2QKMB

The crystal structure of fission yeast mrna decapping enzyme dcp1-dcp2 complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
266
structure length
266
Chain Sequence
MSFTNATFSQVLDDLSARFILNLPAEEQSSVERLCFQIEQAHWFYEDFIRAQNDQLPSLGLRVFSAKLFAHCPLLWKWSKVHEEAFDDFLRYKTRIPVRGAIMLDMSMQQCVLVKGWKASSGWGFPKGKIDKDESDVDCAIREVYEETGFDCSSRINPNEFIDMTIRGQNVRLYIIPGISLDTRFESRTRKEISKIEWHNLMDLPTFKKNKPQTMKNKFYMVIPFLAPLKKWIKKRNIANNTTKEKNISVDVDADASSQLLSLLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords SPBC3B9.21 protein
publication title Structural basis of dcp2 recognition and activation by dcp1.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 80
structure length 266
sequence length 266
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00293 NUDIX NUDIX domain
B PF05026 DCP2 Dcp2, box A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1050 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2qkmB01
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2qkmB02
5GHNA 3EF5A 2FKBA 3ACAA 4JZUA 3HHJA 4S2YA 5FSNA 5DDGA 4KYXA 4DYWA 3U53A 1V8LA 2I6KA 3O52A 5HZXA 5IW5A 5GHIA 1HX3A 3I9XA 2O5FA 3KVHA 3GZ6A 4S2WA 3I7VA 5C7QA 3MDGA 2CL3A 3Q2SA 3FJYA 2DSCA 2B0VA 3X0PA 4YPRA 2DSBA 1MP2A 3F13A 3GG6A 1NFZA 2A8PA 1MUTA 1MQEA 1PUNA 2QJTA 2J8QA 3P5TA 5FSOA 5BS6A 2ICKA 3CNGA 3X0MA 1XSCA 5LPGA 2KDVA 1NQYA 1PPXA 4ZG0A 2YYHA 5DD4A 3FFUA 5C8LA 3X0SA 1VRLA 1X83A 3EESA 3X0JA 1SJYA 2YVPA 2QKLB 5FSLA 3BM4A 1RYAA 2A8RA 1XSAA 2O5WA 3E57A 5FSKA 3A6UA 2KDWA 2W4EA 4NFWA 4N1UA 5GHQA 3X0OA 2R5WA 2A8QA 1MQWA 1X51A 1V8YA 3ID9A 1PPVA 3O6ZA 4S2VA 5I8UA 2FVVA 1KTGA 1PVFA 3X0NA 1K26A 1Q54A 2QKMB 1SU2A 3X0IA 1XSBA 3MCFA 2A8SA 3RH7A 1VIQA 4NFXA 5GHPA 5ANVA 5GHOA 5IW4A 3N9UA 3OGAA 1RRSA 3A6SA 3GWYA 3L85A 1HZTA 3DUPA 1VHZA 1JRKA 2G73A 1K2EA 2QJOA 1TUMA 2VNQA 3Q91A 2DHOA 3R03A 4JZTA 4KG4A 4C9WA 3WHWA 1V8VA 5ANSA 4KTBA 3X0KA 3Q93A 1QVJA 2VNPA 3Q1PA 1VK6A 2B06A 4ICKA 3X0LA 1V8NA 2GT2A 3GRNA 3O8SA 4YPHA 2DUKA 4KG3A 2O1CA 3A6VA 3AC9A 5ANUA 3BAPA 5CFJA 2FMLA 1NFSA 3N77A 4C9XA 4HFQA 5GHMA 1V8IA 3BHOA 3X0QA 5CFIA 1V8RA 4K6EA 4YOQA 1JKNA 3GZ8A 5C7TA 5BONA 1V8MA 4S2XA 1PUQA 1G0SA 3GZ5A 1Q27A 5ANWA 1GA7A 2PQVA 3SHDA 4V14A 5GHJA 1VHGA 4JZVA 1R67A 3ZR0A 2A6TA 4IJXA 2Q9PA 3HYQA 5ANTA 2ICJA 2YVNA 3I7UA 1V8WA 2I8TA 1RRQA 2G74A 2I8UA 3Q2TA 1VC9A 3FSPA 3G0QA 3QSJA 3A6TA 1U20A 4HVYA 4N1TA 3SONA 3O61A 2AZWA 1KT9A 1KHZA 3MGMA 4JZSA 2JVBA 2B2KA 3F6AA 1PUSA 3DKUA 2A8TA 3EXQA 3H95A 3SMDA 3J7Ye 3MDIA 3ZR1A 1Q33A 1NQZA 2YVOA 5ISYA 1SZ3A 1V8SA 1SOIA 4ILQA 1I9AA 2RRKA 2YVMA 3FK9A 3X0RA 1X84A 2XSQA 3O69A 3P6YA 3COUA 1V8UA 1OW2A 5DEQA 1G9QA 1V8TA 1VC8A 3Q4IA 1F3YA 1MR2A 1PPWA 3EEUA 2GT4A 2GB5A 1IRYA 2PNYA 2DSDA 3FCMA 5FSMA 5FSIA 5DPKA 1VCDA 1MK1A 4MPOA 1VIUA
chains in the Genus database with same CATH superfamily
1S29A 2FKBA 3H3ZA 1FYLA 3RIRA 1LQ1A 1Y6IA 3I59B 2DPDA 4HBLA 1IV6A 4A3DJ 3DEUA 1B9NA 2PLYA 4YIIA 5D4SA 3V7RA 1ZRDA 4RAZA 1I3QJ 2M0CA 1ETXA 4A3BJ 1EJ9A 3IUOA 4A3EJ 3C2BA 4V2GA 2XGDA 4XORA 1NK2P 3AAFA 3OYIA 3FFUA 1S7AA 1SFXA 1ZRCA 2OTLI 1FX7A 2IGMA 1D3YA 1FBQA 1BM9A 2WB1A 4RAGA 1GT0C 5LEKA 2IA0A 1R6RA 2E71A 3UR3C 3HIFA 4BHPA 4KISA 2CQKA 2JA6J 1S7OA 1ZYRF 3ECHA 4EM1A 3KETA 2EFQA 2BHZA 5FD5A 1ULYA 4FX0A 4FT8A 2KJCA 1MH3A 4RAYA 3OIQA 3RJPA 4RDUA 1DGWY 5E1ZB 5FLXK 3WHBA 4HNUA 1UG2A 3DKXA 3CF5F 5IT3A 2PJRB 5ANVA 5ERIA 3GYHX 4GDFA 4ZZDA 3K0LA 4LK1F 3A6SA 1VQ5I 1F4KA 1YHQI 1U8BA 1K2EA 3ZQLA 1STZA 1XGSA 1PUEE 1FSEA 1Q1VA 1A04A 2R5ZB 2CYYA 2ZMEA 4NC8A 3DBLB 3U2RA 3HTSB 1I1GA 5KAFC 3CESA 2WAFA 2VOOA 2VXZA 5BQTA 3Q9VA 2V7FA 2R7ZJ 3JCUC 5GTHC 2Z2SB 3H35A 1WKMA 1OQYA 3I9V2 4BHCA 1FNNA 3OYGA 3GTPJ 1FZPB 2D2WA 4D7NA 3PIPF 1XSXA 3IL2A 2KT0A 1N77A 1XG1A 2A6TA 3RPUA 3MFKA 1J7KA 2BY1A 3GTOJ 2G74A 4BBRJ 2LY9A 1TWAJ 2V9VA 5F04A 5E8GA 1KT9A 4OAZA 1YRNB 2ID6A 2VL8A 3DKUA 1HW2A 2MABA 2MA3A 3BOQA 2DOAA 1BR2A 2L9VA 2Z5UA 2KHMA 3P6YA 3V4GA 1XDUA 3H0GJ 4KMFA 2MSYA 1R49A 3CJTB 4FHTA 2DA2A 4J00A 1V5FA 2UV1A 3Q4IA 1R23A 1OMIA 4OU0A 2XVCA 3I54A 4ZC3A 4B4CA 1T33A 2KJBA 4UUTA 5M3FJ 1SVOA 1J9IA 4JZUA 3W6JB 1GV2A 3HOZJ 4G7OF 4BGDA 1X2NA 1R5GA 2PX9A 3KZZA 4HSTA 2GAUA 3CC2I 2NS7A 1AHDP 1TW2A 5JR3A 3F8NA 4Y13A 3ROUA 2Y0SN 2TCTA 2IPQX 4GRIA 4BEHA 4HNTA 3AG3H 3PO2J 3WU1B 4G9YA 3ZP5A 1VQLI 3RTRA 2NXNB 2JA7J 2R0QC 3OYJA 2E1OA 2RC4A 2OZ6A 3BT9A 3SYTA 3OR1C 3GMEA 3I71A 1DQUA 2P6SA 3LFUA 4FQGA 4O3MA 1SJYA 1PVEA 2M30A 3F8CA 4JX5A 3OYNA 1HDPA 2M7BA 3AG4H 1Z7UA 2M0MA 3IRRA 4Z2YA 4Q47A 2DJNA 4XIDA 4IZZA 1BI3A 4LK0F 1CF7A 1MSFC 2A8QA 5FKOA 4IEJA 5E1WA 3QAHA 4GO1A 1XB4A 3M07A 2GXAA 1BN5A 1VNDA 2FA5A 4JK1X 3ONQA 3RKXA 3AG1H 3K69A 4XOPA 1LNWA 4Y17A 3HC7A 5CYVA 4HX7A 1BJAA 1IUFA 2H94A 2KLOA 5J3LA 2DA7A 5IW4A 3J80K 1YLFA 3R61A 3L85A 3HPHA 4EATA 2EPFA 2F6CA 1IJWC 4JBAA 3S93A 5FLMJ 2QCOA 2HVRA 2LRDA 4J7HA 2I8DA 2CFXA 2L2OA 4WXHA 4BL0B 3C2GA 2LD5A 3RCOA 4L0ZB 1R58A 3BJAA 3S2DJ 1TWFJ 4UVCA 1XPXA 1Y1VJ 1TNSA 2FNPA 4DBQA 1LB2A 4G6TB 4EGYA 3X0QA 2XAGA 2ZJPF 4BXXJ 5ANWA 4MO7A 5ICEA 1KU3A 1MGTA 1JT6A 3HOSA 2JPBA 2XSDC 2STWA 1SD4A 2NS0A 5F6FA 4RS8A 2VQLA 2XAJA 3ZR0A 4YFXF 3JRDA 3W6KB 4RB3C 2VUMJ 1JUSA 1F9NA 3Q2TA 2CG4A 2LFBA 2EFNA 3HEFA 3HRMA 2BXYA 3BR0A 2FF4A 1VQNI 3TOAA 2KIQA 3AFHA 4H4KC 3GF2A 3FKIJ 5CVIA 1P7JA 3P9IA 2CGPA 3S15J 1BR1A 4L9NA 4YIRX 3OMYA 1I9AA 1FWZA 2ECCA 1X3ZB 2R7RA 3KP3A 1ODDA 5J47A 3L2QA 3CD6I 1HLVA 2GB5A 2VT2A 1S6LA 3W2VA 2EINH 3V8LA 2O8XA 2OF7A 3M8EA 5E8IA 1YTYA 1VQOI 4B43A 2BY0A 4XLAA 5HNHA 4DYWA 3MZHA 3RZDJ 3MQ0A 4Y4RA 1B8IB 4QTRA 1EH6A 3PQJA 1T38A 2IGKA 2DJIA 3KPHA 4PUSA 3GTKJ 2XUBA 3DPLC 5LBQA 4YPRA 4M74A 5J4VA 2LVSA 4R79A 3RKQA 1MUTA 1YIOA 2A8PA 1KYZA 2BBYA 4KN4X 2EK5A 4U0VA 2RQPA 3ULQB 1Y8QB 5LGTA 5GPCA 2XKOA 3KEOA 4G6QA 4NC7A 4IHWA 1XTAA 4PCQA 4M3FA 1Z05A 3D5LA 1ZR2A 1IDYA 1G2HA 4KT6A 4MTDA 3WODF 3K1MA 4XLFA 1QHHD 2YUSA 5D6EA 5HVQC 3BTIA 3ID9A 2TDXA 2YX4A 4S2VA 2R3SA 2D1VA 3D1NI 2Y69H 3BROA 4RM2A 2V9KA 5ILSA 2HNHA 4LLLA 3VYUB 2K4JA 3BG3A 2PG4A 3WG7H 3M1CA 2VPLA 2ZCWA 5FROA 3R03A 1Q1HA 1VZ0A 1LE8A 4ZDOA 2LH9A 2BYVE 2GXBA 4S05A 2GA1A 5EYRA 2J5PA 1ZTRA 1NG6A 1VK6A 3D0SA 4CCNA 3JRHA 1QZZA 4UVAA 3X0LA 2DFEA 3DWLE 2CRGA 3PIOF 1UMQA 2O1CA 4WXCA 4JYKA 2QUFA 5JLXA 2XAUA 4UVBA 2QVOA 4CH7A 1E2XA 2L0KA 1SMYF 3ISPA 1XS9A 2EB7A 1WI9A 1I39A 4F7ZA 4WX9A 1J09A 4HEA2 1LPQA 1XMAA 1ZHFA 2X6OA 2COMA 3PUBA 3HRUA 1SD7A 4BBSJ 1DP3A 2M8GX 1BI1A 3GFMA 1XCBA 2ICJA 1ZRFA 2AHQA 4I76A 3K4CA 3G1LA 3I4PA 3P7NA 2LBFB 2JSPA 3CDLA 1R71A 1QVTA 4IHYA 1BOBA 1WSUA 3A01A 5ICGA 2OCEA 2E2HJ 1APLC 3FXRA 2L01A 3I56I 2ADUA 1SOIA 3CC7I 2YVMA 2E19A 2UWMA 2ISZA 1QZYA 3DU6A 4WK8F 2HOAA 2VE9A 4PSWA 4HZFA 1ETOA 4IVNA 2KZVA 4BAYA 2BHYA 4OOIA 2X48A 4O5VA 4LG0B 2IGNA 4L9TA 5DTDA 4A93J 1TT5B 2JJ7A 3ACAA 1JT0A 3FXQA 2HU9A 3RPQA 3Q3SA 1WJEA 1BI2A 4HX8A 1OCOH 2FOWA 3CCJI 1QU3A 5CVJA 5IOYA 1T2KA 3FHNA 1O3QA 2CMPA 2IP2A 3IAS2 3ABMH 2PMZA 3ZQQA 2W48A 1Z3XA 1IN5A 2G7UA 5H6RA 1K61A 2K9SA 1TBXA 3J7ZI 3F13A 2COBA 4QSHA 3VSLA 2HQRA 1MQEA 1PUNA 5M5WJ 4V19K 1MW7A 2JRMA 3I3LA 5B3SH 4B48A 4BQQA 2E7WA 1U5TB 2GA2A 2KQRA 1WCMJ 2BV6A 4HX4A 1MDMB 4HLXA 5EGOB 4ESFA 4A5NA 1T6SA 4J19A 3J7AY 4L5EA 4AUXA 3N4MA 2OQRA 3JRGA 2V4JC 5GHQA 1FBSA 1BC8C 4ZYHA 3S1MJ 3BR6A 5I8UA 4BY1J 1BW5A 2V6CA 2QKMB 2F4OB 4P55A 3JW4A 2HOTA 2A8SA 2RDPA 4ZH4F 3DPTA 3MWMA 4NFXA 1ZELA 2NAZA 2QQAA 3B6AA 3OSFA 2X85A 1HZTA 3OWTA 1JRKA 1QNTA 5FRNA 2V26A 3R60A 3DFGA 4NQWB 4YFNF 2PMUA 4ZYAA 1YE9A 4U0YA 4I0BA 3Q93A 1QVJA 2OCCH 4CA0A 2VNPA 4MIMA 2GM4A 2R4GA 4GGGA 4PSXA 3CP2A 2HXIA 1F5TA 3A6VA 3OYKA 3L2UA 1DU6A 3FK6A 2QSFX 3LQQA 3O3KA 5CFIA 2R7FA 1G4DA 1MBKA 1JKNA 3ZPLA 5LRRA 2NOJB 1PUQA 4QWQA 1YW8A 1S8NA 2ACJA 3S14J 1BR4A 3SHDA 2K9LA 3SFIA 4LD5A 3S16J 2CW0F 5D5XB 1MMNA 4XLHA 4I98B 3VDXA 4DOZA 4AIJA 3DEWA 4ESJA 5ANTA 1LUJB 5E3LA 3H3UA 1ZG3A 5F0FA 1W7PB 5E3MA 2DTZA 3GVAA 1HXDA 1TP4A 5F0CA 5EG0B 3DKYA 4JOMA 2K9NA 2LLKA 3GZNB 3BZKA 3DPUA 5AIQA 2XB0X 4NHJA 1OFCX 1IXRC 1YS7A 3ABUA 4E7HA 3K4JA 4LMYA 3ZN0A 2E35A 2MC4A 5K5OA 3H0DA 1FSHA 1JKQC 1LDDA 3H9QA 2QZ8A 2X6WA 4KJZA 1IV8A 4MNUA 2HOSA 1W0TA 5EEHA 1UZCA 2VQHA 3K6GA 4S2YA 4HDVA 4XBFA 2D5VA 2KRFA 3Q0WA 3DBHB 5TJJA 3A1YA 2DA5A 1IN6A 4LFUA 1D8JA 2KMUA 2DA1A 4DGWB 3I7VA 5LGUA 2EFWA 2LKSA 3DEEA 3WE2A 1WJDA 2FEZA 4U87A 3IHUA 3CUQB 5KHDA 1ETKA 2JMWA 3CJRB 1ACIA 3K4NA 4A5MA 4DZJA 4ESBA 5D8LB 1RRJA 1K83J 3LOCA 5K7FA 3V8KA 2E1MC 2XPVA 1P4WA 2QA4I 3FWEA 2KP6A 2F48A 1RIOH 1UHSA 2DK5A 4JX4A 1X1AA 3WU0A 5DS9A 5FSLA 1MBFA 3MKWB 1Z0XA 2A8RA 3DQVC 5CVVA 1OYIA 3M7GA 4B8XA 2EILH 1HCRA 2WBMA 3B73A 3OIOA 4EVIA 5K7ZA 4D5FA 1PPVA 2KPMA 2KIMA 2DPUA 3OYDA 4E70A 2DMUA 1RPWA 1B1BA 3IV5A 4CCMA 1D0YA 2VLAA 2ZMEB 2FX0A 3H9GA 1W4MA 5DM6F 2DMPA 4ZTFA 2Z3YA 2CV2A 2L7MP 3S1QJ 2DBBA 2KFDA 3N9UA 4Y33A 2HZTA 2CW7A 2K4BA 1VQPI 3HOVJ 2A61A 2JTVA 2WY8Q 1TUMA 1WWXA 3WTTC 1RZ4A 2DHOA 4AU7A 1IXSB 3WHWA 5E18F 5CPRB 1R22A 3PM1A 1KZHA 1O4XA 3I55I 1IO2A 2KKOA 4YRVA 3SEZA 2EV6A 4ICKA 3ZMDA 4R1HA 2J5OA 4EV0A 2M7AA 4BE2A 2DUKA 4PGGA 4EM0B 1WJAA 3WTZA 4WWCA 4AYBA 1OJLA 3KP4A 2DA4A 4OWRB 3TKYA 2CUZA 3J81Z 1LFBA 1A35A 4XRFA 3N97A 2EA2A 5CVUA 2VKHA 4C3HJ 1TC3C 2L9NA 2O61A 3CTAA 