A;  5FSM A;  1BR4 A;  2P0W A;  3VSL A;  4CCO A;  5GHO A;  2XC7 A;  2OV7 A;  2V26 A;  4KG4 A;  1TUM A;  2A8R A;  1WJD A;  1IRX A;  3SEZ A;  4B47 A;  2IGK A;  1V8L A;  3C2H A;  4XNF A;  3F13 A;  1V5G A;  4HPQ A;  3HXL A;  3DQV C;  3MMY B;  3OS1 A;  2LG4 A;  3FHN A;  4V14 A;  2I8T A;  1GA7 A;  2I6K A;  3RTR A;  3Q2S A;  5FSO A;  2VPL A;  4F93 B;  3D5S C;  3EPZ A;  3U21 A;  2PNY A;  5FSK A;  2YVN A;  3QYF A;  4IQJ A;  1PUQ A;  2R7R A;  2WB1 A;  5HNF A;  3OYN A;  3CMM A;  3PSI A;  2R4G A;  2VJ4 A;  4AYB A;  2VB6 A;  4IQ4 A;  3PFY A;  4BXF A;  1X1A A;  1ERD A;  4ICK A;  2JSP A;  5GHI A;  1PJR A;  3I9V 2;  4HRI A;  4DYW A;  3KEY A;  4CA0 A;  4NQW B;  5DD4 A;  1Y6I A;  1X1B A;  2IS4 A;  3D5R C;  3IAM 2;  4RLQ A;  1WJE A;  3IP4 B;  4B43 A;  3KVH A;  1MMA A;  2LBF A;  5FRN A;  2Q9P A;  4NC8 A;  2J8Q A;  2CS3 A;  3PNY A;  3HKZ A;  5ISY A;  2PMZ A;  2O5R A;  5HOO A;  4ANJ A;  4KTB A;  3HPH A;  4YPR A;  5LPG A;  2GB5 A;  4YEJ A;  1VZ0 A;  2R7U A;  2ELJ A;  2VJ5 A;  2XF6 A;  1NQY A;  3X0O A;  4C9W A;  3QOD A;  1RRQ A;  1S9H A;  4N4O B;  3DPU A;  1OW2 A;  3O6Z A;  3F9K A;  2W1O A;  2VIX A;  4PSW A;  4JZT A;  1N78 A;  3N05 A;  3RH7 A;  2LC2 A;  3KX2 A;  3W2V A;  4JZU A;  4PJJ A;  3OYA A;  4AVZ A;  2JVH A;  3OWT A;  3CJR B;  1WFX A;  2W7N A;  4HFQ A;  1XSC A;  3Q93 A;  4XKB A;  1P9Q C;  4LIU A;  3A4C A;  3OL3 A;  3Q1P A;  3HYQ A;  1E0E A;  2ZXI A;  4ZDL A;  3RCO A;  1BR2 A;  2ICJ A;  4F55 A;  2F4I A;  4PSX A;  2DHO A;  4KIS A;  3E0J B;  2AQF A;  2YYH A;  3A6U A;  3X0N A;  2CH0 A;  2L2O A;  4PK4 A;  4XLA A;  1JRK A;  5ANU A;  2E60 A;  1MNE A;  3MKY B;  1V8N A;  3DEE A;  2CUJ A;  4QPQ A;  5IW4 A;  4BQN A;  2HVQ A;  2LRD A;  3OL4 A;  2L5Q A;  3DU5 A;  1TT0 A;  1X84 A;  2M4K A;  4KIT B;  4YRV A;  2KDV A;  2X1D A;  4XL9 A;  5ANS A;  3GBG A;  5CQE A;  4FET A;  4E4H A;  2BOL A;  2QKM B;  2HQA A;  4F52 A;  4S2W A;  4BDY A;  1VC8 A;  3R03 A;  5GHP A;  2DJI A;  3S3M A;  1QVJ A;  1X4O A;  3TBI A;  4BL0 B;  3I3L A;  3AL0 B;  1HA8 A;  5JHF A;  1MP2 A;  2CFO A;  2UUZ A;  1KTG A;  4DGW B;  2X85 A;  3OS2 A;  2VXZ A;  3BG7 A;  4YEL A;  2RRE A;  