5ANVA

Mth1 in complex with compound 15
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
154
structure length
153
Chain Sequence
ASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7,8-DIHYDRO-8-OXOGUANINE TRIPHOSPHATASE
publication title Potent and Selective Inhibitors of Mth1 Probe its Role in Cancer Cell Survival.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 39
structure length 153
sequence length 154
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5anvA00
2DSBA 1PUSA 5GHPA 4YPHA 1PPVA 3Q93A 4ZG0A 5FSLA 3CNGA 1VK6A 3Q4IA 1PUQA 3WHWA 1R67A 1NQYA 4IJXA 5C7TA 4S2VA 5GHQA 5IW5A 1VC8A 1NQZA 1V8RA 4V14A 2A8TA 1G9QA 1XSBA 5CFIA 2KDWA 4JZSA 5GHOA 3MCFA 4C9WA 1V8NA 1JKNA 2B2KA 3I7UA 1VIUA 4S2XA 3GZ6A 1QVJA 1NFSA 2YVOA 1SJYA 3SHDA 5GHIA 3GRNA 3X0IA 2O1CA 3A6UA 5GHMA 1OW2A 3ZR1A 2ICKA 1MK1A 2DSDA 1Q54A 1V8TA 2I8UA 3EF5A 1Q33A 2AZWA 3FCMA 4KG3A 4N1UA 3BAPA 3R03A 3O8SA 3FSPA 2QJOA 1PPXA 3X0NA 5IW4A 5FSNA 1XSAA 3HHJA 2A8PA 3OGAA 2O5FA 1V8MA 5FSOA 3P6YA 1VHGA 4KTBA 3KVHA 4S2YA 2KDVA 3COUA 3A6VA 4JZTA 3O69A 2XSQA 4JZVA 2PQVA 2CL3A 3Q91A 5DD4A 1I9AA 1KTGA 4MPOA 3GZ8A 1PPWA 4HFQA 2YYHA 1K2EA 1RYAA 1MUTA 3AC9A 5GHJA 2VNQA 5DDGA 1VCDA 4YOQA 5DPKA 1IRYA 1F3YA 3H95A 4KYXA 3FK9A 2I8TA 2DUKA 2PNYA 4JZUA 5ANUA 4ILQA 3MDIA 3Q2SA 1VRLA 1RRSA 1X51A 2B0VA 3I7VA 1KHZA 2FVVA 2A8QA 1MR2A 3X0QA 1VIQA 3N9UA 3N77A 2FKBA 2QJTA 3GG6A 4N1TA 1SU2A 2A8SA 3F13A 4C9XA 1V8UA 3HYQA 4S2WA 5GHNA 3I9XA 5C8LA 1VC9A 1V8LA 2A6TA 1HZTA 2GT2A 3DUPA 4KG4A 3X0JA 5LPGA 3DKUA 3EEUA 3Q2TA 2GT4A 5I8UA 1Q27A 2VNPA 3SMDA 2RRKA 3X0RA 4ICKA 5ANTA 1V8SA 5ANWA 5ANVA 2JVBA 1KT9A 3J7Ye 2G73A 1MP2A 1MQEA 1PVFA 1SOIA 1X84A 2O5WA 2A8RA 2ICJA 2J8QA 3MDGA 1TUMA 3P5TA 3X0MA 2QKMB 3O61A 3O6ZA 2W4EA 2R5WA 3X0PA 5DEQA 1VHZA 3GWYA 3FJYA 3QSJA 3ZR0A 4HVYA 1V8WA 5BS6A 4YPRA 1RRQA 1K26A 3EXQA 3L85A 5ISYA 1HX3A 1X83A 2B06A 3BHOA 5FSIA 3Q1PA 5BONA 1V8VA 2GB5A 2G74A 3A6TA 1V8YA 5CFJA 4K6EA 4DYWA 2DSCA 5C7QA 2DHOA 3X0KA 2I6KA 5FSMA 3FFUA 3X0OA 2YVNA 1SZ3A 2Q9PA 1JRKA 1PUNA 2YVPA 3E57A 3RH7A 3EESA 1V8IA 1G0SA 3ID9A 5HZXA 3MGMA 3A6SA 3X0SA 3ACAA 3BM4A 2FMLA 1MQWA 3O52A 3G0QA 4NFXA 3X0LA 5ANSA 1NFZA 5FSKA 3SONA 3U53A 2YVMA 1GA7A 3F6AA 1U20A 4NFWA 1XSCA 3GZ5A