3HG9A 3MD2A 3W6VA 4Y7NJ 1V8WA 2RKHA 1FYMA 2R7VA 2I8TA 1RRQA 5HDGA 4AYBN 1SVLA 2M87A 3TDZC 4N1TA 3CF2A 3I64A 3CMAI 5HS7A 2PQ8A 5B66C 2JA5J 3EYYA 1OCCH 2Q2EA 2HKXA 1PUSA 2YVOA 5FLVA 2AXTC 2DW4A 2XSQA 3T0YA 2PN6A 4M6YA 4BJ6C 1NK3P 1G9QA 2QM3A 2LDUA 5BNGA 3LWFA 2XIGA 5FSIA 4FE7A 4FCYA 3ML6A 3VPRA 1YYVA 3FX3A 5FRMA 1MIJA 5F1JA 4BEHB 5KK1A 1Z77A 4NDLA 1O57A 1UHWA 2Y75A 1ON1A 2XF6A 2RNJA 2E34A 5GHIA 1JGSA 2K9MA 3F8BA 3KZIC 2CV1A 3RSNA 3JRBA 3BZCA 3KIOA 3UNGC 3S1NJ 4XL9A 1FTZA 2CS3A 2DSCA 3FK7A 4I7HA 3CCQI 4KICA 3ESWB 4MFEA 3QU6A 2ICKA 2H8RA 1CF7B 4IL6C 2FUG2 2XGEA 2KDVA 4M9SA 3TO6A 5HLGA 1NQYA 2YR2A 3E5XA 5LHHA 4ZG0A 3IKVA 4F52A 3D5SC 5B1AH 3BC8A 2LC2A 3QPLA 2JK3A 2ZC2A 3LL7A 2VJJA 3J81K 1W7PD 1X4PA 4ZZLA 3ELKA 1DU0A 2WAEA 3E0JB 3CCMI 3X0IA 2QQBA 3VEPA 4XN0A 1D8KA 1ON2A 5FJ8J 3EUAA 4P1WA 2OU2A 4Y52J 2QLZA 3L7WA 3TO9A 2BE5F 1SANA 3JRFA 3WG9A 3HHGA 4NC6A 3I58A 1OLTA 1A6QA 1D0ZA 2K5CA 4AIHA 2CQQA 2ELKA 2O6GE 2CJJA 3C7JA 4CGZA 3QOEA 1XX5A 2LY2A 1X4OA 3FXLA 1IRFA 5ILUA 2E5ZA 1V8IA 5EJCA 4Q4ZF 4FX4A 3BZ6A 4UUSB 1JKRC 2L7KA 2X4HA 3VB2A 5CJ9A 2H09A 5M3MJ 3MCZA 2WB1N 3QOPA 4HAMA 2LKPA 3C1DA 1KU7A 4KA4A 2VI6A 3F0CA 3H5RA 2Y48A 4A3IJ 2VOPA 1QVUA 2EQRA 2B63J 1T0FA 1VC9A 3FSPA 1R1UA 1GXQA 1KHZA 3R6SA 1IAWA 3QPSA 1MMDA 3BTJA 3M8JA 4XRSA 3SQNA 5ILVA 5ISYA 3QYFA 2YPRA 1K6OA 1IZ1A 3JTGA 4EMSA 1SD5A 3HHHA 2DLLA 3P5JA 4D0PA 5FFXA 3B02A 4BY7J 1BOAA 3BLYA 4HOBA 2F4IA 1S3JA 3ECOA 4H0EA 1BIAA 3BDDA 1DP7P 2BGCA 1MK1A 1U8RA 1J5YA 3IH3A 3PSIA 4LLNA 4I01A 2WAQA 1HA8A 4HDUA 4L0YB 3FXKA 4D1QA 4HV5A 5D4RA 4ZJZA 3J80Z 5DV5A 5HOOA 1B6AA 2EWNA 3ZMTA 1Z3YA 3PSFA 1S5LC 1KQ9A 1TTYA 2ZFWA 4A3FJ 3QRFF 3WTSC 3GTJJ 2R7TA 2XROA 2K3PA 3WHCA 4NB5A 3LNQA 1ORKA 1U9OA 2B0LA 3GLXA 4A0ZA 2YYHA 3PNTA 5BPDA 4PJMA 5ED4A 3EESA 3IH2A 4CYDA 4MEXF 4UB6C 2MH2A 2FBHA 1XDSA 3FISA 1ZK8A 4RA2A 4N4NB 3MVPA 2VJ4A 1LE8B 4DZPA 3KP6A 1KTGA 5J40A 3AG2H 1XSBA 4F91B 2VB6A 1UCRA 4J7GA 3HM5A 1MJBA 3HPGA 2R5YA 1J2XA 4A3CJ 1FOKA 2G73A 1V3FA 3X2QH 2VQGA 5JFRA 3OYAA 3TEDA 3F23A 2ZNZA 3FKJA 1BJZA 3TQNA 4EJOA 1W0UA 1H8AC 3X0KA 2EFOA 3DTKA 1MKMA 1R5ID 4YPHA 1HOMA 2VBZA 2DODA 4U7BA 2ESNA 5LD2C 4XONA 1NFSA 4I09A 2R7QA 4W1UA 1G8XA 4C9XA 4KIBA 2KL4A 1R1VA 2RV8A 3OS1A 3ASNH 1V8MA 2DT5A 2A5YB 1Q27A 2R92J 1GA7A 3A01B 1OYWA 2XASA 3GO5A 1LVKA 5GP9A 4XR6A 1V5GA 3LQRA 1PP7U 4GYGA 3ZQGA 1SD6A 4IJXA 4RLQA 5IP7J 1Z21A 2EV0A 2N8GA 4LLGF 1FTTA 3QSJA 2W82A 1RC9A 4IJAA 1JHHA 3A6TA 3RZOJ 4WCGA 1MNMC 1SFEA 3ASOH 3CO7C 4HSRA 2JVBA 2HYJA 2LOOA 2W25A 2ZFUA 2W57A 4XKWA 5F64A 3ZR1A 4ASNA 4YFKF 3LSHA 2R7OA 2IS6A 2ESHA 1UB9A 3P9KA 4BXUA 3GFLA 3O69A 1MNEA 3TL4X 4L5JA 1OW2A 2DA3A 4CYCA 2LTPA 4A6DA 3SDGA 4EEFG 5DM7F 1PPWA 2NVYJ 1IRYA 1R4MB 1X19A 4EJUA 2DSDA 2PNYA 2QQ9A 2EFPA 4UNOA 4KYWA 1RETA 3OL3A 3EF5A 2VQCA 5J8FA 3ZQIA 5IY5H 3HHJA 2PFBA 3GBGA 5DCMA 2Z33A 4DYQA 2ZJ2A 1J59A 2EZLA 2IGOA 2IW5A 4M73A 4M72A 5BPIA 3S8PA 1EV7A 3KCCA 4E7IA 4UB8C 5FKNA 2VC0A 4CUGA 2FMYA 3FXJA 1D5VA 3GG6A 1I6XA 1ZG5A 1KU2A 2L54A 2VKVA 1IGNA 3OYLA 1T0FC 3OYCA 1TZLA 2HYFA 3P5TA 2RAEA 5FSOA 1J0RA 1XSCA 5LPGA 3PFYA 4HG2A 2KISA 1IC8A 2VJIA 2ZBKA 4I02A 4U88A 4U0WA 1X2MA 3U21A 2YU9J 1IUYA 5L3CA 2E2JJ 1NHAA 3NWTA 1X3WB 4AWXB 5DYMA 4EGZA 2EIKH 3E57A 2PJRA 2OJED 2CFOA 4E4HA 2CQ7A 1WPKA 4ENKA 3HGGA 5K5QA 3GWZA 4B09A 1DPUA 1P2FA 2E2IJ 4F55A 2GIVA 3CCYA 1Q54A 4E7KA 3IKTA 3H5NA 1OCRH 5C4XJ 3K10A 5AIPA 4FTHA 4PK4A 1KGSA 1R1TA 1HSTA 1N25A 2IA1A 3OGAA 2FSWA 2GOMA 3LA2A 1OKRA 4HPQA 3QQAA 3MEXA 3AL0B 4OIQF 2Y9ZA 4KTBA 2L7ZA 4X1EA 4QLCU 3F6OA 4DIQA 2NVTJ 4XKVA 1TWHJ 3OYBA 2FMLA 1B72A 1E3HA 3KE2A 2VE8A 1V5EA 4K2EA 4IKFA 4K6EA 3BCBA 3GZ8A 3CCRI 1JGGA 4KDPA 3CJNA 3M8FA 4AM3A 3BQYA 1YRNA 2XDVA 3ABLH 1UJ8A 5J1YA 2OA4A 3HGYA 4BE0A 1HC8A 3W2AA 4HVYA 4I0AA 2WC2A 5CQGA 1JTYA 4F93B 4ENNA 5JLWA 1RR8C 4ABZA 2Y30A 2OD5A 1Q33A 3FXOA 2IA2A 3CDHA 3JR9A 1IW7F 3EETA 1Y1WJ 5EDNA 1QRYA 1X84A 2H1LA 4S0HB 4AVPA 1YJ9I 1T56A 1XD7A 2L7FP 2VC1A 2HKOA 2A68F 1VC8A 1G3SA 1PYVA 3E6MA 1KYWA 1D1AA 2IS1A 2GT4A 3BTLA 4RM3A 4FE4A 1W5TA 4M3DA 1UFMA 1ERDA 3IH4A 1FP1D 3HJEA 4UV8A 3IAM2 2HTSA 1HDDC 2DI3A 4CZCA 4BKXA 5DDGA 3HZJA 2M4KA 3RKYA 1FIPA 3VYRB 4OIRF 3EPZA 5IYCJ 5LLQA 1J75A 2GLOA 5E20A 4EM2A 3H36A 1D5YA 1P4XA 3RYPA 2VKEA 3V42A 3KZYA 2X1CA 3SXYA 4E7LA 4C3JJ 1L0OC 5FKKA 2OQGA 3GFIA 3CO6C 4BUPA 4BDZA 2OTJI 1PPXA 3ZMVA 4II2A 5J4YA 3L09A 3X0SA 2P0WA 1B59A 1YW9A 3R0JA 3BR1A 3ABKH 3FBIB 2JZYA 4XRSG 1GUUA 3FZVA 3LSPA 4A3MJ 1R5HA 2Z9OA 3M1EA 5CKTA 2XF7A 4EJWA 3FHZA 2HOEA 3BR3A 3WU2C 2VASA 2GXGA 1YG2A 3ZRGA 3TP3A 1K26A 1YQAA 2IBDA 5IOZA 5C4JJ 3MCFA 5E3NA 4D9JA 1MH4A 4MHGA 1DUXC 2MLKA 4KNYA 1R7JA 3KP5A 3WGGA 2H6CA 2OBPA 2HWVA 4CO8A 2IXSA 2JN6A 3HUGB 3LAJA 1VQ6I 5ANSA 3CQZJ 4I99C 2PMZN 1FLIA 3Q1PA 3ZN1A 1H9GA 5JI6A 1ZARA 4XNFA 4KG3A 2K27A 3T1BA 2K7LA 4UUVA 1IDZA 5DUIA 1AOYA 5C7TA 3LSIA 3CCSI 4IPAA 1XCVA 4J01A 2NVXJ 2Q2EB 2A6EF 3OV8A 4BACA 1T08B 4XK4A 5JVGF 1TLHB 5FD6A 3F72A 3HOYJ 2LP0A 2XSJC 2GBYA 3KP2A 3MMYB 2JVHA 1ZGAA 4RGSA 3O61A 2QENA 5D8KB 4BE1A 2AZWA 2NOGA 5GTIC 4IX7A 3OSGA 3HSFA 2G9WA 3JTHA 4HF0A 5H20A 3CMEI 5B5EC 3E3VA 1OISA 2FQ3A 2VBYA 2MFZA 1TQPA 3DKWA 3PL8A 5GPAA 5HLTA 3ZOBA 3TP0A 4Q48A 5M5XJ 5F1RA 2VT3A 1QGPA 4G6DA 3COAC 1P4AA 2E7XA 3WTYC 2O8KA 2M9HA 2VJ5A 1B8IA 3KP7A 2X6XA 2EZKA 3HTUA 2AS5F 2CZRA 2HDDA 1ZKGA 2DT7B 3CCLI 1VCDA 2K3FA 4N9IA 1Z6RA 1X1BA 3J7YJ 2V1NA 2XF5A 1E3OC 5C44J 3QWLA 4ZYDA 3GZ6A 1YOVB 1FT9A 2RVCA 5C7QA 2R7WA 3CC4I 4UV9A 2W1OA 1GDTA 1FOWA 2NVQJ 2B0VA 1L3LA 3RYRA 2XAQA 2DSBA 1HQCA 2HS5A 2O7OA 3HKZA 4RLFA 4AIDA 1G3YA 3S3MA 2UXNA 5KCMA 2LKXA 1U3EM 3BJ6A 2IS4A 1Z6TA 1FMWA 2VKDA 4HF2A 1SC7A 4IQ4A 1JHFA 2HVQA 3OR2C 1S9HA 3O8GA 3RDIA 2MLGA 3TBIA 1FYKA 3I5UA 1IF1A 1K79A 3HKZN 3E1SA 3FMRA 1Z1DA 3TOBA 1JE8A 2WA0A 1C0WA 4NFWA 1A6IA 3ZGKA 4DJAA 2YS9A 5LHGA 2V79A 4GYIA 3HOWJ 1O3TA 4CCOA 3H1CA 2LF7A 3LMMA 4BQAA 3I4MJ 4C3IJ 1MJAA 2LMDA 4N9HA 2EIJH 3O8HA 2DFHA 5F27A 2E36A 3GX4X 2DYRH 2EZHA 3W3CA 1ZREA 4Q5SF 3E7LA 1DGRM 2HQ5A 5C8LA 1CQTA 2QBYA 2DOFA 3KYLA 2QGUA 5JHUA 2B9SA 1SFOJ 2A6HF 1VQ4I 3FIWA 2JA2A 1O7LA 1V8NA 1EKEA 3HL2A 4PJJA 4M6XA 5CFJA 3NARA 2BY3A 1N78A 2RQQA 3Q5FA 1VQ9I 3QP6A 5BONA 4GFBA 4RGXA 2YSRA 3FM5A 1ZGWA 2V9PA 3CJQB 1YI2I 3TGNA 3PNVA 1HSJA 3SZPA 1XGNA 1WRJA 1UAAA 2DMNA 3K2AA 4XSXF 3GLLA 3LSTA 1MZBA 2DU9A 1QO0D 1IXCA 2B2KA 3H95A 3SMDA 1Z9CA 1AKHA 3FDYA 3WTXC 1QBJA 3F8MA 2ZKZA 4LG0A 5IP9J 1TWCJ 1V8SA 3F9KA 5L3FA 2YX7A 5CVRA 1ZGJA 1JJ8C 3T5XA 1VQKI 4DYCA 2X9DA 3COUA 2XRNA 2A69F 4BQOA 5LEJA 1A31A 3EUKL 3TO7A 3HYIA 3IP4B 1MR2A 3BG5A 1BC7C 1H89C 1OR7C 1H9TA 1WJ5A 4RMNA 4ON0A 2LNBA 1YJWI 5A2QZ 1NH3A 3BQZA 4DYRA 3K1PA 1WJCA 5F0HA 2QEXI 3O52A 2I6KA 5EF6A 1HX3A 2XPUA 3QP5A 2FD5A 3OYMA 1USSA 3RQIA 3ZXSA 3G1OA 3HRSA 1MDMA 3X0PA 3DU5A 2DOEA 2HI3A 2DDBA 4PFOA 2DA6A 1WVRA 1RESA 3F22A 4UXNA 2FXAA 5EGOA 4C2TA 1MP2A 1YIJI 1XMXA 2P81A 2ME6A 2BVMA 4MLOA 2Y2ZA 3F21A 3NWSA 2K02A 1ITYA 3GW2A 3DTEA 1V55H 4IRHA 4S04A 2HZDA 1ETYA 1G6NA 1SAXA 4BNCA 4C2MJ 2YVPA 4UY8I 2HR3A 3BM4A 1IG7A 1RYAA 5F08A 2BY2A 2FOKA 3NRVA 2BOLA 2Y31A 5K5RA 1RUNA 2KDWA 4V2FA 4AVZA 2PJPA 1MQWA 3HSEA 2FVVA 1ETVA 4NQWA 2DDAA 1ZN2A 3HXLA 2L4AA 3H3VK 3PO3J 5GHPA 1TT0A 1I50J 2EV5A 2KRHA 1ZLJA 1S7EA 3GWYA 1ENHA 2RN7A 2X1DA 4NNJA 3QODA 1U2WA 2ZNYA 1WQ2A 2M45A 4PFPA 4RB0A 2A3SA 1QZEA 5BMZA 1KU9A 1HKSA 4HNVA 5HS9A 2QQ8A 4AIKA 3K1NA 1RUOA 3O8SA 2FBKA 2TRTA 2LF8A 2L9SA 5B1BH 3G4SI 3K9TA 1FEXA 2CW8A 1T98A 3JRAA 1W7PA 5A2QK 3CMYA 3E6BA 1SFUA 4WF2A 2L5QA 5EG0A 2QSGX 3EYIA 2OZUA 1U0JA 1G3TA 1TWGJ 1EA3A 1JTXA 2WTEA 2EBIA 4JQFA 3G0QA 2VN2A 4CYCB 2HTJA 1HKQA 1RR7A 4ENMA 4IF4A 2A8TA 3E6DA 1QPMA 3WTVC 2UZKA 4HF1A 4A69C 3DTIA 1I6HJ 1X58A 4E7ZA 5BOXA 2R93J 5LFAA 1IN7A 1TW3A 4KUMA 4KMUX 3EUHC 5DCMB 1VQ7I 1HKTA 1TQIA 1Y39A 1QA6A 5DCFA 5KNLA 3D5RC 3VOEA 2L3DA 3NQOA 4QIWN 3M4OJ 1MD0A 3A2KA 1EF4A 3G2BA 3OYHA 3MKZA 1K78A 3CUQA 3S2WA 4KYXA 3L2VA 2LR8A 4ITVA 3HSRA 4F3QA 4IHSA 2O5FA 2NS8A 2Y9YA 4S2WA 3F8FA 1R4NB 2E60A 4OIPF 3Q2SA 3F3XA 2WADA 2HGCA 3QYBA 4L5IA 3CMMA 2LY1A 4KIGA 4NUBA 2XB5A 4IQJA 2DQRA 4OAYA 1HW1A 3LA7A 1W5CC 1K4TA 4IRIA 2OV7A 5DUKA 1YX3A 1ZAOA 2GZWA 2ELJA 1RKWA 2LK2A 3FMSA 2DN0A 3E5QA 3TMOA 1VRLA 1JKPC 4N0BA 3MKYB 3BG9A 3G73A 2EH3A 2OPTA 1XSAA 2HFHA 2MC3A 2O5WA 2QYOA 2IVMA 4E7JA 3VWBA 5FSKA 4HV6A 1IRGA 2F5EA 2HQAA 3ERMA 2W4EA 2PI0A 2ZJQF 2B7EA 2O0YA 2W84A 1YO5C 1X51A 2R7DA 3EDPA 1SEUA 3X0NA 1PVFA 2LG4A 3RPUD 3K4BA 5LGNA 2ZJRF 2MH9A 2V1DA 3HOTA 2WAQN 4CXFA 1ZH5A 3KLOA 3ERED 2DCEA 2KZGA 1NG7A 3K4MA 3U9GA 2BW3A 1B72B 4JP0A 4D5CA 4HLYA 2QJOA 2IEKA 3A0HC 2KIFA 1U5TC 2RREA 1D0XA 4A3JJ 4LOCA 2O03A 1WI3A 5EEAA 3DBRB 3V7SA 3VODA 3FXUA 3NAUA 5HS8A 1WH5A 1ETQA 4XSZF 3IWZA 2BEOA 4LG3A 4IO9F 4Y15A 3SZGA 3HB9A 4YG2F 1FY7A 1MBHA 1YW7A 2CH0A 4L9VA 4YEJA 2PEXA 1OPCA 5HODA 4DW6A 2ID3A 3I4NJ 3LAPA 5D5UB 1G0SA 1KONA 4XOTA 4E6KG 2CWEA 2EIMH 5HLHA 3GXOA 1YITI 5GHJA 2BXZA 3FM3A 2Y0SA 1BIBA 1Y8RB 3CCVI 2R7UA 2YVNA 4FASD 4OMYA 4MQ9F 3A4CA 1B9MA 3M9AA 3NEUA 1OYYA 3VYSB 1W36D 1LEBA 4OMZA 1PP8F 3MGMA 1HBXG 2CU7A 1QHGA 4IOCF 3S2HJ 1XN7A 1IRXA 5L3DA 3H5AA 1KA8A 1GVJA 1YFHA 3T8TA 2MD0A 3S1RJ 1VTNC 5IT9Z 2EJRA 4IXAA 1P6RA 2QF7A 