2Q1Z B;  3W2W A;  1PUN A;  1DGR M;  3S8P A;  4E7Z A;  1N75 A;  3VSK A;  4Y3O A;  3CZ6 A;  4S2V A;  4KYX A;  1D1A A;  3Q91 A;  2G74 A;  1UEL B;  1V5E A;  3A6S A;  3KYL A;  3ZR1 A;  3H95 A;  3IUO A;  3FSP A;  2WAD A;  4KG3 A;  4BJ5 C;  2HZD A;  3ONQ A;  2PJR B;  3OYG A;  2VJI A;  3DUP A;  1Z7L A;  1W36 C;  4U7B A;  4BDZ A;  1VCD A;  2PJR A;  2JUG A;  4JQF A;  4XN0 A;  3RSN A;  1EA3 A;  3F6A A;  2IGM A;  4CCM A;  1RYA A;  4F91 B;  3TL4 X;  1D0Y A;  1I9A A;  2FVV A;  1WJF A;  3N9U A;  1X83 A;  3OY9 A;  2DCE A;  3G0Q A;  3K4J A;  2HNH A;  3O69 A;  2FUG 2;  5C7Q A;  3LL7 A;  2O1C A;  3A6V A;  4C2T A;  3QSJ A;  5CFI A;  2KZV A;  1D0Z A;  3X0K A;  2K9L A;  5KNL A;  4BUP A;  4Y4R A;  5DPK A;  5FSI A;  1PPV A;  1R6R A;  3FKJ A;  3DPT A;  5KHD A;  4ZG0 A;  1IRY A;  2IS6 A;  3DTK A;  4NUB A;  2KP6 A;  3X0L A;  2E1M C;  5KCM A;  3FK9 A;  4DOZ A;  1MMN A;  4ITV A;  3VYU B;  2V1N A;  2W4E A;  3ZR8 X;  4BGD A;  2XSQ A;  2UV1 A;  3OR1 C;  3ZGK A;  4K6E A;  3MDI A;  3EUA A;  2RNG A;  2A8S A;  4E7I A;  3DLA A;  4FAS D;  1W36 D;  4N4N B;  2VL8 A;  2V9K A;  1KHZ A;  2WA0 A;  1WJA A;  4NFX A;  3DKX A;  1FMW A;  3HHJ A;  5C8L A;  4J00 A;  2VNQ A;  1NFZ A;  4ZDP A;  2LOO A;  3COU A;  3FBN B;  4IKF A;  2M7B A;  1MQE A;  2X1C A;  3BCB A;  2BVL A;  2R7T A;  4D9J A;  1OR7 C;  1PPW A;  4BE2 A;  3L2Q A;  3O61 A;  2KLO A;  1X1D A;  2V7F A;  4BU2 A;  1V5F A;  3HPG A;  3E1S A;  5GHN A;  1Z21 A;  4MPO A;  4YOQ A;  3X0S A;  1G0S A;  1U20 A;  3S3N A;  2FML A;  5TGT A;  2KL4 A;  4G6T B;  4P1W A;  4XN3 A;  4OAZ A;  5DDG A;  3BC8 A;  4CUG A;  1MUT A;  4XOP A;  3GZ6 A;  2HVR A;  1X51 A;  3DU6 A;  3MD2 A;  3VYT B;  5GHQ A;  2A8P A;  2R7S A;  2IXS A;  3SDB A;  1VC9 A;  3X0P A;  1HZT A;  3E57 A;  3ZR0 A;  2MFZ A;  3I7V A;  4BQQ A;  1Q54 A;  3PNT A;  4MLO A;  2K3P A;  1X4P A;  1Y56 A;  1FMV A;  3FBI B;  4C9X A;  4ZJZ A;  3H5R A;  1YX5 A;  2ZFU A;  1PYV A;  3PUB A;  2BVM A;  3K4L A;  3M8J A;  4E7J A;  3SHD A;  5CQG A;  1SFK A;  2KMU A;  1MR2 A;  5ANV A;  3X0I A;  5LD2 C;  3EUH C;  2YVO A;  2BW3 A;  4NNJ A;  2Z2S B;  2Z1D A;  4BEH A;  3S3O A;  5BON A;  