chains in the Genus database with same CATH superfamily
2DSBA 1PUSA 5GHPA 4YPHA 1PPVA 3Q93A 4ZG0A 5FSLA 3CNGA 1VK6A 3Q4IA 1PUQA 3WHWA 1R67A 1NQYA 4IJXA 5C7TA 4S2VA 5GHQA 5IW5A 1VC8A 1NQZA 1V8RA 4V14A 2A8TA 1G9QA 1XSBA 5CFIA 2KDWA 4JZSA 5GHOA 3MCFA 4C9WA 1V8NA 1JKNA 2B2KA 3I7UA 1VIUA 4S2XA 3GZ6A 1QVJA 1NFSA 2YVOA 1SJYA 3SHDA 5GHIA 3GRNA 3X0IA 2O1CA 3A6UA 5GHMA 1OW2A 3ZR1A 2ICKA 1MK1A 2DSDA 1Q54A 1V8TA 2I8UA 3EF5A 1Q33A 2AZWA 3FCMA 4KG3A 4N1UA 3BAPA 3R03A 3O8SA 3FSPA 2QJOA 1PPXA 3X0NA 5IW4A 5FSNA 1XSAA 3HHJA 2A8PA 3OGAA 2O5FA 1V8MA 5FSOA 3P6YA 1VHGA 4KTBA 3KVHA 4S2YA 2KDVA 2CZRA 3A6VA 3COUA 4JZTA 3O69A 2XSQA 4JZVA 2PQVA 2CL3A 3Q91A 5DD4A 1I9AA 1KTGA 4MPOA 3GZ8A 1PPWA 4HFQA 2YYHA 1K2EA 1RYAA 1MUTA 3AC9A 5GHJA 2VNQA 5DDGA 1VCDA 4YOQA 5DPKA 1IRYA 1F3YA 3H95A 4KYXA 3FK9A 2I8TA 2DUKA 2PNYA 4JZUA 5ANUA 4ILQA 3MDIA 3Q2SA 1VRLA 1RRSA 1X51A 2B0VA 3I7VA 1KHZA 2FVVA 2A8QA 1MR2A 3X0QA 1VIQA 3N9UA 3N77A 2FKBA 2QJTA 3GG6A 4N1TA 1SU2A 2A8SA 3F13A 4C9XA 1V8UA 3HYQA 4S2WA 5GHNA 3I9XA 5C8LA 1VC9A 1V8LA 2A6TA 1HZTA 2GT2A 3DUPA 4KG4A 3X0JA 5LPGA 3DKUA 3EEUA 3Q2TA 2GT4A 5I8UA 1Q27A 2VNPA 3SMDA 2RRKA 3X0RA 4J7HA 4ICKA 5ANTA 1V8SA 5ANWA 5ANVA 2JVBA 1KT9A 3J7Ye 2G73A 1MP2A 1MQEA 1PVFA 1SOIA 1X84A 2O5WA 2A8RA 2ICJA 2J8QA 3MDGA 1TUMA 3P5TA 3X0MA 2QKMB 3O61A 3O6ZA 2W4EA 2R5WA 3X0PA 5DEQA 1VHZA 3GWYA 3FJYA 3QSJA 3ZR0A 4HVYA 1V8WA 5BS6A 4YPRA 1RRQA 1K26A 3EXQA 3L85A 5ISYA 1HX3A 1X83A 2B06A 3BHOA 5FSIA 3Q1PA 5BONA 1V8VA 2GB5A 2G74A 3A6TA 1V8YA 5CFJA 4K6EA 4DYWA 2DSCA 5C7QA 2DHOA 3X0KA 2I6KA 5FSMA 3FFUA 3X0OA 2YVNA 1SZ3A 2Q9PA 1JRKA 1PUNA 2YVPA 3E57A 3RH7A 3EESA 1V8IA 1G0SA 3ID9A 5HZXA 3MGMA 4J7GA 3A6SA 3X0SA 3ACAA 3BM4A 2FMLA 1MQWA 3O52A 3G0QA 4NFXA 3X0LA 5ANSA 1NFZA 5FSKA 3SONA 3U53A 2YVMA 1GA7A 3F6AA 1U20A 4NFWA 1XSCA 3GZ5A