1IRZA 4OIOF 3LFKA 2E1MB 2JPCA 2VBWA 2DT6A 4A3LJ 5FSMA 4R8HA 5HNFA 3L9FA 4AD9A 1PUFA 2K40A 3SZTA 2FQ4A 2XC7A 2UUZA 1HF0A 1WHUA 4EJTA 4D7MA 2L4MA 4CCLA 2P5KA 2XRLA 2HDCA 1V8LA 3BCAA 2CSOA 5H6QA 4XQFA 1RI7A 2HVSA 2NNNA 2XGCA 2XAFA 2VODA 2M34A 4I2OA 1LJ9A 2KDZA 2J8QA 5K1YA 3KLNA 1X1PA 3LA3A 3BPVA 3I59A 2ZXWH 3O2PE 5L3BA 4CCKA 3L2CA 3T8RA 2ZSHB 1T8IA 3U1KA 5GAHJ 4RGUA 2MBFA 2GQQA 4LB6B 3TDUC 5D5WB 3CDIA 1DDNA 5CLSA 1CGPA 3HDDA 1I3AA 2MYSA 3O6BB 4C2UA 1LFUP 4LITA 1MMGA 1Z67A 2DYSH 3V7CA 3A6UA 2Z1DA 3WE3A 4A0YA 1BW6A 3X0OA 1F43A 2R5WA 3WTWC 3GTMJ 2HYGD 4A2UA 1MBJA 5TRDA 2F4MB 5EZGA 4A12A 1R36A 3ZMZA 4X0GA 2R7SA 5E79C 1AU7A 1E3PA 5M5YJ 1VIQA 3CUQC 1FMVA 1RRSA 3GEZA 1X3UA 1Y56A 5DD8A 4CHUA 2JWTA 1VHZA 2XHKA 4KG4A 4KIFA 2M8EA 3QPTA 3S32A 5E3OA 2VNQA 4C9WA 4M71A 4UUSA 2F5DA 2K85A 4G7HF 2E5NA 3OOUA 3SEQA 1A5JA 2IRFG 2MW8A 3BJOA 3K2ZA 1ZG1A 1AWCA 5EEGA 3C3WA 1K4SA 2A5WA 2IT0A 5IT9K 2GT2A 4L18B 2L02A 3Q9SA 1YX5A 4W97A 3KYCB 4ZYGA 4P9UA 4PZJA 3U1DA 3IRQA 4KFCA 1W5SA 3SFZA 2JT1A 1GV5A 4BHBA 1MBGA 1GHCA 2BVLA 5IPAA 3PNYA 4B44A 2R5ZA 2IAIA 4ZYEA 4G94A 4JZVA 2ZMEC 4MFDA 1POGA 2XKPA 2M1BA 5KVRA 3A03A 3KYDB 2HPMA 1M1EB 1BI0A 2DXIA 2NVUB 5FKLA 1Z91A 4X6AJ 4YELA 1U20A 1MNDA 3S3OA 3BY6A 2HEOA 6PAXA 2LSOA 2ECBA 1JUMA 4BJ5C 2ME0A 3BP8A 3EXQA 3R0AA 3MDIA 4ENJA 2W00A 2JSCA 4A3KJ 2PBIA 2P5VA 2RRKA 5FO5A 2VIXA 2ZO4A 3ZQCA 2MG4A 3SJMA 4BQNA 4Z6YA 5J1UA 4OINF 3P9CA 1QPIA 5LRSA 2AQFA 3REOA 2V6EA 3JSOA 2K86A 2DAOA 2F5CA 2A07F 2D45A 4MEYF 1ETWA 4KN7X 3L2RA 5DPKA 1WH7A 4B3XA 2CUFA 2I5UA 5ICFA 4ZDLA 1XSVA 3DLAA 3VYTB 2KDOA 5JHFA 1RKTA 2HXOA 1F36A 5IYBJ 4ANJA 1PJRA 4PDKA 1P92A 2Q8KA 4XLPF 3GTGJ 2ZB9A 5IW5A 2F5VA 5HZXA 3JRIA 4GXOA 1JJ6C 2D1HA 3N05A 1Y0NA 2RGVA 3DP7A 2CL3A 1VI0A 3M3YJ 2DFIA 2P7VB 3S3NA 4CSWA 5E1XA 1JUPA 2STTA 1WGXA 3H9JA 2EZIA 4QPOA 2P5LC 3OYEA 5BS6A 3ABTA 1I1SA 3CNGA 3OS0A 3OIPA 1SFKA 2NNYA 3CZ6A 3K70D 4BYYA 1I5ZA 3KFWX 3BR5A 3CUOA 4HYEA 5HDNA 1W36C 4A3GJ 2KRCA 2QKLB 5D6FA 1G59A 5L3EA 5AONA 4PJ0C 1IN4A 4XN3A 4N1UA 3K7AJ 2BZTA 2QBYB 3F6VA 2Z16A 5EZHA 1FJLA 2HDWA 1V8YA 3O6ZA 2LREA 2VONA 4JX6A 1G3WA 4WXDA 1QQIA 3E6CC 1GXPA 1ZLKA 3I53A 3QPHA 2FNAA 2H8WA 3ZMUA 5ICCA 3H92A 3MZ8A 3BG7A 1ONVA 1ZR4A 2Q1ZB 3DUPA 3E5UA 1O7FA 3Q91A 2P8TA 3HRTA 1X1DA 1FPQA 3LSGA 4BH9A 1LFPA 3VSKA 3EQLF 2LYCA 5ANUA 3N77A 1TNTA 1WFXA 4HQEA 5GHMA 3SDBA 3DF8A 4FISA 5FKMA 4A0XA 2M3AA 5FB2A 3WGIA 2G7HA 2NYXA 5GAGJ 5J1RA 3UKGA 4XRMA 1R9TJ 3J7AO 1AKHB 2X6YA 1ZQ3P 2M2EA 4L9JA 4LIVA 5JVTA 1JKOC 2Q9PA 1WJFA 4EJVA 3C2HA 5C3EJ 1JI8A 2WY7Q 4IHXA 1S72I 5E17F 4M3GA 2I10A 2QWWA 2YU3A 1OR7A 2GIZA 2O5RA 2ELHA 2ZXJA 1PDNC 2AQEA 2Q0OA 4XICA 1NQZA 4ZTJA 4F92B 2UXXA 1KQ0A 3PFIA 2FJ1A 1Y0UA 4PJNA 4ILQA 3ZQ7A 3FK9A 2X1EA 2CQXA 2CO5A 2H6BA 1BBYA 2O9LA 2K9QA 1MMAA 5DEQA 4RB2C 4BS9A 1V8TA 2JUCA 4KT5C 1DPRA 5H2FC 4HQMA 1F3YA 1GVDA 3PQKA 5GADJ 1EH8A 3FCMA 3CCEI 4CCJA 2H1KA 1EH7A 2XGXA 2XAHA 4M3EA 3G71I 4BDYA 5GHNA 1REPC 4BJTA 5FSNA 3S17J 1MMSA 4IRGA 1VQMI 1USTA 4B47A 4LGWA 2E1CA 4C9YA 4XM3A 1D1CA 2OUMA 4FETA 1BA5A 3BPXA 5KAIC 3I0TA 1NFZA 1W1WE 3A02A 1RNLA 3VFZA 1K6YA 3X0MA 1YJNI 3IC7A 4UHTA 1H0MA 2AO9A 1FP2A 3DLLF 3PJRA 1IN8A 3KX2A 1X83A 3LSKA 3ZQHA 9ANTA 1JXSA 4LB5A 2ISYA 4XLNF 1MJ9A 1Z7LA 4RB1A 3LSRA 2WWYA 4BU2A 1VF9A 4CDGA 2X51A 1MSEC 4XKBA 3OS2A 3CLOA 3Q0UA 1LDJA 5J8CA 3TW7A 2W4SA 2FU4A 1SU2A 3LSJA 1YS6A 2O3FA 3RH7A 2XPWA 2VXDA 2AXLA 4IOAF 2VBXA 5FFZA 1T39A 2JA8J 4JZTA 1GLNA 3KEYA 1O3RA 1V8VA 2JUGA 1FBUA 1U9NA 4M3BA 3FXMA 2DO7A 2Z99A 2DMTA 3WTUC 2B06A 2OC6A 5HLIA 3GRNA 4HW0A 3BWGA 1WZ2A 3FBNB 4NBQA 3BAPA 2GWRA 1P9QC 3CP8A 1BL0A 3QU3A 1K7AA 1V8RA 1WJBA 1H88C 2JQ7A 2M4GA 4KITB 1D1BA 2PQVA 5TISC 4V14A 2G0EA 3DCFA 3B6CA 4GCVA 4HRIA 4RGRA 1LDKB 3K70C 3ZMSA 1A36A 3EUHA 1O3SA 1AA7A 2X0LA 2L9RA 4P5OA 2W7NA 3HOXJ 1XGOA 4M6VA 2OAZA 3L1PA 4XMYA 3FMQA 3JSPA 1U78A 3JAMZ 2DK8A 2KIUA 4A6EA 3K4LA 2NRAC 3HBLA 4LJZF 4QPQA 1FOXA 4EQQA 5HDKA 3RI4A 1XC5A 1K78B 1UELB 1FOYA 3G1MA 1V8UA 2F5FA 1P7IA 2LBFA 1FIAA 3BTCA 5IP6A 4BXFA 4C30A 1V4RA 3A0BC 2PMHA 4YIFA 2CUJA 2CQNA 2DTRA 1XMKA 4LIUA 4P96A 3OL4A 4ZDPA 1VIUA 4MPOA 1XGMA 3L2WA 3MKLA 3JREA 2FRHA 2P4WA 2W85A 2ZSIB 1OCZH 2W24A 3G3ZA 4DBRA 2CV0A 2V1UA 3R4KA 3U53A 3IWFA 2E1NA 1E17A 4Y3OA 3W2WA 3I9XA 3KVHA 2MD5A 4PGHA 2FBIA 3MDGA 3CCUI 3FJYA 3MZYA 3GUDA 2M5WA 3PUFA 4M9XA 2CUEA 3DV8A 2HPIA 1UHMA 3LSMA 5J6XA 2QJTA 2FE3A 1N75A 3JRCA 1LEAA 3C18A 3KEQA 5DD4A 2ETHA 1LVAA 1SVMA 3TW6A 5FGMA 2JVGA 3X0JA 2ZXIA 1XSDA 4B1RA 1NTCA 1LKXA 4B3AA 4MGRA 3GTLJ 2BW3B 4XKCA 4AC0A 3GCMA 4RBOA 1TL8A 1U5TA 2WV0A 3DXJF 2WV1A 3HUGA 3Q0VA 3SHFA 4E7SA 4TV7A 1I27A 3ZQFA 1R00A 2P7CB 2GOXB 2QSHX 5GHOA 2V1XA 2ZXHA 1TQMA 2DMQA 4M9ZA 3JAMK 5D5VB 4IHTA 4G7ZF 3WGHA 1MBEA 3GTQJ 3FF5A 4U7DA 2C6YA 4CZZA 3QYEA 3OYFA 3L00A 4XLCA 2MGQA 2R5YB 1SAUA 3AC9A 3CLQA 2HQNA 3MN2A 4HFQA 3OY9A 3BHOA 3E97A 4PJLA 3G6EI 4YOQA 4S2XA 5TGTA 3GZ5A 3V8JA 4G8XA 1F1ZA 3ZCOA 4DQ2A 5GAEJ 1OCTC 1V54H 3RKWA 1FC3A 1VHGA 1U6GA 1R67A 4MTEA 3AKZA 3HYQA 1HW5A 2EA4A 4DNCA 4I6ZA 2IS2A 2JRTA 5IYDJ 5CQEA 3BG6A 1KQ8A 5FLXZ 3I7UA 2I8UA 1E0EA 1UG0A 2ICWG 3HOUJ 3SONA 1B4AA 5L3GA 3AL0C 4JZSA 3MAJA 2F2EA 3F6AA 1T95A 3J7Ye 1PUFB 4P9FA 1VQ8I 2DFFA 3K4KA 2IJLA 2P6TA 4MQVA 1SZ3A 4N4OB 3ZR8X 4O6JA 3X0RA 4CICA 1X1CA 3BR2A 2XV4S 4IHVA 2R7XA 2Y0MA 1VFCA 4ETSA 3OOPA 4G12A 2RNGA 4II3A 4RAFA 2A05A 5LHIA 2DQLA 3EEUA 4HA8A 3RQ4A 2VPRA 4XLEA 2H27A 3GFJA 5K7HA 1SMTA 1OCPA
chains in the Genus database with same CATH topology
2UUZA 4CZCA 2VQHA 3K6GA 2FKBA 4S2YA 4CCLA 5DDGA 2M4KA 1V8LA 3A1YA 3BCAA 1Y6IA 3VYRB 2KMUA 4XQFA 4DGWB 3EPZA 3I7VA 3DEEA 2HVSA 1WJDA 3V42A 4U87A 2X1CA 4E7LA 5KHDA 3CJRB 2J8QA 3K4NA 3IUOA 4CCKA 2ZSHB 2E1MC 4XORA 4BUPA 4BDZA 1PPXA 3OYIA 3FFUA 4II2A 2KP6A 3X0SA 2IGMA 2P0WA 4C2UA 2WB1A 5FSLA 1X1AA 2MYSA 3MKWB 4LITA 1MMGA 3FBIB 2A8RA 3DQVC 3A6UA 1R6RA 2Z1DA 3UR3C 4KISA 2WBMA 3X0OA 2R5WA 5CKTA 2XF7A 1PPVA 2KPMA 2VASA 3OYDA 3ZRGA 1K26A 4CCMA 3OIQA 4X0GA 1D0YA 3MCFA 1DGWY 2R7SA 2VLAA 4D9JA 3H9GA 4ZTFA 4HNUA 3DKXA 2CV2A 1VIQA 2PJRB 5ANVA 3N9UA 4Y33A 1FMVA 1RRSA 3A6SA 2CW7A 1Y56A 2IXSA 1VHZA 2WY8Q 1K2EA 3S32A 1TUMA 2VNQA 2DHOA 4KG4A 3HUGB 4AU7A 4C9WA 3WHWA 5ANSA 5CPRB 2E5NA 3OOUA 3SEQA 3Q1PA 4YRVA 3SEZA 4ICKA 2A5WA 4NC8A 2GT2A 4XNFA 4BE2A 2M7AA 2DUKA 4KG3A 1YX5A 1WJAA 3CESA 2WAFA 4AYBA 2VXZA 2V7FA 2Z2SB 3H35A 3I9V2 4OWRB 5C7TA 2CUZA 3LSIA 2BVLA 3OYGA 4J01A 3PNYA 4B44A 2Q2EB 4BACA 2VKHA 4JZVA 2L9NA 1N77A 2A6TA 3HG9A 3MD2A 1V8WA 2I8TA 2HPMA 2XSJC 2R7VA 2G74A 1RRQA 2DXIA 3MMYB 4YELA 1U20A 1MNDA 4N1TA 2JVHA 3S3OA 3O61A 3CF2A 4BE1A 2AZWA 1KT9A 4OAZA 4BJ5C 4IX7A 2VL8A 1PUSA 3DKUA 3EXQA 3MDIA 2W00A 2MABA 2YVOA 2DOAA 2RRKA 2VIXA 1BR2A 2XSQA 2MFZA 2KHMA 4BQNA 3PL8A 3P6YA 5HLTA 4BJ6C 1G9QA 4J00A 2AQFA 1V5FA 2UV1A 2V6EA 3Q4IA 4MPOA 2VJ5A 2X6XA 4ZC3A 2CZRA 3L2RA 2DT7B 5FSIA 5DPKA 1VCDA 4B3XA 4ZDLA 1X1BA 5FRMA 4JZUA 2V1NA 3DLAA 3VYTB 2KDOA 2XF5A 4BEHB 4ANJA 4BGDA 5JHFA 1PJRA 4HSTA 5IW5A 2XF6A 2F5VA 5HZXA 5GHIA 3N05A 3GZ6A 2K9MA 2CV1A 5C7QA 2R7WA 3RSNA 2W1OA 2CL3A 3S3NA 2DSCA 2B0VA 3UNGC 4CSWA 4XL9A 2CS3A 2DSBA 3H9JA 3HKZA 4GRIA 4BEHA 4RLFA 4HNTA 4QPOA 3S3MA 3OYEA 5KCMA 3RTRA 5BS6A 2ICKA 3CNGA 3OYJA 2IS4A 1FMWA 2VKDA 3OS0A 2FUG2 2KDVA 1NQYA 3OIPA 4IQ4A 3SYTA 1SFKA 3OR1C 2HVQA 3OR2C 4ZG0A 3CZ6A 3K70D 1S9HA 1DQUA 4F52A 3TBIA 3D5SC 3LFUA 1W36C 2KRCA 2LC2A 3BC8A 2QKLB 1SJYA 1G59A 3LL7A 2M7BA 3OYNA 3E1SA 2M0MA 2WA0A 2VJJA 4IZZA 4XN3A 1X4PA 4N1UA 4NFWA 3ZGKA 4DJAA 2A8QA 2Z16A 1V8YA 3O6ZA 2HDWA 2WAEA 3E0JB 2LREA 4CCOA 3LMMA 3X0IA 4XN0A 3ONQA 4XOPA 3HC7A 5IW4A 2KLOA 3EUAA 4P1WA 3BG7A 3W3CA 3HPHA 4EATA 2Q1ZB 2F6CA 3DUPA 3L85A 1DGRM 5C8LA 3Q91A 3S93A 3KYLA 1OLTA 1D0ZA 2K5CA 1X1DA 2HVRA 2LRDA 4J7HA 3LSGA 2JA2A 2I8DA 2L2OA 4BL0B 1V8NA 1LFPA 3C2GA 3RCOA 3QOEA 3HL2A 2LY2A 1X4OA 3VSKA 4PJJA 2LYCA 5ANUA 5CFJA 3N77A 1N78A 1WFXA 2E5ZA 5GHMA 1V8IA 3SDBA 3X0QA 2RQQA 4DBQA 4G6TB 2M3AA 5BONA 2L7KA 5ANWA 3HOSA 2X6YA 3CJQB 3PNVA 2VQLA 4LIVA 3ZR0A 2Q9PA 1WJFA 3C2HA 3H5RA 1UAAA 2WY7Q 1JI8A 3Q2TA 1VC9A 3FSPA 3AFHA 4H4KC 1KHZA 2O5RA 2B2KA 3H95A 1MMDA 3SMDA 2AQEA 3FDYA 3M8JA 1NQZA 1BR1A 4ZTJA 4F92B 3OMYA 5ISYA 3QYFA 1V8SA 4ILQA 4PJNA 1I9AA 3F9KA 3FK9A 2X1EA 2R7RA 3COUA 5DEQA 1MMAA 4BQOA 4BS9A 1V8TA 3EUKL 3BLYA 3IP4B 3L2QA 1MR2A 2F4IA 1F3YA 1OR7C 2GB5A 3FCMA 4CCJA 1WJ5A 1MK1A 3W2VA 4RMNA 4BDYA 3PSIA 5GHNA 2WAQA 4BJTA 1HA8A 5FSNA 1WJCA 4B43A 4D1QA 4XLAA 5HNHA 4DYWA 3O52A 2I6KA 4ZJZA 1HX3A 4Y4RA 4B47A 3OYMA 5HOOA 2IGKA 1Z3YA 3ZXSA 2DJIA 4C9YA 3PSFA 4PUSA 3DPLC 3DU5A 3X0PA 4YPRA 4XM3A 1D1CA 4PFOA 2OUMA 4R79A 4FETA 4C2TA 1MP2A 1NFZA 1MUTA 2A8PA 2R7TA 2K3PA 2BVMA 4MLOA 3NWSA 1K6YA 3X0MA 3DTEA 2YYHA 3PNTA 4NC7A 4PJMA 2HZDA 3PJRA 3KX2A 1X83A 3LSKA 3EESA 2YVPA 2XC7A 3BM4A 3D5LA 1RYAA 1Z7LA 4KT6A 4BU2A 2BOLA 4XLFA 2X51A 1QHHD 4XKBA 2KDWA 3OS2A 4N4NB 4AVZA 5HVQC 3ID9A 1MQWA 2VJ4A 4S2VA 2FVVA 1KTGA 2W4SA 1SU2A 4RM2A 3HXLA 1XSBA 4F91B 2VB6A 2V9KA 2HNHA 3RH7A 3VYUB 5GHPA 4J7GA 1TT0A 2VXDA 3HPGA 2KRHA 3M1CA 3GWYA 2X1DA 2VPLA 5FROA 2G73A 4NNJA 3R03A 2VQGA 1GLNA 1VZ0A 3KEYA 3QODA 3OYAA 2LH9A 4ZDOA 1V8VA 2JUGA 4PFPA 3FKJA 3X0KA 1NG6A 3DTKA 1VK6A 2B06A 