3ZXS A;  2E1M B;  3HUG B;  4HG2 A;  1NFS A;  2YVM A;  3X0M A;  3OMY A;  2DSC A;  2BW3 B;  2KHM A;  4XOR A;  1V8R A;  1WJB A;  3LFU A;  3MGM A;  3OYB A;  2FKB A;  2OUM A;  3UNG C;  4BS9 A;  3BAP A;  1G9Q A;  2WY7 Q;  5GHJ A;  2WBM A;  2GT2 A;  2MYS A;  4DIQ A;  2ZSI B;  3LSG A;  4XKW A;  1V8I A;  1MQW A;  1WJ5 A;  3K70 D;  1WJC A;  2IS1 A;  1DP3 A;  3OYJ A;  1SOI A;  1VHZ A;  4XLF A;  4DJA A;  5DEQ A;  2X51 A;  4BE1 A;  2JVG A;  3H35 A;  2IS2 A;  2KRH A;  3OYK A;  3OYH A;  3DKU A;  3H9J A;  4H4K C;  2CV2 A;  3K4C A;  4BEH B;  4C9Y A;  1SZ3 A;  2KPM A;  3W3C A;  3LSH A;  4RLF A;  3C2G A;  3OYC A;  3SON A;  1DQU A;  3A2K A;  2R7O A;  2WY8 Q;  1GLN A;  2QJO A;  3I7U A;  2HU9 A;  5FSL A;  1UG0 A;  4BE0 A;  2R7V A;  4E7S A;  3L2U A;  2HVS A;  1D1C A;  2RQQ A;  4PFO A;  2E5Z A;  1V8M A;  3HC7 A;  4LIV A;  1V8W A;  1Z3X A;  2VJJ A;  3A1Y A;  2CL3 A;  1X1C A;  2KQR A;  2CV0 A;  4IJX A;  3GRN A;  4F3Q A;  2Q2E B;  4XQF A;  2DSD A;  1VIU A;  2VQH A;  4ZDO A;  3ZQQ A;  5ANT A;  4D1Q A;  4JOM A;  2LBF B;  2A6T A;  3H0D A;  3AKZ A;  3OIP A;  1K6Y A;  3L2R A;  3SZG A;  4B3X A;  3BM4 A;  4YPH A;  1PUS A;  2Z16 A;  3DKY A;  1N77 A;  4HST A;  3V42 A;  5ANW A;  3MDG A;  2AZW A;  2DOA A;  2L9S A;  4B44 A;  1JI8 A;  4C2U A;  1HX3 A;  3OGA A;  4P5O A;  2VKD A;  2R7Q A;  4RMN A;  2ICK A;  2VAS A;  1R67 A;  3ZCO A;  4IX7 A;  5C7T A;  2CZR A;  2O5W A;  1Q33 A;  1XSB A;  4BJ6 C;  4JZV A;  1BOB A;  4BAC A;  4RM2 A;  3CF2 A;  3K4N A;  2W4S A;  2DT7 B;  1J09 A;  4XM3 A;  4S2Y A;  1DGW Y;  1YE9 A;  1SAU A;  2AQE A;  2GOX B;  3H5A A;  5CFJ A;  1MND A;  1QHG A;  3MCF A;  3EXQ A;  3Q2T A;  3CJQ B;  3NWS A;  3S32 A;  3PL8 A;  3N77 A;  4J7G A;  3SMD A;  2GOM A;  1XSA A;  1MW7 A;  3EF5 A;  2VKH A;  3MKW B;  2DUK A;  3OYD A;  4C30 A;  3OYE A;  2WAQ A;  3H9Q A;  3IAS 2;  3K4K A;  4IZZ A;  2L7K A;  2VQL A;  3OYF A;  4B48 A;  3EES A;  3GWY A;  3L2V A;  4CCJ A;  3DTI A;  2PQV A;  4N1T A;  3H5N A;  3VDX A;  1RRS A;  3UR3 C;  3LSK A;  4BJT A;  3HL2 A;  3K6G A;  3OR2 C;  1UAA A;  3CES A;  4X0G A;  3K4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...