chains in the Genus database with same CATH topology
2DSBA 1PUSA 5GHPA 4YPHA 1PPVA 3Q93A 4ZG0A 5FSLA 3CNGA 1VK6A 3Q4IA 1PUQA 3WHWA 1R67A 1NQYA 4IJXA 5C7TA 4S2VA 5GHQA 5IW5A 1VC8A 1NQZA 1V8RA 4V14A 2A8TA 1G9QA 1XSBA 5CFIA 2KDWA 4JZSA 5GHOA 3MCFA 4C9WA 1V8NA 1JKNA 2B2KA 3I7UA 1VIUA 4S2XA 3GZ6A 1QVJA 1NFSA 2YVOA 1SJYA 3SHDA 5GHIA 3GRNA 3X0IA 2O1CA 3A6UA 5GHMA 1OW2A 3ZR1A 2ICKA 1MK1A 2DSDA 1Q54A 1V8TA 2I8UA 3EF5A 1Q33A 2AZWA 3FCMA 4KG3A 4N1UA 3BAPA 3R03A 3O8SA 3FSPA 2QJOA 1PPXA 3X0NA 5IW4A 5FSNA 1XSAA 3HHJA 2A8PA 3OGAA 2O5FA 1V8MA 5FSOA 3P6YA 1VHGA 4KTBA 3KVHA 4S2YA 2KDVA 2CZRA 3A6VA 3COUA 4JZTA 3O69A 2XSQA 4JZVA 2PQVA 2CL3A 3Q91A 5DD4A 1I9AA 1KTGA 4MPOA 3GZ8A 1PPWA 4HFQA 2YYHA 1K2EA 1RYAA 1MUTA 3AC9A 5GHJA 2VNQA 5DDGA 1VCDA 4YOQA 5DPKA 1IRYA 1F3YA 3H95A 4KYXA 3FK9A 2I8TA 2DUKA 2PNYA 4JZUA 5ANUA 4ILQA 3MDIA 3Q2SA 1VRLA 1RRSA 1X51A 2B0VA 3I7VA 1KHZA 2FVVA 2A8QA 1MR2A 3X0QA 1VIQA 3N9UA 3N77A 2FKBA 2QJTA 3GG6A 4N1TA 1SU2A 2A8SA 3F13A 4C9XA 1V8UA 3HYQA 4S2WA 5GHNA 3I9XA 5C8LA 1VC9A 1V8LA 2A6TA 1HZTA 2GT2A 3DUPA 4KG4A 3X0JA 5LPGA 3DKUA 3EEUA 3Q2TA 2GT4A 5I8UA 1Q27A 2VNPA 3SMDA 2RRKA 3X0RA 4J7HA 4ICKA 5ANTA 1V8SA 5ANWA 5ANVA 2JVBA 1KT9A 3J7Ye 2G73A 1MP2A 1MQEA 1PVFA 1SOIA 1X84A 2O5WA 2A8RA 2ICJA 2J8QA 3MDGA 1TUMA 3P5TA 3X0MA 2QKMB 3O61A 3O6ZA 2W4EA 2R5WA 3X0PA 5DEQA 1VHZA 3GWYA 3FJYA 3QSJA 3ZR0A 4HVYA 1V8WA 5BS6A 4YPRA 1RRQA 1K26A 3EXQA 3L85A 5ISYA 1HX3A 1X83A 2B06A 3BHOA 5FSIA 3Q1PA 5BONA 1V8VA 2GB5A 2G74A 3A6TA 1V8YA 5CFJA 4K6EA 4DYWA 2DSCA 5C7QA 2DHOA 3X0KA 2I6KA 5FSMA 3FFUA 3X0OA 2YVNA 1SZ3A 2Q9PA 1JRKA 1PUNA 2YVPA 3E57A 3RH7A 3EESA 1V8IA 1G0SA 3ID9A 5HZXA 3MGMA 4J7GA 3A6SA 3X0SA 3ACAA 3BM4A 2FMLA 1MQWA 3O52A 3G0QA 4NFXA 3X0LA 5ANSA 1NFZA 5FSKA 3SONA 3U53A 2YVMA 1GA7A 3F6AA 1U20A 4NFWA 1XSCA 3GZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DSB A;  1PUS A;  5GHP A;  4YPH A;  1PPV A;  3Q93 A;  4ZG0 