4CCNA 3X0LA 2OC6A 3GRNA 3O8SA 4YPHA 3DWLE 4U7BA 2O1CA 3FBNB 2L9SA 5LD2C 3BAPA 4XONA 1P9QC 1NFSA 3CP8A 2R7QA 4C9XA 1G8XA 2KL4A 2XAUA 3OS1A 1V8RA 4CH7A 2CW8A 1WJBA 1V8MA 1Q27A 2M4GA 1GA7A 4KITB 1D1BA 2PQVA 1J09A 4HEA2 4V14A 1LVKA 4XR6A 1V5GA 3PUBA 2L5QA 4HRIA 1LDKB 4RLQA 1DP3A 3K70C 4IJXA 1Z21A 1U0JA 2ICJA 1EA3A 1AA7A 3K4CA 2W7NA 4P5OA 4JQFA 3G0QA 3QSJA 2W82A 2LBFB 2JSPA 3A6TA 4XMYA 1BOBA 4HSRA 2JVBA 2ZFUA 2LOOA 3K4LA 4XKWA 2A8TA 3ZR1A 3LSHA 2R7OA 3DTIA 2IS6A 4QPQA 4E7ZA 1SOIA 5LFAA 2YVMA 3O69A 1MNEA 3EUHC 1UELB 3TL4X 2UWMA 1OW2A 3DU6A 1V8UA 4JZTA 2LBFA 4PSWA 4BXFA 5KNLA 3D5RC 4C30A 1PPWA 2KZVA 1IRYA 1X19A 2DSDA 2PNYA 2IGNA 2CUJA 4LIUA 3OL3A 4ZDPA 3OL4A 3A2KA 1VIUA 3G2BA 3L2WA 2VQCA 3OYHA 3ACAA 3EF5A 3HHJA 3MKZA 3GBGA 2HU9A 2ZSIB 4KYXA 1WJEA 4DBRA 3L2VA 2CV0A 3U53A 2IGOA 4ITVA 4F3QA 4Y3OA 3W2WA 1QU3A 3I9XA 2O5FA 3KVHA 3S8PA 4S2WA 3FHNA 2CMPA 3IAS2 4E7IA 2E60A 3MDGA 2PMZA 3ZQQA 3Q2SA 3FJYA 1Z3XA 4CUGA 2WADA 3F13A 3GG6A 3QYBA 3VSLA 2HPIA 3CMMA 2LY1A 1MQEA 3OYLA 1T0FC 3LSMA 4NUBA 1PUNA 2QJTA 3OYCA 1TZLA 4IQJA 3P5TA 1MW7A 5FSOA 4OAYA 1N75A 3I3LA 1XSCA 5LPGA 3PFYA 4HG2A 4B48A 4BQQA 2VJIA 2KQRA 2OV7A 1YX3A 3U21A 5DD4A 2ELJA 3NWTA 3TMOA 1VRLA 2JVGA 3X0JA 2ZXIA 3J7AY 3MKYB 3E57A 1XSAA 2O5WA 2PJRA 1LKXA 5FSKA 4E7JA 3VWBA 2BW3B 2CFOA 2V4JC 4XKCA 2HQAA 4E4HA 2W4EA 5GHQA 1X51A 5I8UA 3X0NA 1PVFA 2LG4A 4F55A 1Q54A 2QKMB 3RPUD 4E7SA 4E7KA 3K4BA 3H5NA 2A8SA 3K10A 2GOXB 3DPTA 4PK4A 3HOTA 1ZELA 4NFXA 5GHOA 2ZXHA 2DCEA 2X85A 1NG7A 3K4MA 3OGAA 2BW3A 2GOMA 1HZTA 3OWTA 4HPQA 1JRKA 2QJOA 5FRNA 2V26A 4NQWB 2RREA 3AL0B 1D0XA 4ZYAA 1YE9A 4KTBA 3QYEA 3Q93A 1QVJA 4CA0A 3OYFA 2VNPA 4XLCA 4DIQA 4LG3A 1SAUA 2R4GA 4PSXA 3CP2A 4XKVA 3A6VA 3AC9A 3SZGA 3OYBA 3OYKA 3L2UA 2FMLA 4HFQA 3OY9A 3BHOA 1V5EA 5CFIA 2CH0A 4PJLA 4YEJA 4IKFA 4K6EA 3BCBA 4YOQA 1JKNA 3GZ8A 4S2XA 2NOJB 5TGTA 1PUQA 1G0SA 3GZ5A 1KONA 3ZCOA 4XOTA 4E6KG 1BR4A 3SHDA 2K9LA 5GHJA 2XDVA 1VHGA 1R67A 2Y0SA 3AKZA 1MMNA 4XLHA 2IS2A 3HYQA 3VDXA 4DOZA 2R7UA 4BE0A 2YVNA 5CQEA 3BG6A 3I7UA 4FASD 5ANTA 2I8UA 3A4CA 1E0EA 3VYSB 1UG0A 3W2AA 4HVYA 5CQGA 1W36D 3SONA 4F93B 3AL0C 4JZSA 3MGMA 3F6AA 1T95A 3J7Ye 1QHGA 1Q33A 3DKYA 1IRXA 3K4KA 4JOMA 1SZ3A 3H5AA 4N4OB 3DPUA 3ZR8X 3X0RA 2MD0A 1X84A 1X1CA 4E7HA 3K4JA 2MC4A 2R7XA 3H0DA 1VC8A 1PYVA 2RNGA 4II3A 3EEUA 2E1MB 1D1AA 2IS1A 2GT4A 2DT6A 3H9QA 4RM3A 5FSMA 3RQ4A 2X6WA 5HNFA 4KJZA 4XLEA 1ERDA 3IAM2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GHN A;  3EF5 A;  2FKB A;  3ACA A;  4JZU A;  3HHJ A;  4S2Y A;  5FSN A;  5DDG A;  4KYX A;  4DYW A;  3U53 A;  1V8L A;  2I6K A;  3O52 A;  5HZX A;  5IW5 A;  5GHI A;  1HX3 A;  3I9X A;  2O5F A;  3KVH A;  3GZ6 A;  4S2W A;  3I7V A;  5C7Q A;  3MDG A;  2CL3 A;  3Q2S A;  3FJY A;  2DSC A;  2B0V A;  3X0P A;  4YPR A;  2DSB A;  1MP2 A;  3F13 A;  3GG6 A;  1NFZ A;  2A8P A;  1MUT A;  1MQE A;  1PUN A;  2QJT A;  2J8Q A;  3P5T A;  5FSO A;  5BS6 A;  2ICK A;  3CNG A;  3X0M A;  1XSC A;  5LPG A;  2KDV A;  1NQY A;  1PPX A;  4ZG0 A;  2YYH A;  5DD4 A;  3FFU A;  5C8L A;  3X0S A;  1VRL A;  1X83 A;  3EES A;  3X0J A;  1SJY A;  2YVP A;  2QKL B;  5FSL A;  3BM4 A;  1RYA A;  2A8R A;  1XSA A;  2O5W A;  3E57 A;  5FSK A;  3A6U A;  2KDW A;  2W4E A;  4NFW A;  4N1U A;  5GHQ A;  3X0O A;  2R5W A;  2A8Q A;  1MQW A;  1X51 A;  1V8Y A;  3ID9 A;  1PPV A;  3O6Z A;  4S2V A;  5I8U A;  2FVV A;  1KTG A;  1PVF A;  3X0N A;  1K26 A;  1Q54 A;  2QKM B;  1SU2 A;  3X0I A;  1XSB A;  3MCF A;  2A8S A;  3RH7 A;  1VIQ A;  4NFX A;  5GHP A;  5ANV A;  5GHO A;  5IW4 A;  3N9U A;  3OGA A;  1RRS A;  3A6S A;  3GWY A;  3L85 A;  1HZT A;  3DUP A;  1VHZ A;  1JRK A;  2G73 A;  1K2E A;  2QJO A;  1TUM A;  2VNQ A;  3Q91 A;  2DHO A;  3R03 A;  4JZT A;  4KG4 A;  4C9W A;  3WHW A;  1V8V A;  5ANS A;  4KTB A;  3X0K A;  3Q93 A;  1QVJ A;  2VNP A;  3Q1P A;  1VK6 A;  2B06 A;  4ICK A;  3X0L A;  1V8N A;  2GT2 A;  3GRN A;  3O8S A;  4YPH A;  2DUK A;  4KG3 A;  2O1C A;  3A6V A;  3AC9 A;  5ANU A;  3BAP A;  5CFJ A;  2FML A;  1NFS A;  3N77 A;  4C9X A;  4HFQ A;  5GHM A;  1V8I A;  3BHO A;  3X0Q A;  5CFI A;  1V8R A;  4K6E A;  4YOQ A;  1JKN A;  3GZ8 A;  5C7T A;  5BON A;  1V8M A;  4S2X A;  1PUQ A;  1G0S A;  3GZ5 A;  1Q27 A;  5ANW A;  1GA7 A;  2PQV A;  3SHD A;  4V14 A;  5GHJ A;  1VHG A;  4JZV A;  1R67 A;  3ZR0 A;  2A6T A;  4IJX A;  2Q9P A;  3HYQ A;  5ANT A;  2ICJ A;  2YVN A;  3I7U A;  1V8W A;  2I8T A;  1RRQ A;  2G74 A;  2I8U A;  3Q2T A;  1VC9 A;  3FSP A;  3G0Q A;  3QSJ A;  3A6T A;  1U20 A;  4HVY A;  4N1T A;  3SON A;  3O61 A;  2AZW A;  1KT9 A;  1KHZ A;  3MGM A;  4JZS A;  2JVB A;  2B2K A;  3F6A A;  1PUS A;  3DKU A;  2A8T A;  3EXQ A;  3H95 A;  3SMD A;  3J7Y e;  3MDI A;  3ZR1 A;  1Q33 A;  1NQZ A;  2YVO A;  5ISY A;  1SZ3 A;  1V8S A;  1SOI A;  4ILQ A;  1I9A A;  2RRK A;  2YVM A;  3FK9 A;  3X0R A;  1X84 A;  2XSQ A;  3O69 A;  3P6Y A;  3COU A;  1V8U A;  1OW2 A;  5DEQ A;  1G9Q A;  1V8T A;  1VC8 A;  3Q4I A;  1F3Y A;  1MR2 A;  1PPW A;  3EEU A;  2GT4 A;  2GB5 A;  1IRY A;  2PNY A;  2DSD A;  3FCM A;  5FSM A;  5FSI A;  5DPK A;  1VCD A;  1MK1 A;  4MPO A;  1VIU A; 
#chains in the Genus database with same CATH topology
 1S29 A;  2FKB A;  3H3Z A;  1FYL A;  3RIR A;  1LQ1 A;  1Y6I A;  3I59 B;  2DPD A;  4HBL A;  1IV6 A;  4A3D J;  3DEU A;  1B9N A;  2PLY A;  4YII A;  5D4S A;  3V7R A;  1ZRD A;  4RAZ A;  1I3Q J;  2M0C A;  1ETX A;  4A3B J;  1EJ9 A;  3IUO A;  4A3E J;  3C2B A;  4V2G A;  2XGD A;  4XOR A;  1NK2 P;  3AAF A;  3OYI A;  3FFU A;  1S7A A;  1SFX A;  1ZRC A;  2OTL I;  1FX7 A;  2IGM A;  1D3Y A;  1FBQ A;  1BM9 A;  2WB1 A;  4RAG A;  1GT0 C;  5LEK A;  2IA0 A;  1R6R A;  2E71 A;  3UR3 C;  3HIF A;  4BHP A;  4KIS A;  2CQK A;  2JA6 J;  1S7O A;  1ZYR F;  3ECH A;  4EM1 A;  3KET A;  2EFQ A;  2BHZ A;  5FD5 A;  1ULY A;  4FX0 A;  4FT8 A;  2KJC A;  1MH3 A;  4RAY A;  3OIQ A;  3RJP A;  4RDU A;  1DGW Y;  5E1Z B;  5FLX K;  3WHB A;  4HNU A;  1UG2 A;  3DKX A;  3CF5 F;  5IT3 A;  2PJR B;  5ANV A;  5ERI A;  3GYH X;  4GDF A;  4ZZD A;  3K0L A;  4LK1 F;  3A6S A;  1VQ5 I;  1F4K A;  1YHQ I;  1U8B A;  1K2E A;  3ZQL A;  1STZ A;  1XGS A;  1PUE E;  1FSE A;  1Q1V A;  1A04 A;  2R5Z B;  2CYY A;  2ZME A;  4NC8 A;  3DBL B;  3U2R A;  3HTS B;  1I1G A;  5KAF C;  3CES A;  2WAF A;  2VOO A;  2VXZ A;  5BQT A;  3Q9V A;  2V7F A;  2R7Z J;  3JCU C;  5GTH C;  2Z2S B;  3H35 A;  1WKM A;  1OQY A;  3I9V 2;  4BHC A;  1FNN A;  3OYG A;  3GTP J;  1FZP B;  2D2W A;  4D7N A;  3PIP F;  1XSX A;  3IL2 A;  2KT0 A;  1N77 A;  1XG1 A;  2A6T A;  3RPU A;  3MFK A;  1J7K A;  2BY1 A;  3GTO J;  2G74 A;  4BBR J;  2LY9 A;  1TWA J;  2V9V A;  5F04 A;  5E8G A;  1KT9 A;  4OAZ A;  1YRN B;  2ID6 A;  2VL8 A;  3DKU A;  1HW2 A;  2MAB A;  2MA3 A;  3BOQ A;  2DOA A;  1BR2 A;  2L9V A;  2Z5U A;  2KHM A;  3P6Y A;  3V4G A;  1XDU A;  3H0G J;  4KMF A;  2MSY A;  1R49 A;  3CJT B;  4FHT A;  2DA2 A;  4J00 A;  1V5F A;  2UV1 A;  3Q4I A;  1R23 A;  1OMI A;  4OU0 A;  2XVC A;  3I54 A;  4ZC3 A;  4B4C A;  1T33 A;  2KJB A;  4UUT A;  5M3F J;  1SVO A;  1J9I A;  4JZU A;  3W6J B;  1GV2 A;  3HOZ J;  4G7O F;  4BGD A;  1X2N A;  1R5G A;  2PX9 A;  3KZZ A;  4HST A;  2GAU A;  3CC2 I;  2NS7 A;  1AHD P;  1TW2 A;  5JR3 A;  3F8N A;  4Y13 A;  3ROU A;  2Y0S N;  2TCT A;  2IPQ X;  4GRI A;  4BEH A;  4HNT A;  3AG3 H;  3PO2 J;  3WU1 B;  4G9Y A;  3ZP5 A;  1VQL I;  3RTR A;  2NXN B;  2JA7 J;  2R0Q C;  3OYJ A;  2E1O A;  2RC4 A;  2OZ6 A;  3BT9 A;  3SYT A;  3OR1 C;  3GME A;  3I71 A;  1DQU A;  2P6S A;  3LFU A;  4FQG A;  4O3M A;  1SJY A;  1PVE A;  2M30 A;  3F8C A;  4JX5 A;  3OYN A;  1HDP A;  2M7B A;  3AG4 H;  1Z7U A;  2M0M A;  3IRR A;  4Z2Y A;  4Q47 A;  2DJN A;  4XID A;  4IZZ A;  1BI3 A;  4LK0 F;  1CF7 A;  1MSF C;  2A8Q A;  5FKO A;  4IEJ A;  5E1W A;  3QAH A;  4GO1 A;  1XB4 A;  3M07 A;  2GXA A;  1BN5 A;  1VND A;  2FA5 A;  4JK1 X;  3ONQ A;  3RKX A;  3AG1 H;  3K69 A;  4XOP A;  1LNW A;  4Y17 A;  3HC7 A;  5CYV A;  4HX7 A;  1BJA A;  1IUF A;  2H94 A;  2KLO A;  5J3L A;  2DA7 A;  5IW4 A;  3J80 K;  1YLF A;  3R61 A;  3L85 A;  3HPH A;  4EAT A;  2EPF A;  2F6C A;  1IJW C;  4JBA A;  3S93 A;  5FLM J;  2QCO A;  2HVR A;  2LRD A;  4J7H A;  2I8D A;  2CFX A;  2L2O A;  4WXH A;  4BL0 B;  3C2G A;  2LD5 A;  3RCO A;  4L0Z B;  1R58 A;  3BJA A;  3S2D J;  1TWF J;  4UVC A;  1XPX A;  1Y1V J;  1TNS A;  2FNP A;  4DBQ A;  1LB2 A;  4G6T B;  4EGY A;  3X0Q A;  2XAG A;  2ZJP F;  4BXX J;  5ANW A;  4MO7 A;  5ICE A;  1KU3 A;  1MGT A;  1JT6 A;  3HOS A;  2JPB A;  2XSD C;  2STW A;  1SD4 A;  2NS0 A;  5F6F A;  4RS8 A;  2VQL A;  2XAJ A;  3ZR0 A;  4YFX F;  3JRD A;  3W6K B;  4RB3 C;  2VUM J;  1JUS A;  1F9N A;  3Q2T A;  2CG4 A;  2LFB A;  2EFN A;  3HEF A;  3HRM A;  2BXY A;  3BR0 A;  2FF4 A;  1VQN I;  3TOA A;  2KIQ A;  3AFH A;  4H4K C;  3GF2 A;  3FKI J;  5CVI A;  1P7J A;  3P9I A;  2CGP A;  3S15 J;  1BR1 A;  4L9N A;  4YIR X;  3OMY A;  1I9A A;  1FWZ A;  2ECC A;  1X3Z B;  2R7R A;  3KP3 A;  1ODD A;  5J47 A;  3L2Q A;  3CD6 I;  1HLV A;  2GB5 A;  2VT2 A;  1S6L A;  3W2V A;  2EIN H;  3V8L A;  2O8X A;  2OF7 A;  3M8E A;  5E8I A;  1YTY A;  1VQO I;  4B43 A;  2BY0 A;  4XLA A;  5HNH A;  4DYW