A;  5FSL A;  3CNG A;  1VK6 A;  3Q4I A;  1PUQ A;  3WHW A;  1R67 A;  1NQY A;  4IJX A;  5C7T A;  4S2V A;  5GHQ A;  5IW5 A;  1VC8 A;  1NQZ A;  1V8R A;  4V14 A;  2A8T A;  1G9Q A;  1XSB A;  5CFI A;  2KDW A;  4JZS A;  5GHO A;  3MCF A;  4C9W A;  1V8N A;  1JKN A;  2B2K A;  3I7U A;  1VIU A;  4S2X A;  3GZ6 A;  1QVJ A;  1NFS A;  2YVO A;  1SJY A;  3SHD A;  5GHI A;  3GRN A;  3X0I A;  2O1C A;  3A6U A;  5GHM A;  1OW2 A;  3ZR1 A;  2ICK A;  1MK1 A;  2DSD A;  1Q54 A;  1V8T A;  2I8U A;  3EF5 A;  1Q33 A;  2AZW A;  3FCM A;  4KG3 A;  4N1U A;  3BAP A;  3R03 A;  3O8S A;  3FSP A;  2QJO A;  1PPX A;  3X0N A;  5IW4 A;  5FSN A;  1XSA A;  3HHJ A;  2A8P A;  3OGA A;  2O5F A;  1V8M A;  5FSO A;  3P6Y A;  1VHG A;  4KTB A;  3KVH A;  4S2Y A;  2KDV A;  3COU A;  3A6V A;  4JZT A;  3O69 A;  2XSQ A;  4JZV A;  2PQV A;  2CL3 A;  3Q91 A;  5DD4 A;  1I9A A;  1KTG A;  4MPO A;  3GZ8 A;  1PPW A;  4HFQ A;  2YYH A;  1K2E A;  1RYA A;  1MUT A;  3AC9 A;  5GHJ A;  2VNQ A;  5DDG A;  1VCD A;  4YOQ A;  5DPK A;  1IRY A;  1F3Y A;  3H95 A;  4KYX A;  3FK9 A;  2I8T A;  2DUK A;  2PNY A;  4JZU A;  5ANU A;  4ILQ A;  3MDI A;  3Q2S A;  1VRL A;  1RRS A;  1X51 A;  2B0V A;  3I7V A;  1KHZ A;  2FVV A;  2A8Q A;  1MR2 A;  3X0Q A;  1VIQ A;  3N9U A;  3N77 A;  2FKB A;  2QJT A;  3GG6 A;  4N1T A;  1SU2 A;  2A8S A;  3F13 A;  4C9X A;  1V8U A;  3HYQ A;  4S2W A;  5GHN A;  3I9X A;  5C8L A;  1VC9 A;  1V8L A;  2A6T A;  1HZT A;  2GT2 A;  3DUP A;  4KG4 A;  3X0J A;  5LPG A;  3DKU A;  3EEU A;  3Q2T A;  2GT4 A;  5I8U A;  1Q27 A;  2VNP A;  3SMD A;  2RRK A;  3X0R A;  4ICK A;  5ANT A;  1V8S A;  5ANW A;  5ANV A;  2JVB A;  1KT9 A;  3J7Y e;  2G73 A;  1MP2 A;  1MQE A;  1PVF A;  1SOI A;  1X84 A;  2O5W A;  2A8R A;  2ICJ A;  2J8Q A;  3MDG A;  1TUM A;  3P5T A;  3X0M A;  2QKM B;  3O61 A;  3O6Z A;  2W4E A;  2R5W A;  3X0P A;  5DEQ A;  1VHZ A;  3GWY A;  3FJY A;  3QSJ A;  3ZR0 A;  4HVY A;  1V8W A;  5BS6 A;  4YPR A;  1RRQ A;  1K26 A;  3EXQ A;  3L85 A;  5ISY A;  1HX3 A;  