A;  3MZH A;  3RZD J;  3MQ0 A;  4Y4R A;  1B8I B;  4QTR A;  1EH6 A;  3PQJ A;  1T38 A;  2IGK A;  2DJI A;  3KPH A;  4PUS A;  3GTK J;  2XUB A;  3DPL C;  5LBQ A;  4YPR A;  4M74 A;  5J4V A;  2LVS A;  4R79 A;  3RKQ A;  1MUT A;  1YIO A;  2A8P A;  1KYZ A;  2BBY A;  4KN4 X;  2EK5 A;  4U0V A;  2RQP A;  3ULQ B;  1Y8Q B;  5LGT A;  5GPC A;  2XKO A;  3KEO A;  4G6Q A;  4NC7 A;  4IHW A;  1XTA A;  4PCQ A;  4M3F A;  1Z05 A;  3D5L A;  1ZR2 A;  1IDY A;  1G2H A;  4KT6 A;  4MTD A;  3WOD F;  3K1M A;  4XLF A;  1QHH D;  2YUS A;  5D6E A;  5HVQ C;  3BTI A;  3ID9 A;  2TDX A;  2YX4 A;  4S2V A;  2R3S A;  2D1V A;  3D1N I;  2Y69 H;  3BRO A;  4RM2 A;  2V9K A;  5ILS A;  2HNH A;  4LLL A;  3VYU B;  2K4J A;  3BG3 A;  2PG4 A;  3WG7 H;  3M1C A;  2VPL A;  2ZCW A;  5FRO A;  3R03 A;  1Q1H A;  1VZ0 A;  1LE8 A;  4ZDO A;  2LH9 A;  2BYV E;  2GXB A;  4S05 A;  2GA1 A;  5EYR A;  2J5P A;  1ZTR A;  1NG6 A;  1VK6 A;  3D0S A;  4CCN A;  3JRH A;  1QZZ A;  4UVA A;  3X0L A;  2DFE A;  3DWL E;  2CRG A;  3PIO F;  1UMQ A;  2O1C A;  4WXC A;  4JYK A;  2QUF A;  5JLX A;  2XAU A;  4UVB A;  2QVO A;  4CH7 A;  1E2X A;  2L0K A;  1SMY F;  3ISP A;  1XS9 A;  2EB7 A;  1WI9 A;  1I39 A;  4F7Z A;  4WX9 A;  1J09 A;  4HEA 2;  1LPQ A;  1XMA A;  1ZHF A;  2X6O A;  2COM A;  3PUB A;  3HRU A;  1SD7 A;  4BBS J;  1DP3 A;  2M8G X;  1BI1 A;  3GFM A;  1XCB A;  2ICJ A;  1ZRF A;  2AHQ A;  4I76 A;  3K4C A;  3G1L A;  3I4P A;  3P7N A;  2LBF B;  2JSP A;  3CDL A;  1R71 A;  1QVT A;  4IHY A;  1BOB A;  1WSU A;  3A01 A;  5ICG A;  2OCE A;  2E2H J;  1APL C;  3FXR A;  2L01 A;  3I56 I;  2ADU A;  1SOI A;  3CC7 I;  2YVM A;  2E19 A;  2UWM A;  2ISZ A;  1QZY A;  3DU6 A;  4WK8 F;  2HOA A;  2VE9 A;  4PSW A;  4HZF A;  1ETO A;  4IVN A;  2KZV A;  4BAY A;  2BHY A;  4OOI A;  2X48 A;  4O5V A;  4LG0 B;  2IGN A;  4L9T A;  5DTD A;  4A93 J;  1TT5 B;  2JJ7 A;  3ACA A;  1JT0 A;  3FXQ A;  2HU9 A;  3RPQ A;  3Q3S A;  1WJE A;  1BI2 A;  4HX8 A;  1OCO H;  2FOW A;  3CCJ I;  1QU3 A;  5CVJ A;  5IOY A;  1T2K A;  3FHN A;  1O3Q A;  2CMP A;  2IP2 A;  3IAS 2;  3ABM H;  2PMZ A;  3ZQQ A;  2W48 A;  1Z3X A;  1IN5 A;  2G7U A;  5H6R A;  1K61 A;  2K9S A;  1TBX A;  3J7Z I;  3F13 A;  2COB A;  4QSH A;  3VSL A;  2HQR A;  1MQE A;  1PUN A;  5M5W J;  4V19 K;  1MW7 A;  2JRM A;  3I3L A;  5B3S H;  4B48 A;  4BQQ A;  2E7W A;  1U5T B;  2GA2 A;  2KQR A;  1WCM J;  2BV6 A;  4HX4 A;  1MDM B;  4HLX A;  5EGO B;  4ESF A;  4A5N A;  1T6S A;  4J19 A;  3J7A Y;  4L5E A;  4AUX A;  3N4M A;  2OQR A;  3JRG A;  2V4J C;  5GHQ A;  1FBS A;  1BC8 C;  4ZYH A;  3S1M J;  3BR6 A;  5I8U A;  4BY1 J;  1BW5 A;  2V6C A;  2QKM B;  2F4O B;  4P55 A;  3JW4 A;  2HOT A;  2A8S A;  2RDP A;  4ZH4 F;  3DPT A;  3MWM A;  4NFX A;  1ZEL A;  2NAZ A;  2QQA A;  3B6A A;  3OSF A;  2X85 A;  1HZT A;  3OWT A;  1JRK A;  1QNT A;  5FRN A;  2V26 A;  3R60 A;  3DFG A;  4NQW B;  4YFN F;  2PMU A;  4ZYA A;  1YE9 A;  4U0Y A;  4I0B A;  3Q93 A;  1QVJ A;  2OCC H;  4CA0 A;  2VNP A;  4MIM A;  2GM4 A;  2R4G A;  4GGG A;  4PSX A;  3CP2 A;  2HXI A;  1F5T A;  3A6V A;  3OYK A;  3L2U A;  1DU6 A;  3FK6 A;  2QSF X;  3LQQ A;  3O3K A;  5CFI A;  2R7F A;  1G4D A;  1MBK A;  1JKN A;  3ZPL A;  5LRR A;  2NOJ B;  1PUQ A;  4QWQ A;  1YW8 A;  1S8N A;  2ACJ A;  3S14 J;  1BR4 A;  3SHD A;  2K9L A;  3SFI A;  4LD5 A;  3S16 J;  2CW0 F;  5D5X B;  1MMN A;  4XLH A;  4I98 B;  3VDX A;  4DOZ A;  4AIJ A;  3DEW A;  4ESJ A;  5ANT A;  1LUJ B;  5E3L A;  3H3U A;  1ZG3 A;  5F0F A;  1W7P B;  5E3M A;  2DTZ A;  3GVA A;  1HXD A;  1TP4 A;  5F0C A;  5EG0 B;  3DKY A;  4JOM A;  2K9N A;  2LLK A;  3GZN B;  3BZK A;  3DPU A;  5AIQ A;  2XB0 X;  4NHJ A;  1OFC X;  1IXR C;  1YS7 A;  3ABU A;  4E7H A;  3K4J A;  4LMY A;  3ZN0 A;  2E35 A;  2MC4 A;  5K5O A;  3H0D A;  1FSH A;  1JKQ C;  1LDD A;  3H9Q A;  2QZ8 A;  2X6W A;  4KJZ A;  1IV8 A;  4MNU A;  2HOS A;  1W0T A;  5EEH A;  1UZC A;  2VQH A;  3K6G A;  4S2Y A;  4HDV A;  4XBF A;  2D5V A;  2KRF A;  3Q0W A;  3DBH B;  5TJJ A;  3A1Y A;  2DA5 A;  1IN6 A;  4LFU A;  1D8J A;  2KMU A;  2DA1 A;  4DGW B;  3I7V A;  5LGU A;  2EFW A;  2LKS A;  3DEE A;  3WE2 A;  1WJD A;  2FEZ A;  4U87 A;  3IHU A;  3CUQ B;  5KHD A;  1ETK A;  2JMW A;  3CJR B;  1ACI A;  3K4N A;  4A5M A;  4DZJ A;  4ESB A;  5D8L B;  1RRJ A;  1K83 J;  3LOC A;  5K7F A;  3V8K A;  2E1M C;  2XPV A;  1P4W A;  2QA4 I;  3FWE A;  2KP6 A;  2F48 A;  1RIO H;  1UHS A;  2DK5 A;  4JX4 A;  1X1A A;  3WU0 A;  5DS9 A;  5FSL A;  1MBF A;  3MKW B;  1Z0X A;  2A8R A;  3DQV C;  5CVV A;  1OYI A;  3M7G A;  4B8X A;  2EIL H;  1HCR A;  2WBM A;  3B73 A;  3OIO A;  4EVI A;  5K7Z A;  4D5F A;  1PPV A;  2KPM A;  2KIM A;  2DPU A;  3OYD A;  4E70 A;  2DMU A;  1RPW A;  1B1B A;  3IV5 A;  4CCM A;  1D0Y A;  2VLA A;  2ZME B;  2FX0 A;  3H9G A;  1W4M A;  5DM6 F;  2DMP A;  4ZTF A;  2Z3Y A;  2CV2 A;  2L7M P;  3S1Q J;  2DBB A;  2KFD A;  3N9U A;  4Y33 A;  2HZT A;  2CW7 A;  2K4B A;  1VQP I;  3HOV J;  2A61 A;  2JTV A;  2WY8 Q;  1TUM A;  1WWX A;  3WTT C;  1RZ4 A;  2DHO A;  4AU7 A;  1IXS B;  3WHW A;  5E18 F;  5CPR B;  1R22 A;  3PM1 A;  1KZH A;  1O4X A;  3I55 I;  1IO2 A;  2KKO A;  4YRV A;  3SEZ A;  2EV6 A;  4ICK A;  3ZMD A;  4R1H A;  2J5O A;  4EV0 A;  2M7A A;  4BE2 A;  2DUK A;  4PGG A;  4EM0 B;  1WJA A;  3WTZ A;  4WWC A;  4AYB A;  1OJL A;  3KP4 A;  2DA4 A;  4OWR B;  3TKY A;  2CUZ A;  3J81 Z;  1LFB A;  1A35 A;  4XRF A;  3N97 A;  2EA2 A;  5CVU A;  2VKH A;  4C3H J;  1TC3 C;  2L9N A;  2O61 A;  3CTA A;  3HG9 A;  3MD2 A;  3W6V A;  4Y7N J;  1V8W A;  2RKH A;  1FYM A;  2R7V A;  2I8T A;  1RRQ A;  5HDG A;  4AYB N;  1SVL A;  2M87 A;  3TDZ C;  4N1T A;  3CF2 A;  3I64 A;  3CMA I;  5HS7 A;  2PQ8 A;  5B66 C;  2JA5 J;  3EYY A;  1OCC H;  2Q2E A;  2HKX A;  1PUS A;  2YVO A;  5FLV A;  2AXT C;  2DW4 A;  2XSQ A;  3T0Y A;  2PN6 A;  4M6Y A;  4BJ6 C;  1NK3 P;  1G9Q A;  2QM3 A;  2LDU A;  5BNG A;  3LWF A;  2XIG A;  5FSI A;  4FE7 A;  4FCY A;  3ML6 A;  3VPR A;  1YYV A;  3FX3 A;  5FRM A;  1MIJ A;  5F1J A;  4BEH B;  5KK1 A;  1Z77 A;  4NDL A;  1O57 A;  1UHW A;  2Y75 A;  1ON1 A;  2XF6 A;  2RNJ A;  2E34 A;  5GHI A;  1JGS A;  2K9M A;  3F8B A;  3KZI C;  2CV1 A;  3RSN A;  3JRB A;  3BZC A;  3KIO A;  3UNG C;  3S1N J;  4XL9 A;  1FTZ A;  2CS3 A;  2DSC A;  3FK7 A;  4I7H A;  3CCQ I;  4KIC A;  3ESW B;  4MFE A;  3QU6 A;  2ICK A;  2H8R A;  1CF7 B;  4IL6 C;  2FUG 2;  2XGE A;  2KDV A;  4M9S A;  3TO6 A;  5HLG A;  1NQY A;  2YR2 A;  3E5X A;  5LHH A;  4ZG0 A;  3IKV A;  4F52 A;  3D5S C;  5B1A H;  3BC8 A;  2LC2 A;  3QPL A;  2JK3 A;  2ZC2 A;  3LL7 A;  2VJJ A;  3J81 K;  1W7P D;  1X4P A;  4ZZL A;  3ELK A;  1DU0 A;  2WAE A;  3E0J B;  3CCM I;  3X0I A;  2QQB A;  3VEP A;  4XN0 A;  1D8K A;  1ON2 A;  5FJ8 J;  3EUA A;  4P1W A;  2OU2 A;  4Y52 J;  2QLZ A;  3L7W A;  3TO9 A;  2BE5 F;  1SAN A;  3JRF A;  3WG9 A;  3HHG A;  4NC6 A;  3I58 A;  1OLT A;  1A6Q A;  1D0Z A;  2K5C A;  4AIH A;  2CQQ A;  2ELK A;  2O6G E;  2CJJ A;  3C7J A;  4CGZ A;  3QOE A;  1XX5 A;  2LY2 A;  1X4O A;  3FXL A;  1IRF A;  5ILU A;  2E5Z A;  1V8I A;  5EJC A;  4Q4Z F;  4FX4 A;  3BZ6 A;  4UUS B;  1JKR C;  2L7K A;  2X4H A;  3VB2 A;  5CJ9 A;  2H09 A;  5M3M J;  3MCZ A;  2WB1 N;  3QOP A;  4HAM A;  2LKP A;  3C1D A;  1KU7 A;  4KA4 A;  2VI6 A;  3F0C A;  3H5R A;  2Y48 A;  4A3I J;  2VOP A;  1QVU A;  2EQR A;  2B63 J;  1T0F A;  1VC9 A;  3FSP A;  1R1U A;  1GXQ A;  1KHZ A;  3R6S A;  1IAW A;  3QPS A;  1MMD A;  3BTJ A;  3M8J A;  4XRS A;  3SQN A;  5ILV A;  5ISY A;  3QYF A;  2YPR A;  1K6O A;  1IZ1 A;  3JTG A;  4EMS A;  1SD5 A;  3HHH A;  2DLL A;  3P5J A;  4D0P A;  5FFX A;  3B02 A;  4BY7 J;  1BOA A;  3BLY A;  4HOB A;  2F4I A;  1S3J A;  3ECO A;  4H0E A;  1BIA A;  3BDD A;  1DP7 P;  2BGC A;  1MK1 A;  1U8R A;  1J5Y A;  3IH3 A;  3PSI A;  4LLN A;  4I01 A;  2WAQ A;  1HA8 A;  4HDU A;  4L0Y B;  3FXK A;  4D1Q A;  4HV5 A;  5D4R A;  4ZJZ A;  3J80 Z;  5DV5 A;  5HOO A;  1B6A A;  2EWN A;  3ZMT A;  1Z3Y A;  3PSF A;  1S5L C;  1KQ9 A;  1TTY A;  2ZFW A;  4A3F J;  3QRF F;  3WTS C;  3GTJ J;  2R7T A;  2XRO A;  2K3P A;  3WHC A;  4NB5 A;  3LNQ A;  1ORK A;  1U9O A;  2B0L A;  3GLX A;  4A0Z A;  2YYH A;  3PNT A;  5BPD A;  4PJM A;  5ED4 A;  3EES A;  3IH2 A;  4CYD A;  4MEX F;  4UB6 C;  2MH2 A;  2FBH A;  1XDS A;  3FIS A;  1ZK8 A;  4RA2 A;  4N4N B;  3MVP A;  2VJ4 A;  1LE8 B;  4DZP A;  3KP6 A;  1KTG A;  5J40 A;  3AG2 H;  1XSB A;  4F91 B;  2VB6 A;  1UCR A;  4J7G A;  3HM5 A;  1MJB A;  3HPG A;  2R5Y A;  1J2X A;  4A3C J;  1FOK A;  2G73 A;  1V3F A;  3X2Q H;  2VQG A;  5JFR A;  3OYA A;  3TED A;  3F23 A;  2ZNZ A;  3FKJ A;  1BJZ A;  3TQN A;  4EJO A;  1W0U A;  1H8A C;  3X0K A;  2EFO A;  3DTK A;  1MKM A;  1R5I D;  4YPH A;  1HOM A;  2VBZ A;  2DOD A;  4U7B A;  2ESN A;  5LD2 C;  4XON A;  1NFS A;  4I09 A;  2R7Q A;  4W1U A;  1G8X A;  4C9X A;  4KIB A;  2KL4 A;  1R1V A;  2RV8 A;  3OS1 A;  3ASN H;  1V8M A;  2DT5 A;  2A5Y B;  1Q27 A;  2R92 J;  1GA7 A;  3A01 B;  1OYW A;  2XAS A;  3GO5 A;  1LVK A;  5GP9 A;  4XR6 A;  1V5G A;  3LQR A;  1PP7 U;  4GYG A;  3ZQG A;  1SD6 A;  4IJX A;  4RLQ A;  5IP7 J;  1Z21 A;  2EV0 A;  2N8G A;  4LLG F;  1FTT A;  3QSJ A;  2W82 A;  1RC9 A;  4IJA A;  