1X83 A;  2B06 A;  3BHO A;  5FSI A;  3Q1P A;  5BON A;  1V8V A;  2GB5 A;  2G74 A;  3A6T A;  1V8Y A;  5CFJ A;  4K6E A;  4DYW A;  2DSC A;  5C7Q A;  2DHO A;  3X0K A;  2I6K A;  5FSM A;  3FFU A;  3X0O A;  2YVN A;  1SZ3 A;  2Q9P A;  1JRK A;  1PUN A;  2YVP A;  3E57 A;  3RH7 A;  3EES A;  1V8I A;  1G0S A;  3ID9 A;  5HZX A;  3MGM A;  3A6S A;  3X0S A;  3ACA A;  3BM4 A;  2FML A;  1MQW A;  3O52 A;  3G0Q A;  4NFX A;  3X0L A;  5ANS A;  1NFZ A;  5FSK A;  3SON A;  3U53 A;  2YVM A;  1GA7 A;  3F6A A;  1U20 A;  4NFW A;  1XSC A;  3GZ5 A; 
#chains in the Genus database with same CATH topology
 2DSB A;  1PUS A;  5GHP A;  4YPH A;  1PPV A;  3Q93 A;  4ZG0 A;  5FSL A;  3CNG A;  1VK6 A;  3Q4I A;  1PUQ A;  3WHW A;  1R67 A;  1NQY A;  4IJX A;  5C7T A;  4S2V A;  5GHQ A;  5IW5 A;  1VC8 A;  1NQZ A;  1V8R A;  4V14 A;  2A8T A;  1G9Q A;  1XSB A;  5CFI A;  2KDW A;  4JZS A;  5GHO A;  3MCF A;  4C9W A;  1V8N A;  1JKN A;  2B2K A;  3I7U A;  1VIU A;  4S2X A;  3GZ6 A;  1QVJ A;  1NFS A;  2YVO A;  1SJY A;  3SHD A;  5GHI A;  3GRN A;  3X0I A;  2O1C A;  3A6U A;  5GHM A;  1OW2 A;  3ZR1 A;  2ICK A;  1MK1 A;  2DSD A;  1Q54 A;  1V8T A;  2I8U A;  3EF5 A;  1Q33 A;  2AZW A;  3FCM A;  4KG3 A;  4N1U A;  3BAP A;  3R03 A;  3O8S A;  3FSP A;  2QJO A;  1PPX A;  3X0N A;  5IW4 A;  5FSN A;  1XSA A;  3HHJ A;  2A8P A;  3OGA A;  2O5F A;  1V8M A;  5FSO A;  3P6Y A;  1VHG A;  4KTB A;  3KVH A;  4S2Y A;  2KDV A;  2CZR A;  3A6V A;  3COU A;  4JZT A;  3O69 A;  2XSQ A;  4JZV A;  2PQV A;  2CL3 A;  3Q91 A;  5DD4 A;  1I9A A;  1KTG A;  4MPO A;  3GZ8 A;  1PPW A;  4HFQ A;  2YYH A;  1K2E A;  1RYA A;  1MUT A;  3AC9 A;  5GHJ A;  2VNQ A;  5DDG A;  1VCD A;  4YOQ A;  5DPK A;  1IRY A;  1F3Y A;  3H95 A;  4KYX A;  3FK9 A;  2I8T A;  2DUK A;  2PNY A;  4JZU A;  5ANU A;  4ILQ A;  3MDI A;  3Q2S A;  1VRL A;  1RRS A;  1X51 A;  2B0V A;  3I7V A;  1KHZ A;  2FVV A;  2A8Q A;  1MR2 A;  3X0Q A;  1VIQ A;  3N9U A;  3N77 A;  2FKB A;  2QJT A;  3GG6 A;  4N1T A;  1SU2 A;  2A8S A;  3F13 A;  4C9X A;  1V8U A;  3HYQ A;  4S2W A;  5GHN A;  3I9X A;  5C8L A;  1VC9 A;  1V8L A;  2A6T A;  1HZT A;  2GT2 A;  3DUP A;  4KG4 A;  3X0J A;  5LPG A;  3DKU A;  3EEU A;  3Q2T A;  2GT4 A;  5I8U A;  1Q27 A;  2VNP A;  3SMD A;  2RRK A;  3X0R A;  4J7H A;  4ICK A;  5ANT A;  1V8S A;  5ANW A;  5ANV A;  2JVB A;  1KT9 A;  3J7Y e;  2G73 A;  1MP2 A;  1MQE A;  1PVF A;  1SOI A;  1X84 A;  2O5W A;  2A8R A;  2ICJ A;  2J8Q A;  3MDG A;  1TUM A;  3P5T A;  3X0M A;  2QKM B;  3O61 A;  3O6Z A;  2W4E A;  2R5W A;  3X0P A;  5DEQ A;  1VHZ A;  3GWY A;  3FJY A;  3QSJ A;  3ZR0 A;  4HVY A;  1V8W A;  5BS6 A;  4YPR A;  1RRQ A;  1K26 A;  3EXQ A;  3L85 A;  5ISY A;  1HX3 A;  1X83 A;  2B06 A;  3BHO A;  5FSI A;  3Q1P A;  5BON A;  1V8V A;  2GB5 A;  2G74 A;  3A6T A;  1V8Y A;  5CFJ A;  4K6E A;  4DYW A;  2DSC A;  5C7Q A;  2DHO A;  3X0K A;  2I6K A;  5FSM A;  3FFU A;  3X0O A;  2YVN A;  1SZ3 A;  2Q9P A;  1JRK A;  1PUN A;  2YVP A;  3E57 A;  3RH7 A;  3EES A;  1V8I A;  1G0S A;  3ID9 A;  5HZX A;  3MGM A;  4J7G A;  3A6S A;  3X0S A;  3ACA A;  3BM4 A;  2FML A;  1MQW A;  3O52 A;  3G0Q A;  4NFX A;  3X0L A;  5ANS A;  1NFZ A;  5FSK A;  3SON A;  3U53 A;  2YVM A;  1GA7 A;  3F6A A;  1U20 A;  4NFW A;  1XSC A;  3GZ5 A; 
#chains in the Genus database with same CATH homology
 2DSB A;  1PUS A;  5GHP A;  4YPH A;  1PPV A;  3Q93 A;  4ZG0 A;  5FSL A;  3CNG A;  1VK6 A;  3Q4I A;  1PUQ A;  3WHW A;  1R67 A;  1NQY A;  4IJX A;  5C7T A;  4S2V A;  5GHQ A;  5IW5 A;  1VC8 A;  1NQZ A;  1V8R A;  4V14 A;  2A8T A;  1G9Q A;  1XSB A;  5CFI A;  2KDW A;  4JZS A;  5GHO A;  3MCF A;  4C9W A;  1V8N A;  1JKN A;  2B2K A;  3I7U A;  1VIU A;  4S2X A;  3GZ6 A;  1QVJ A;  1NFS A;  2YVO A;  1SJY A;  3SHD A;  5GHI A;  3GRN A;  3X0I A;  2O1C A;  3A6U A;  5GHM A;  1OW2 A;  3ZR1 A;  2ICK A;  1MK1 A;  2DSD A;  1Q54 A;  1V8T A;  2I8U A;  3EF5 A;  1Q33 A;  2AZW A;  3FCM A;  4KG3 A;  4N1U A;  3BAP A;  3R03 A;  3O8S A;  3FSP A;  2QJO A;  1PPX A;  3X0N A;  5IW4 A;  