1JHH A;  3A6T A;  3RZO J;  4WCG A;  1MNM C;  1SFE A;  3ASO H;  3CO7 C;  4HSR A;  2JVB A;  2HYJ A;  2LOO A;  2W25 A;  2ZFU A;  2W57 A;  4XKW A;  5F64 A;  3ZR1 A;  4ASN A;  4YFK F;  3LSH A;  2R7O A;  2IS6 A;  2ESH A;  1UB9 A;  3P9K A;  4BXU A;  3GFL A;  3O69 A;  1MNE A;  3TL4 X;  4L5J A;  1OW2 A;  2DA3 A;  4CYC A;  2LTP A;  4A6D A;  3SDG A;  4EEF G;  5DM7 F;  1PPW A;  2NVY J;  1IRY A;  1R4M B;  1X19 A;  4EJU A;  2DSD A;  2PNY A;  2QQ9 A;  2EFP A;  4UNO A;  4KYW A;  1RET A;  3OL3 A;  3EF5 A;  2VQC A;  5J8F A;  3ZQI A;  5IY5 H;  3HHJ A;  2PFB A;  3GBG A;  5DCM A;  2Z33 A;  4DYQ A;  2ZJ2 A;  1J59 A;  2EZL A;  2IGO A;  2IW5 A;  4M73 A;  4M72 A;  5BPI A;  3S8P A;  1EV7 A;  3KCC A;  4E7I A;  4UB8 C;  5FKN A;  2VC0 A;  4CUG A;  2FMY A;  3FXJ A;  1D5V A;  3GG6 A;  1I6X A;  1ZG5 A;  1KU2 A;  2L54 A;  2VKV A;  1IGN A;  3OYL A;  1T0F C;  3OYC A;  1TZL A;  2HYF A;  3P5T A;  2RAE A;  5FSO A;  1J0R A;  1XSC A;  5LPG A;  3PFY A;  4HG2 A;  2KIS A;  1IC8 A;  2VJI A;  2ZBK A;  4I02 A;  4U88 A;  4U0W A;  1X2M A;  3U21 A;  2YU9 J;  1IUY A;  5L3C A;  2E2J J;  1NHA A;  3NWT A;  1X3W B;  4AWX B;  5DYM A;  4EGZ A;  2EIK H;  3E57 A;  2PJR A;  2OJE D;  2CFO A;  4E4H A;  2CQ7 A;  1WPK A;  4ENK A;  3HGG A;  5K5Q A;  3GWZ A;  4B09 A;  1DPU A;  1P2F A;  2E2I J;  4F55 A;  2GIV A;  3CCY A;  1Q54 A;  4E7K A;  3IKT A;  3H5N A;  1OCR H;  5C4X J;  3K10 A;  5AIP A;  4FTH A;  4PK4 A;  1KGS A;  1R1T A;  1HST A;  1N25 A;  2IA1 A;  3OGA A;  2FSW A;  2GOM A;  3LA2 A;  1OKR A;  4HPQ A;  3QQA A;  3MEX A;  3AL0 B;  4OIQ F;  2Y9Z A;  4KTB A;  2L7Z A;  4X1E A;  4QLC U;  3F6O A;  4DIQ A;  2NVT J;  4XKV A;  1TWH J;  3OYB A;  2FML A;  1B72 A;  1E3H A;  3KE2 A;  2VE8 A;  1V5E A;  4K2E A;  4IKF A;  4K6E A;  3BCB A;  3GZ8 A;  3CCR I;  1JGG A;  4KDP A;  3CJN A;  3M8F A;  4AM3 A;  3BQY A;  1YRN A;  2XDV A;  3ABL H;  1UJ8 A;  5J1Y A;  2OA4 A;  3HGY A;  4BE0 A;  1HC8 A;  3W2A A;  4HVY A;  4I0A A;  2WC2 A;  5CQG A;  1JTY A;  4F93 B;  4ENN A;  5JLW A;  1RR8 C;  4ABZ A;  2Y30 A;  2OD5 A;  1Q33 A;  3FXO A;  2IA2 A;  3CDH A;  3JR9 A;  1IW7 F;  3EET A;  1Y1W J;  5EDN A;  1QRY A;  1X84 A;  2H1L A;  4S0H B;  4AVP A;  1YJ9 I;  1T56 A;  1XD7 A;  2L7F P;  2VC1 A;  2HKO A;  2A68 F;  1VC8 A;  1G3S A;  1PYV A;  3E6M A;  1KYW A;  1D1A A;  2IS1 A;  2GT4 A;  3BTL A;  4RM3 A;  4FE4 A;  1W5T A;  4M3D A;  1UFM A;  1ERD A;  3IH4 A;  1FP1 D;  3HJE A;  4UV8 A;  3IAM 2;  2HTS A;  1HDD C;  2DI3 A;  4CZC A;  4BKX A;  5DDG A;  3HZJ A;  2M4K A;  3RKY A;  1FIP A;  3VYR B;  4OIR F;  3EPZ A;  5IYC J;  5LLQ A;  1J75 A;  2GLO A;  5E20 A;  4EM2 A;  3H36 A;  1D5Y A;  1P4X A;  3RYP A;  2VKE A;  3V42 A;  3KZY A;  2X1C A;  3SXY A;  4E7L A;  4C3J J;  1L0O C;  5FKK A;  2OQG A;  3GFI A;  3CO6 C;  4BUP A;  4BDZ A;  2OTJ I;  1PPX A;  3ZMV A;  4II2 A;  5J4Y A;  3L09 A;  3X0S A;  2P0W A;  1B59 A;  1YW9 A;  3R0J A;  3BR1 A;  3ABK H;  3FBI B;  2JZY A;  4XRS G;  1GUU A;  3FZV A;  3LSP A;  4A3M J;  1R5H A;  2Z9O A;  3M1E A;  5CKT A;  2XF7 A;  4EJW A;  3FHZ A;  2HOE A;  3BR3 A;  3WU2 C;  2VAS A;  2GXG A;  1YG2 A;  3ZRG A;  3TP3 A;  1K26 A;  1YQA A;  2IBD A;  5IOZ A;  5C4J J;  3MCF A;  5E3N A;  4D9J A;  1MH4 A;  4MHG A;  1DUX C;  2MLK A;  4KNY A;  1R7J A;  3KP5 A;  3WGG A;  2H6C A;  2OBP A;  2HWV A;  4CO8 A;  2IXS A;  2JN6 A;  3HUG B;  3LAJ A;  1VQ6 I;  5ANS A;  3CQZ J;  4I99 C;  2PMZ N;  1FLI A;  3Q1P A;  3ZN1 A;  1H9G A;  5JI6 A;  1ZAR A;  4XNF A;  4KG3 A;  2K27 A;  3T1B A;  2K7L A;  4UUV A;  1IDZ A;  5DUI A;  1AOY A;  5C7T A;  3LSI A;  3CCS I;  4IPA A;  1XCV A;  4J01 A;  2NVX J;  2Q2E B;  2A6E F;  3OV8 A;  4BAC A;  1T08 B;  4XK4 A;  5JVG F;  1TLH B;  5FD6 A;  3F72 A;  3HOY J;  2LP0 A;  2XSJ C;  2GBY A;  3KP2 A;  3MMY B;  2JVH A;  1ZGA A;  4RGS A;  3O61 A;  2QEN A;  5D8K B;  4BE1 A;  2AZW A;  2NOG A;  5GTI C;  4IX7 A;  3OSG A;  3HSF A;  2G9W A;  3JTH A;  4HF0 A;  5H20 A;  3CME I;  5B5E C;  3E3V A;  1OIS A;  2FQ3 A;  2VBY A;  2MFZ A;  1TQP A;  3DKW A;  3PL8 A;  5GPA A;  5HLT A;  3ZOB A;  3TP0 A;  4Q48 A;  5M5X J;  5F1R A;  2VT3 A;  1QGP A;  4G6D A;  3COA C;  1P4A A;  2E7X A;  3WTY C;  2O8K A;  2M9H A;  2VJ5 A;  1B8I A;  3KP7 A;  2X6X A;  2EZK A;  3HTU A;  2AS5 F;  2CZR A;  2HDD A;  1ZKG A;  2DT7 B;  3CCL I;  1VCD A;  2K3F A;  4N9I A;  1Z6R A;  1X1B A;  3J7Y J;  2V1N A;  2XF5 A;  1E3O C;  5C44 J;  3QWL A;  4ZYD A;  3GZ6 A;  1YOV B;  1FT9 A;  2RVC A;  5C7Q A;  2R7W A;  3CC4 I;  4UV9 A;  2W1O A;  1GDT A;  1FOW A;  2NVQ J;  2B0V A;  1L3L A;  3RYR A;  2XAQ A;  2DSB A;  1HQC A;  2HS5 A;  2O7O A;  3HKZ A;  4RLF A;  4AID A;  1G3Y A;  3S3M A;  2UXN A;  5KCM A;  2LKX A;  1U3E M;  3BJ6 A;  2IS4 A;  1Z6T A;  1FMW A;  2VKD A;  4HF2 A;  1SC7 A;  4IQ4 A;  1JHF A;  2HVQ A;  3OR2 C;  1S9H A;  3O8G A;  3RDI A;  2MLG A;  3TBI A;  1FYK A;  3I5U A;  1IF1 A;  1K79 A;  3HKZ N;  3E1S A;  3FMR A;  1Z1D A;  3TOB A;  1JE8 A;  2WA0 A;  1C0W A;  4NFW A;  1A6I A;  3ZGK A;  4DJA A;  2YS9 A;  5LHG A;  2V79 A;  4GYI A;  3HOW J;  1O3T A;  4CCO A;  3H1C A;  2LF7 A;  3LMM A;  4BQA A;  3I4M J;  4C3I J;  1MJA A;  2LMD A;  4N9H A;  2EIJ H;  3O8H A;  2DFH A;  5F27 A;  2E36 A;  3GX4 X;  2DYR H;  2EZH A;  3W3C A;  1ZRE A;  4Q5S F;  3E7L A;  1DGR M;  2HQ5 A;  5C8L A;  1CQT A;  2QBY A;  2DOF A;  3KYL A;  2QGU A;  5JHU A;  2B9S A;  1SFO J;  2A6H F;  1VQ4 I;  3FIW A;  2JA2 A;  1O7L A;  1V8N A;  1EKE A;  3HL2 A;  4PJJ A;  4M6X A;  5CFJ A;  3NAR A;  2BY3 A;  1N78 A;  2RQQ A;  3Q5F A;  1VQ9 I;  3QP6 A;  5BON A;  4GFB A;  4RGX A;  2YSR A;  3FM5 A;  1ZGW A;  2V9P A;  3CJQ B;  1YI2 I;  3TGN A;  3PNV A;  1HSJ A;  3SZP A;  1XGN A;  1WRJ A;  1UAA A;  2DMN A;  3K2A A;  4XSX F;  3GLL A;  3LST A;  1MZB A;  2DU9 A;  1QO0 D;  1IXC A;  2B2K A;  3H95 A;  3SMD A;  1Z9C A;  1AKH A;  3FDY A;  3WTX C;  1QBJ A;  3F8M A;  2ZKZ A;  4LG0 A;  5IP9 J;  1TWC J;  1V8S A;  3F9K A;  5L3F A;  2YX7 A;  5CVR A;  1ZGJ A;  1JJ8 C;  3T5X A;  1VQK I;  4DYC A;  2X9D A;  3COU A;  2XRN A;  2A69 F;  4BQO A;  5LEJ A;  1A31 A;  3EUK L;  3TO7 A;  3HYI A;  3IP4 B;  1MR2 A;  3BG5 A;  1BC7 C;  1H89 C;  1OR7 C;  1H9T A;  1WJ5 A;  4RMN A;  4ON0 A;  2LNB A;  1YJW I;  5A2Q Z;  1NH3 A;  3BQZ A;  4DYR A;  3K1P A;  1WJC A;  5F0H A;  2QEX I;  3O52 A;  2I6K A;  5EF6 A;  1HX3 A;  2XPU A;  3QP5 A;  2FD5 A;  3OYM A;  1USS A;  3RQI A;  3ZXS A;  3G1O A;  3HRS A;  1MDM A;  3X0P A;  3DU5 A;  2DOE A;  2HI3 A;  2DDB A;  4PFO A;  2DA6 A;  1WVR A;  1RES A;  3F22 A;  4UXN A;  2FXA A;  5EGO A;  4C2T A;  1MP2 A;  1YIJ I;  1XMX A;  2P81 A;  2ME6 A;  2BVM A;  4MLO A;  2Y2Z A;  3F21 A;  3NWS A;  2K02 A;  1ITY A;  3GW2 A;  3DTE A;  1V55 H;  4IRH A;  4S04 A;  2HZD A;  1ETY A;  1G6N A;  1SAX A;  4BNC A;  4C2M J;  2YVP A;  4UY8 I;  2HR3 A;  3BM4 A;  1IG7 A;  1RYA A;  5F08 A;  2BY2 A;  2FOK A;  3NRV A;  2BOL A;  2Y31 A;  5K5R A;  1RUN A;  2KDW A;  4V2F A;  4AVZ A;  2PJP A;  1MQW A;  3HSE A;  2FVV A;  1ETV A;  4NQW A;  2DDA A;  1ZN2 A;  3HXL A;  2L4A A;  3H3V K;  3PO3 J;  5GHP A;  1TT0 A;  1I50 J;  2EV5 A;  2KRH A;  1ZLJ A;  1S7E A;  3GWY A;  1ENH A;  2RN7 A;  2X1D A;  4NNJ A;  3QOD A;  1U2W A;  2ZNY A;  1WQ2 A;  2M45 A;  4PFP A;  4RB0 A;  2A3S A;  1QZE A;  5BMZ A;  1KU9 A;  1HKS A;  4HNV A;  5HS9 A;  2QQ8 A;  4AIK A;  3K1N A;  1RUO A;  3O8S A;  2FBK A;  2TRT A;  2LF8 A;  2L9S A;  5B1B H;  3G4S I;  3K9T A;  1FEX A;  2CW8 A;  1T98 A;  3JRA A;  1W7P A;  5A2Q K;  3CMY A;  3E6B A;  1SFU A;  4WF2 A;  2L5Q A;  5EG0 A;  2QSG X;  3EYI A;  2OZU A;  1U0J A;  1G3T A;  1TWG J;  1EA3 A;  1JTX A;  2WTE A;  2EBI A;  4JQF A;  3G0Q A;  2VN2 A;  4CYC B;  2HTJ A;  1HKQ A;  1RR7 A;  4ENM A;  4IF4 A;  2A8T A;  3E6D A;  1QPM A;  3WTV C;  2UZK A;  4HF1 A;  4A69 C;  3DTI A;  1I6H J;  1X58 A;  4E7Z A;  5BOX A;  2R93 J;  5LFA A;  1IN7 A;  1TW3 A;  4KUM A;  4KMU X;  3EUH C;  5DCM B;  1VQ7 I;  1HKT A;  1TQI A;  1Y39 A;  1QA6 A;  5DCF A;  5KNL A;  3D5R C;  3VOE A;  2L3D A;  3NQO A;  4QIW N;  3M4O J;  1MD0 A;  3A2K A;  1EF4 A;  3G2B A;  3OYH A;  3MKZ A;  1K78 A;  3CUQ A;  3S2W A;  4KYX A;  3L2V A;  2LR8 A;  4ITV A;  3HSR A;  4F3Q A;  4IHS A;  2O5F A;  2NS8 A;  2Y9Y A;  4S2W A;  3F8F A;  1R4N B;  2E60 A;  4OIP F;  3Q2S A;  3F3X A;  2WAD A;  2HGC A;  3QYB A;  4L5I A;  3CMM A;  2LY1 A;  4KIG A;  4NUB A;  2XB5 A;  4IQJ A;  2DQR A;  4OAY A;  1HW1 A;  3LA7 A;  1W5C C;  1K4T A;  4IRI A;  2OV7 A;  5DUK A;  1YX3 A;  1ZAO A;  2GZW A;  2ELJ A;  1RKW A;  2LK2 A;  3FMS A;  2DN0 A;  3E5Q A;  3TMO A;  1VRL A;  1JKP C;  4N0B A;  3MKY B;  3BG9 A;  3G73 A;  2EH3 A;  2OPT A;  1XSA A;  2HFH A;  2MC3 A;  2O5W A;  2QYO A;  2IVM A;  4E7J A;  3VWB A;  5FSK A;  4HV6 A;  1IRG A;  2F5E A;  2HQA A;  3ERM A;  2W4E A;  2PI0 A;  2ZJQ F;  2B7E A;  2O0Y A;  2W84 A;  1YO5 C;  1X51 A;  2R7D A;  3EDP A;  1SEU A;  3X0N A;  1PVF A;  2LG4 A;  3RPU D;  3K4B A;  5LGN A;  2ZJR F;  2MH9 A;  2V1D A;  3HOT A;  2WAQ N;  4CXF A;  1ZH5 A;  3KLO A;  3ERE D;  2DCE A;  2KZG A;  1NG7 A;  3K4M A;  3U9G A;  2BW3 A;  1B72 B;  4JP0 A;  4D5C A;  4HLY A;  2QJO A;  2IEK