5FSN A;  1XSA A;  3HHJ A;  2A8P A;  3OGA A;  2O5F A;  1V8M A;  5FSO A;  3P6Y A;  1VHG A;  4KTB A;  3KVH A;  4S2Y A;  2KDV A;  2CZR A;  3A6V A;  3COU A;  4JZT A;  3O69 A;  2XSQ A;  4JZV A;  2PQV A;  2CL3 A;  3Q91 A;  5DD4 A;  1I9A A;  1KTG A;  4MPO A;  3GZ8 A;  1PPW A;  4HFQ A;  2YYH A;  1K2E A;  1RYA A;  1MUT A;  3AC9 A;  5GHJ A;  2VNQ A;  5DDG A;  1VCD A;  4YOQ A;  5DPK A;  1IRY A;  1F3Y A;  3H95 A;  4KYX A;  3FK9 A;  2I8T A;  2DUK A;  2PNY A;  4JZU A;  5ANU A;  4ILQ A;  3MDI A;  3Q2S A;  1VRL A;  1RRS A;  1X51 A;  2B0V A;  3I7V A;  1KHZ A;  2FVV A;  2A8Q A;  1MR2 A;  3X0Q A;  1VIQ A;  3N9U A;  3N77 A;  2FKB A;  2QJT A;  3GG6 A;  4N1T A;  1SU2 A;  2A8S A;  3F13 A;  4C9X A;  1V8U A;  3HYQ A;  4S2W A;  5GHN A;  3I9X A;  5C8L A;  1VC9 A;  1V8L A;  2A6T A;  1HZT A;  2GT2 A;  3DUP A;  4KG4 A;  3X0J A;  5LPG A;  3DKU A;  3EEU A;  3Q2T A;  2GT4 A;  5I8U A;  1Q27 A;  2VNP A;  3SMD A;  2RRK A;  3X0R A;  4J7H A;  4ICK A;  5ANT A;  1V8S A;  5ANW A;  5ANV A;  2JVB A;  1KT9 A;  3J7Y e;  2G73 A;  1MP2 A;  1MQE A;  1PVF A;  1SOI A;  1X84 A;  2O5W A;  2A8R A;  2ICJ A;  2J8Q A;  3MDG A;  1TUM A;  3P5T A;  3X0M A;  2QKM B;  3O61 A;  3O6Z A;  2W4E A;  2R5W A;  3X0P A;  5DEQ A;  1VHZ A;  3GWY A;  3FJY A;  3QSJ A;  3ZR0 A;  4HVY A;  1V8W A;  5BS6 A;  4YPR A;  1RRQ A;  1K26 A;  3EXQ A;  3L85 A;  5ISY A;  1HX3 A;  1X83 A;  2B06 A;  3BHO A;  5FSI A;  3Q1P A;  5BON A;  1V8V A;  2GB5 A;  2G74 A;  3A6T A;  1V8Y A;  5CFJ A;  4K6E A;  4DYW A;  2DSC A;  5C7Q A;  2DHO A;  3X0K A;  2I6K A;  5FSM A;  3FFU A;  3X0O A;  2YVN A;  1SZ3 A;  2Q9P A;  1JRK A;  1PUN A;  2YVP A;  3E57 A;  3RH7 A;  3EES A;  1V8I A;  1G0S A;  3ID9 A;  5HZX A;  3MGM A;  4J7G A;  3A6S A;  3X0S A;  3ACA A;  3BM4 A;  2FML A;  1MQW A;  3O52 A;  3G0Q A;  4NFX A;  3X0L A;  5ANS A;  1NFZ A;  5FSK A;  3SON A;  3U53 A;  2YVM A;  1GA7 A;  3F6A A;  1U20 A;  4NFW A;  1XSC A;  3GZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...