A;  3A0H C;  2KIF A;  1U5T C;  2RRE A;  1D0X A;  4A3J J;  4LOC A;  2O03 A;  1WI3 A;  5EEA A;  3DBR B;  3V7S A;  3VOD A;  3FXU A;  3NAU A;  5HS8 A;  1WH5 A;  1ETQ A;  4XSZ F;  3IWZ A;  2BEO A;  4LG3 A;  4IO9 F;  4Y15 A;  3SZG A;  3HB9 A;  4YG2 F;  1FY7 A;  1MBH A;  1YW7 A;  2CH0 A;  4L9V A;  4YEJ A;  2PEX A;  1OPC A;  5HOD A;  4DW6 A;  2ID3 A;  3I4N J;  3LAP A;  5D5U B;  1G0S A;  1KON A;  4XOT A;  4E6K G;  2CWE A;  2EIM H;  5HLH A;  3GXO A;  1YIT I;  5GHJ A;  2BXZ A;  3FM3 A;  2Y0S A;  1BIB A;  1Y8R B;  3CCV I;  2R7U A;  2YVN A;  4FAS D;  4OMY A;  4MQ9 F;  3A4C A;  1B9M A;  3M9A A;  3NEU A;  1OYY A;  3VYS B;  1W36 D;  1LEB A;  4OMZ A;  1PP8 F;  3MGM A;  1HBX G;  2CU7 A;  1QHG A;  4IOC F;  3S2H J;  1XN7 A;  1IRX A;  5L3D A;  3H5A A;  1KA8 A;  1GVJ A;  1YFH A;  3T8T A;  2MD0 A;  3S1R J;  1VTN C;  5IT9 Z;  2EJR A;  4IXA A;  1P6R A;  2QF7 A;  1IRZ A;  4OIO F;  3LFK A;  2E1M B;  2JPC A;  2VBW A;  2DT6 A;  4A3L J;  5FSM A;  4R8H A;  5HNF A;  3L9F A;  4AD9 A;  1PUF A;  2K40 A;  3SZT A;  2FQ4 A;  2XC7 A;  2UUZ A;  1HF0 A;  1WHU A;  4EJT A;  4D7M A;  2L4M A;  4CCL A;  2P5K A;  2XRL A;  2HDC A;  1V8L A;  3BCA A;  2CSO A;  5H6Q A;  4XQF A;  1RI7 A;  2HVS A;  2NNN A;  2XGC A;  2XAF A;  2VOD A;  2M34 A;  4I2O A;  1LJ9 A;  2KDZ A;  2J8Q A;  5K1Y A;  3KLN A;  1X1P A;  3LA3 A;  3BPV A;  3I59 A;  2ZXW H;  3O2P E;  5L3B A;  4CCK A;  3L2C A;  3T8R A;  2ZSH B;  1T8I A;  3U1K A;  5GAH J;  4RGU A;  2MBF A;  2GQQ A;  4LB6 B;  3TDU C;  5D5W B;  3CDI A;  1DDN A;  5CLS A;  1CGP A;  3HDD A;  1I3A A;  2MYS A;  3O6B B;  4C2U A;  1LFU P;  4LIT A;  1MMG A;  1Z67 A;  2DYS H;  3V7C A;  3A6U A;  2Z1D A;  3WE3 A;  4A0Y A;  1BW6 A;  3X0O A;  1F43 A;  2R5W A;  3WTW C;  3GTM J;  2HYG D;  4A2U A;  1MBJ A;  5TRD A;  2F4M B;  5EZG A;  4A12 A;  1R36 A;  3ZMZ A;  4X0G A;  2R7S A;  5E79 C;  1AU7 A;  1E3P A;  5M5Y J;  1VIQ A;  3CUQ C;  1FMV A;  1RRS A;  3GEZ A;  1X3U A;  1Y56 A;  5DD8 A;  4CHU A;  2JWT A;  1VHZ A;  2XHK A;  4KG4 A;  4KIF A;  2M8E A;  3QPT A;  3S32 A;  5E3O A;  2VNQ A;  4C9W A;  4M71 A;  4UUS A;  2F5D A;  2K85 A;  4G7H F;  2E5N A;  3OOU A;  3SEQ A;  1A5J A;  2IRF G;  2MW8 A;  3BJO A;  3K2Z A;  1ZG1 A;  1AWC A;  5EEG A;  3C3W A;  1K4S A;  2A5W A;  2IT0 A;  5IT9 K;  2GT2 A;  4L18 B;  2L02 A;  3Q9S A;  1YX5 A;  4W97 A;  3KYC B;  4ZYG A;  4P9U A;  4PZJ A;  3U1D A;  3IRQ A;  4KFC A;  1W5S A;  3SFZ A;  2JT1 A;  1GV5 A;  4BHB A;  1MBG A;  1GHC A;  2BVL A;  5IPA A;  3PNY A;  4B44 A;  2R5Z A;  2IAI A;  4ZYE A;  4G94 A;  4JZV A;  2ZME C;  4MFD A;  1POG A;  2XKP A;  2M1B A;  5KVR A;  3A03 A;  3KYD B;  2HPM A;  1M1E B;  1BI0 A;  2DXI A;  2NVU B;  5FKL A;  1Z91 A;  4X6A J;  4YEL A;  1U20 A;  1MND A;  3S3O A;  3BY6 A;  2HEO A;  6PAX A;  2LSO A;  2ECB A;  1JUM A;  4BJ5 C;  2ME0 A;  3BP8 A;  3EXQ A;  3R0A A;  3MDI A;  4ENJ A;  2W00 A;  2JSC A;  4A3K J;  2PBI A;  2P5V A;  2RRK A;  5FO5 A;  2VIX A;  2ZO4 A;  3ZQC A;  2MG4 A;  3SJM A;  4BQN A;  4Z6Y A;  5J1U A;  4OIN F;  3P9C A;  1QPI A;  5LRS A;  2AQF A;  3REO A;  2V6E A;  3JSO A;  2K86 A;  2DAO A;  2F5C A;  2A07 F;  2D45 A;  4MEY F;  1ETW A;  4KN7 X;  3L2R A;  5DPK A;  1WH7 A;  4B3X A;  2CUF A;  2I5U A;  5ICF A;  4ZDL A;  1XSV A;  3DLA A;  3VYT B;  2KDO A;  5JHF A;  1RKT A;  2HXO A;  1F36 A;  5IYB J;  4ANJ A;  1PJR A;  4PDK A;  1P92 A;  2Q8K A;  4XLP F;  3GTG J;  2ZB9 A;  5IW5 A;  2F5V A;  5HZX A;  3JRI A;  4GXO A;  1JJ6 C;  2D1H A;  3N05 A;  1Y0N A;  2RGV A;  3DP7 A;  2CL3 A;  1VI0 A;  3M3Y J;  2DFI A;  2P7V B;  3S3N A;  4CSW A;  5E1X A;  1JUP A;  2STT A;  1WGX A;  3H9J A;  2EZI A;  4QPO A;  2P5L C;  3OYE A;  5BS6 A;  3ABT A;  1I1S A;  3CNG A;  3OS0 A;  3OIP A;  1SFK A;  2NNY A;  3CZ6 A;  3K70 D;  4BYY A;  1I5Z A;  3KFW X;  3BR5 A;  3CUO A;  4HYE A;  5HDN A;  1W36 C;  4A3G J;  2KRC A;  2QKL B;  5D6F A;  1G59 A;  5L3E A;  5AON A;  4PJ0 C;  1IN4 A;  4XN3 A;  4N1U A;  3K7A J;  2BZT A;  2QBY B;  3F6V A;  2Z16 A;  5EZH A;  1FJL A;  2HDW A;  1V8Y A;  3O6Z A;  2LRE A;  2VON A;  4JX6 A;  1G3W A;  4WXD A;  1QQI A;  3E6C C;  1GXP A;  1ZLK A;  3I53 A;  3QPH A;  2FNA A;  2H8W A;  3ZMU A;  5ICC A;  3H92 A;  3MZ8 A;  3BG7 A;  1ONV A;  1ZR4 A;  2Q1Z B;  3DUP A;  3E5U A;  1O7F A;  3Q91 A;  2P8T A;  3HRT A;  1X1D A;  1FPQ A;  3LSG A;  4BH9 A;  1LFP A;  3VSK A;  3EQL F;  2LYC A;  5ANU A;  3N77 A;  1TNT A;  1WFX A;  4HQE A;  5GHM A;  3SDB A;  3DF8 A;  4FIS A;  5FKM A;  4A0X A;  2M3A A;  5FB2 A;  3WGI A;  2G7H A;  2NYX A;  5GAG J;  5J1R A;  3UKG A;  4XRM A;  1R9T J;  3J7A O;  1AKH B;  2X6Y A;  1ZQ3 P;  2M2E A;  4L9J A;  4LIV A;  5JVT A;  1JKO C;  2Q9P A;  1WJF A;  4EJV A;  3C2H A;  5C3E J;  1JI8 A;  2WY7 Q;  4IHX A;  1S72 I;  5E17 F;  4M3G A;  2I10 A;  2QWW A;  2YU3 A;  1OR7 A;  2GIZ A;  2O5R A;  2ELH A;  2ZXJ A;  1PDN C;  2AQE A;  2Q0O A;  4XIC A;  1NQZ A;  4ZTJ A;  4F92 B;  2UXX A;  1KQ0 A;  3PFI A;  2FJ1 A;  1Y0U A;  4PJN A;  4ILQ A;  3ZQ7 A;  3FK9 A;  2X1E A;  2CQX A;  2CO5 A;  2H6B A;  1BBY A;  2O9L A;  2K9Q A;  1MMA A;  5DEQ A;  4RB2 C;  4BS9 A;  1V8T A;  2JUC A;  4KT5 C;  1DPR A;  5H2F C;  4HQM A;  1F3Y A;  1GVD A;  3PQK A;  5GAD J;  1EH8 A;  3FCM A;  3CCE I;  4CCJ A;  2H1K A;  1EH7 A;  2XGX A;  2XAH A;  4M3E A;  3G71 I;  4BDY A;  5GHN A;  1REP C;  4BJT A;  5FSN A;  3S17 J;  1MMS A;  4IRG A;  1VQM I;  1UST A;  4B47 A;  4LGW A;  2E1C A;  4C9Y A;  4XM3 A;  1D1C A;  2OUM A;  4FET A;  1BA5 A;  3BPX A;  5KAI C;  3I0T A;  1NFZ A;  1W1W E;  3A02 A;  1RNL A;  3VFZ A;  1K6Y A;  3X0M A;  1YJN I;  3IC7 A;  4UHT A;  1H0M A;  2AO9 A;  1FP2 A;  3DLL F;  3PJR A;  1IN8 A;  3KX2 A;  1X83 A;  3LSK A;  3ZQH A;  9ANT A;  1JXS A;  4LB5 A;  2ISY A;  4XLN F;  1MJ9 A;  1Z7L A;  4RB1 A;  3LSR A;  2WWY A;  4BU2 A;  1VF9 A;  4CDG A;  2X51 A;  1MSE C;  4XKB A;  3OS2 A;  3CLO A;  3Q0U A;  1LDJ A;  5J8C A;  3TW7 A;  2W4S A;  2FU4 A;  1SU2 A;  3LSJ A;  1YS6 A;  2O3F A;  3RH7 A;  2XPW A;  2VXD A;  2AXL A;  4IOA F;  2VBX A;  5FFZ A;  1T39 A;  2JA8 J;  4JZT A;  1GLN A;  3KEY A;  1O3R A;  1V8V A;  2JUG A;  1FBU A;  1U9N A;  4M3B A;  3FXM A;  2DO7 A;  2Z99 A;  2DMT A;  3WTU C;  2B06 A;  2OC6 A;  5HLI A;  3GRN A;  4HW0 A;  3BWG A;  1WZ2 A;  3FBN B;  4NBQ A;  3BAP A;  2GWR A;  1P9Q C;  3CP8 A;  1BL0 A;  3QU3 A;  1K7A A;  1V8R A;  1WJB A;  1H88 C;  2JQ7 A;  2M4G A;  4KIT B;  1D1B A;  2PQV A;  5TIS C;  4V14 A;  2G0E A;  3DCF A;  3B6C A;  4GCV A;  4HRI A;  4RGR A;  1LDK B;  3K70 C;  3ZMS A;  1A36 A;  3EUH A;  1O3S A;  1AA7 A;  2X0L A;  2L9R A;  4P5O A;  2W7N A;  3HOX J;  1XGO A;  4M6V A;  2OAZ A;  3L1P A;  4XMY A;  3FMQ A;  3JSP A;  1U78 A;  3JAM Z;  2DK8 A;  2KIU A;  4A6E A;  3K4L A;  2NRA C;  3HBL A;  4LJZ F;  4QPQ A;  1FOX A;  4EQQ A;  5HDK A;  3RI4 A;  1XC5 A;  1K78 B;  1UEL B;  1FOY A;  3G1M A;  1V8U A;  2F5F A;  1P7I A;  2LBF A;  1FIA A;  3BTC A;  5IP6 A;  4BXF A;  4C30 A;  1V4R A;  3A0B C;  2PMH A;  4YIF A;  2CUJ A;  2CQN A;  2DTR A;  1XMK A;  4LIU A;  4P96 A;  3OL4 A;  4ZDP A;  1VIU A;  4MPO A;  1XGM A;  3L2W A;  3MKL A;  3JRE A;  2FRH A;  2P4W A;  2W85 A;  2ZSI B;  1OCZ H;  2W24 A;  3G3Z A;  4DBR A;  2CV0 A;  2V1U A;  3R4K A;  3U53 A;  3IWF A;  2E1N A;  1E17 A;  4Y3O A;  3W2W A;  3I9X A;  3KVH A;  2MD5 A;  4PGH A;  2FBI A;  3MDG A;  3CCU I;  3FJY A;  3MZY A;  3GUD A;  2M5W A;  3PUF A;  4M9X A;  2CUE A;  3DV8 A;  2HPI A;  1UHM A;  3LSM A;  5J6X A;  2QJT A;  2FE3 A;  1N75 A;  3JRC A;  1LEA A;  3C18 A;  3KEQ A;  5DD4 A;  2ETH A;  1LVA A;  1SVM A;  3TW6 A;  5FGM A;  2JVG A;  3X0J A;  2ZXI A;  1XSD A;  4B1R A;  1NTC A;  1LKX A;  4B3A A;  4MGR A;  3GTL J;  2BW3 B;  4XKC A;  4AC0 A;  3GCM A;  4RBO A;  1TL8 A;  1U5T A;  2WV0 A;  3DXJ F;  2WV1 A;  3HUG A;  3Q0V A;  3SHF A;  4E7S A;  4TV7 A;  1I27 A;  3ZQF A;  1R00 A;  2P7C B;  2GOX B;  2QSH X;  5GHO A;  2V1X A;  2ZXH A;  1TQM A;  2DMQ A;  4M9Z A;  3JAM K;  5D5V B;  4IHT A;  4G7Z F;  3WGH A;  1MBE A;  3GTQ J;  3FF5 A;  4U7D A;  2C6Y A;  4CZZ A;  3QYE A;  3OYF A;  3L00 A;  4XLC A;  2MGQ A;  2R5Y B;  1SAU A;  3AC9 A;  3CLQ A;  2HQN A;  3MN2 A;  4HFQ A;  3OY9 A;  3BHO A;  3E97 A;  4PJL A;  3G6E I;  4YOQ A;  4S2X A;  5TGT A;  3GZ5 A;  3V8J A;  4G8X A;  1F1Z A;  3ZCO A;  4DQ2 A;  5GAE J;  1OCT C;  1V54 H;  3RKW A;  1FC3 A;  1VHG A;  1U6G A;  1R67 A;  4MTE A;  3AKZ A;  3HYQ A;  1HW5 A;  2EA4 A;  4DNC A;  4I6Z A;  2IS2 A;  2JRT A;  5IYD J;  5CQE A;  3BG6 A;  1KQ8 A;  5FLX Z;  3I7U A;  2I8U A;  1E0E A;  1UG0 A;  2ICW G;  3HOU J;  3SON A;  1B4A A;  5L3G A;  3AL0 C;  4JZS A;  3MAJ A;  2F2E A;  3F6A A;  1T95 A;  3J7Y e;  1PUF B;  4P9F A;  1VQ8 I;  2DFF A;  3K4K A;  2IJL A;  2P6T A;  4MQV A;  1SZ3 A;  4N4O B;  3ZR8 X;  4O6J A;  3X0R A;  4CIC A;  1X1C A;  3BR2 A;  2XV4 S;  4IHV A;  2R7X A;  2Y0M A;  1VFC A;  4ETS A;  3OOP A;  4G12 A;  2RNG A;  4II3 A;  4RAF A;  2A05 A;  5LHI A;  2DQL A;  3EEU A;  4HA8 A;  3RQ4 A;  2VPR A;  4XLE A;  2H27 A;  3GFJ A;  5K7H A;  1SMT A;  1OCP A; 
#chains in the Genus database with same CATH homology
 2UUZ A;  4CZC A;  2VQH A;  3K6G A;  2FKB A;  4S2Y A;  4CCL A;  5DDG A;  2M4K A;  1V8L A;  3A1Y A;  3BCA A;  1Y6I A;  3VYR B;  2KMU A;  4XQF A;  4DGW B;  3EPZ A;  3I7V A;  3DEE A;  2HVS A;  1WJD A;  3V42 A;  4U87 A;  2X1C A;  4E7L A;  5KHD A;  3CJR B;  2J8Q A;  3K4N A;  3IUO A;  4CCK A;  2ZSH B;  2E1M C;  4XOR A;  4BUP A;  4BDZ A;  1PPX A;  3OYI A;  3FFU A;  4II2 A;  2KP6 A;  3X0S A;  2IGM A;  2P0W A;  4C2U A;  2WB1 A;  5FSL A;  1X1A A;  2MYS A;  3MKW B;  4LIT A;  1MMG A;  3FBI B;  2A8R A;  3DQV C;  3A6U A;  1R6R A;  2Z1D A;  3UR3 C;  4KIS A;  2WBM A;  3X0O A;  2R5W A;  5CKT A;  2XF7 A;  1PPV A;  2KPM A;  2VAS A;  3OYD A;  3ZRG A;  1K26 A;  4CCM A;  3OIQ A;  4X0G A;  1D0Y A;  3MCF A;  1DGW Y;  2R7S A;  2VLA A;  4D9J A;  3H9G A;  4ZTF A;  4HNU A;  3DKX A;  2CV2 A;  1VIQ A;  2PJR B;  5ANV A;  3N9U A;  4Y33 A;  1FMV A;  1RRS A;  3A6S A;  2CW7 A;  1Y56 A;  2IXS A;  1VHZ A;  2WY8 Q;  1K2E A;  3S32 A;  1TUM A;  2VNQ A;  2DHO A;  4KG4 A;  3HUG B;  4AU7 A;  4C9W A;  3WHW A;  5ANS A;  5CPR B;  2E5N A;  3OOU A;  3SEQ A;  3Q1P A;  4YRV A;  3SEZ A;  4ICK A;  2A5W A;  4NC8 A;  2GT2 A;  4XNF A;  4BE2 A;  2M7A A;  2DUK A;  4KG3 A;  1YX5 A;  1WJA A;  3CES A;  2WAF A;  4AYB A;  2VXZ A;  2V7F A;  2Z2S B;  3H35 A;  3I9V 2;  4OWR B;  5C7T A;  2CUZ A;  3LSI A;  2BVL A;  3OYG A;  4J01 A;  3PNY A;  4B44 A;  2Q2E B;  4BAC A;  2VKH A;  4JZV A;  2L9N A;  1N77 A;  2A6T A;  3HG9 A;  3MD2 A;  1V8W A;  2I8T A;  2HPM A;  2XSJ C;  2R7V A;  2G74 A;  1RRQ A;  2DXI A;  3MMY B;  4YEL A;  1U20 A;  1MND A;  4N1T A;  2JVH A;  3S3O A;  3O61 A;  3CF2 A;  4BE1 A;  2AZW A;  1KT9 A;  4OAZ A;  4BJ5 C;  4IX7 A;  2VL8 A;  1PUS A;  3DKU A;  3EXQ A;  3MDI A;  2W00 A;  2MAB A;  2YVO A;  2DOA A;  2RRK A;  2VIX A;  1BR2 A;  2XSQ A;  2MFZ A;  2KHM A;  4BQN A;  3PL8 A;  3P6Y A;  5HLT A;  4BJ6 C;  1G9Q A;  4J00 A;  2AQF A;  1V5F A;  2UV1 A;  2V6E A;  3Q4I A;  4MPO A;  2VJ5 A;  2X6X A;  4ZC3 A;  2CZR A;  3L2R A;  2DT7 B;  5FSI A;  5DPK A;  1VCD A;  4B3X A;  4ZDL A;  1X1B A;  5FRM A;  4JZU A;  2V1N A;  3DLA A;  3VYT B;  2KDO A;  2XF5 A;  4BEH B;  4ANJ A;  4BGD A;  5JHF A;  1PJR A;  4HST A;  5IW5 A;  2XF6 A;  2F5V A;  5HZX A;  5GHI A;  3N05 A;  3GZ6 A;  2K9M A;  2CV1 A;  5C7Q A;  2R7W A;  3RSN A;  2W1O A;  2CL3 A;  3S3N A;  2DSC A;  2B0V A;  3UNG C;  4CSW A;  4XL9 A;  2CS3 A;  2DSB A;  3H9J A;  3HKZ A;  4GRI A;  4BEH A;  4RLF A;  4HNT A;  4QPO A;  3S3M A;  3OYE A;  5KCM A;  3RTR A;  5BS6 A;  2ICK A;  3CNG A;  3OYJ A;  2IS4 A;  1FMW A;  2VKD A;  3OS0 A;  2FUG 2;  2KDV A;  1NQY A;  3OIP A;  4IQ4 A;  3SYT A;  1SFK A;  3OR1 C;  2HVQ A;  3OR2 C;  4ZG0 A;  3CZ6 A;  3K70 D;  1S9H A;  1DQU A;  4F52 A;  3TBI A;  3D5S C;  3LFU A;  1W36 C;  2KRC A;  2LC2 A;  3BC8 A;  2QKL B;  1SJY A;  1G59 A;  3LL7 A;  2M7B A;  3OYN A;  3E1S A;  2M0M A;  2WA0 A;  2VJJ A;  4IZZ A;  4XN3 A;  1X4P A;  4N1U A;  4NFW A;  3ZGK A;  4DJA A;  2A8Q A;  2Z16 A;  1V8Y A;  3O6Z A;  2HDW A;  2WAE A;  3E0J B;  2LRE A;  4CCO A;  3LMM A;  3X0I A;  4XN0 A;  3ONQ A;  4XOP A;  3HC7 A;  5IW4 A;  2KLO A;  3EUA A;  4P1W A;  3BG7 A;  3W3C A;  3HPH A;  4EAT A;  2Q1Z B;  2F6C A;  3DUP A;  3L85 A;  1DGR M;  5C8L A;  3Q91 A;  3S93 A;  3KYL A;  1OLT A;  1D0Z A;  2K5C A;  1X1D A;  2HVR A;  2LRD A;  4J7H A;  3LSG A;  2JA2 A;  2I8D A;  2L2O A;  4BL0 B;  1V8N A;  1LFP A;  3C2G A;  3RCO A;  3QOE A;  3HL2 A;  2LY2 A;  1X4O A;  3VSK A;  4PJJ A;  2LYC A;  5ANU A;  5CFJ A;  3N77 A;  1N78 A;  1WFX A;  2E5Z A;  5GHM A;  1V8I A;  3SDB A;  3X0Q A;  2RQQ A;  4DBQ A;  4G6T B;  2M3A A;  5BON A;  2L7K A;  5ANW A;  3HOS A;  2X6Y A;  3CJQ B;  3PNV A;  2VQL A;  4LIV A;  3ZR0 A;  2Q9P A;  1WJF A;  3C2H A;  3H5R A;  1UAA A;  2WY7 Q;  1JI8 A;  3Q2T A;  1VC9 A;  3FSP A;  3AFH A;  4H4K C;  1KHZ A;  2O5R A;  2B2K A;  3H95 A;  1MMD A;  3SMD A;  2AQE A;  3FDY A;  3M8J A;  1NQZ A;  1BR1 A;  4ZTJ A;  4F92 B;  3OMY A;  5ISY A;  3QYF A;  1V8S A;  4ILQ A;  4PJN A;  1I9A A;  3F9K A;  3FK9 A;  2X1E A;  2R7R A;  3COU A;  5DEQ A;  1MMA A;  4BQO A;  4BS9 A;  1V8T A;  3EUK L;  3BLY A;  3IP4 B;  3L2Q A;  1MR2 A;  2F4I A;  1F3Y A;  1OR7 C;  2GB5 A;  3FCM A;  4CCJ A;  1WJ5 A;  1MK1 A;  3W2V A;  4RMN A;  4BDY A;  3PSI A;  5GHN A;  2WAQ A;  4BJT A;  1HA8 A;  5FSN A;  1WJC A;  4B43 A;  4D1Q A;  4XLA A;  5HNH A;  4DYW A;  3O52 A;  2I6K A;  4ZJZ A;  1HX3 A;  4Y4R A;  4B47 A;  3OYM A;  5HOO A;  2IGK A;  1Z3Y A;  3ZXS A;  2DJI A;  4C9Y A;  3PSF A;  4PUS A;  3DPL C;  3DU5 A;  3X0P A;  4YPR A;  4XM3 A;  1D1C A;  4PFO A;  2OUM A;  4R79 A;  4FET A;  4C2T A;  1MP2 A;  1NFZ A;  1MUT A;  2A8P A;  2R7T A;  2K3P A;  2BVM A;  4MLO A;  3NWS A;  1K6Y A;  3X0M A;  3DTE A;  2YYH A;  3PNT A;  4NC7 A;  4PJM A;  2HZD A;  3PJR A;  3KX2 A;  1X83 A;  3LSK A;  3EES A;  2YVP A;  2XC7 A;  3BM4 A;  3D5L A;  1RYA A;  1Z7L A;  4KT6 A;  4BU2 A;  2BOL A;  4XLF A;  2X51 A;  1QHH D;  4XKB A;  2KDW A;  3OS2 A;  4N4N B;  4AVZ A;  5HVQ C;  3ID9 A;  1MQW A;  2VJ4 A;  4S2V A;  2FVV A;  1KTG A;  2W4S A;  1SU2 A;  4RM2 A;  3HXL A;  1XSB A;  4F91 B;  2VB6 A;  2V9K A;  2HNH A;  3RH7 A;  3VYU B;  5GHP A;  4J7G A;  1TT0 A;  2VXD A;  3HPG A;  2KRH A;  3M1C A;  3GWY A;  2X1D A;  2VPL A;  5FRO A;  2G73 A;  4NNJ A;  3R03 A;  2VQG A;  1GLN A;  1VZ0 A;  3KEY A;  3QOD A;  3OYA A;  2LH9 A;  4ZDO A;  1V8V A;  2JUG A;  4PFP A;  3FKJ A;  3X0K A;  1NG6 A;  3DTK A;  1VK6 A;  2B06 A;  4CCN A;  3X0L A;  2OC6 A;  3GRN A;  3O8S A;  4YPH A;  3DWL E;  4U7B A;  2O1C A;  3FBN B;  2L9S A;  5LD2 C;  3BAP A;  4XON A;  1P9Q C;  1NFS A;  3CP8 A;  2R7Q A;  4C9X A;  1G8X A;  2KL4 A;  2XAU A;  3OS1 A;  1V8R A;  4CH7 A;  2CW8 A;  1WJB A;  1V8M A;  1Q27 A;  2M4G A;  1GA7 A;  4KIT B;  1D1B A;  2PQV A;  1J09 A;  4HEA 2;  4V14 A;  1LVK A;  4XR6 A;  1V5G A;  3PUB A;  2L5Q A;  4HRI A;  1LDK B;  4RLQ A;  1DP3 A;  3K70 C;  4IJX A;  1Z21 A;  1U0J A;  2ICJ A;  1EA3 A;  1AA7 A;  3K4C A;  2W7N A;  4P5O A;  4JQF A;  3G0Q A;  3QSJ A;  2W82 A;  2LBF B;  2JSP A;  3A6T A;  4XMY A;  1BOB A;  4HSR A;  2JVB A;  2ZFU A;  2LOO A;  3K4L A;  4XKW A;  2A8T A;  3ZR1 A;  3LSH A;  2R7O A;  3DTI A;  2IS6 A;  4QPQ A;  4E7Z A;  1SOI A;  5LFA A;  2YVM A;  3O69 A;  1MNE A;  3EUH C;  1UEL B;  3TL4 X;  2UWM A;  1OW2 A;  3DU6 A;  1V8U A;  4JZT A;  2LBF A;  4PSW A;  4BXF A;  5KNL A;  3D5R C;  4C30 A;  1PPW A;  2KZV A;  1IRY A;  1X19 A;  2DSD A;  2PNY A;  2IGN A;  2CUJ A;  4LIU A;  3OL3 A;  4ZDP A;  3OL4 A;  3A2K A;  1VIU A;  3G2B A;  3L2W A;  2VQC A;  3OYH A;  3ACA A;  3EF5 A;  3HHJ A;  3MKZ A;  3GBG A;  2HU9 A;  2ZSI B;  4KYX A;  1WJE A;  4DBR A;  3L2V A;  2CV0 A;  3U53 A;  2IGO A;  4ITV A;  4F3Q A;  4Y3O A;  3W2W A;  1QU3 A;  3I9X A;  2O5F A;  3KVH A;  3S8P A;  4S2W A;  3FHN A;  2CMP A;  3IAS 2;  4E7I A;  2E60 A;  3MDG A;  2PMZ A;  3ZQQ A;  3Q2S A;  3FJY A;  1Z3X A;  4CUG A;  2WAD A;  3F13 A;  3GG6 A;  3QYB A;  3VSL A;  2HPI A;  3CMM A;  2LY1 A;  1MQE A;  3OYL A;  1T0F C;  3LSM A;  4NUB A;  1PUN A;  2QJT A;  3OYC A;  1TZL A;  4IQJ A;  3P5T A;  1MW7 A;  5FSO A;  4OAY A;  1N75 A;  3I3L A;  1XSC A;  5LPG A;  3PFY A;  4HG2 A;  4B48 A;  4BQQ A;  2VJI A;  2KQR A;  2OV7 A;  1YX3 A;  3U21 A;  5DD4 A;  2ELJ A;  3NWT A;  3TMO A;  1VRL A;  2JVG A;  3X0J A;  2ZXI A;  3J7A Y;  3MKY B;  3E57 A;  1XSA A;  2O5W A;  2PJR A;  1LKX A;  5FSK A;  4E7J A;  3VWB A;  2BW3 B;  2CFO A;  2V4J C;  4XKC A;  2HQA A;  4E4H A;  2W4E A;  5GHQ A;  1X51 A;  5I8U A;  3X0N A;  1PVF A;  2LG4 A;  4F55 A;  1Q54 A;  2QKM B;  3RPU D;  4E7S A;  4E7K A;  3K4B A;  3H5N A;  2A8S A;  3K10 A;  2GOX B;  3DPT A;  4PK4 A;  3HOT A;  1ZEL A;  4NFX A;  5GHO A;  2ZXH A;  2DCE A;  2X85 A;  1NG7 A;  3K4M A;  3OGA A;  2BW3 A;  2GOM A;  1HZT A;  3OWT A;  4HPQ A;  1JRK A;  2QJO A;  5FRN A;  2V26 A;  4NQW B;  2RRE A;  3AL0 B;  1D0X A;  4ZYA A;  1YE9 A;  4KTB A;  3QYE A;  3Q93 A;  1QVJ A;  4CA0 A;  3OYF A;  2VNP A;  4XLC A;  4DIQ A;  4LG3 A;  1SAU A;  2R4G A;  4PSX A;  3CP2 A;  4XKV A;  3A6V A;  3AC9 A;  3SZG A;  3OYB A;  3OYK A;  3L2U A;  2FML A;  4HFQ A;  3OY9 A;  3BHO A;  1V5E A;  5CFI A;  2CH0 A;  4PJL A;  4YEJ A;  4IKF A;  4K6E A;  3BCB A;  4YOQ A;  1JKN A;  3GZ8 A;  4S2X A;  2NOJ B;  5TGT A;  1PUQ A;  1G0S A;  3GZ5 A;  1KON A;  3ZCO A;  4XOT A;  4E6K G;  1BR4 A;  3SHD A;  2K9L A;  5GHJ A;  2XDV A;  1VHG A;  1R67 A;  2Y0S A;  3AKZ A;  1MMN A;  4XLH A;  2IS2 A;  3HYQ A;  3VDX A;  4DOZ A;  2R7U A;  4BE0 A;  2YVN A;  5CQE A;  3BG6 A;  3I7U A;  4FAS D;  5ANT A;  2I8U A;  3A4C A;  1E0E A;  3VYS B;  1UG0 A;  3W2A A;  4HVY A;  5CQG A;  1W36 D;  3SON A;  4F93 B;  3AL0 C;  4JZS A;  3MGM A;  3F6A A;  1T95 A;  3J7Y e;  1QHG A;  1Q33 A;  3DKY A;  1IRX A;  3K4K A;  4JOM A;  1SZ3 A;  3H5A A;  4N4O B;  3DPU A;  3ZR8 X;  3X0R A;  2MD0 A;  1X84 A;  1X1C A;  4E7H A;  3K4J A;  2MC4 A;  2R7X A;  3H0D A;  1VC8 A;  1PYV A;  2RNG A;  4II3 A;  3EEU A;  2E1M B;  1D1A A;  2IS1 A;  2GT4 A;  2DT6 A;  3H9Q A;  4RM3 A;  5FSM A;  3RQ4 A;  2X6W A;  5HNF A;  4KJZ A;  4XLE A;  1ERD A;  3IAM 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...