5ANVA

Mth1 in complex with compound 15
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
154
structure length
153
Chain Sequence
ASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 7,8-DIHYDRO-8-OXOGUANINE TRIPHOSPHATASE
publication title Potent and Selective Inhibitors of Mth1 Probe its Role in Cancer Cell Survival.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 153
sequence length 154
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5anvA00
4MPOA 3ZR0A 5FSMA 1V8UA 2G74A 3Q2SA 2YVPA 1SOIA 2FKBA 4NFWA 2QJTA 1KHZA 1HX3A 1F3YA 3L85A 1V8VA 3FSPA 2I6KA 2J8QA 3DKUA 1OW2A 4JZTA 5C8LA 3U53A 2R5WA 2PQVA 1NQZA 1PUSA 3O6ZA 3O69A 5C7QA 2GT2A 1VRLA 5DEQA 3KVHA 5I8UA 2Q9PA 4HVYA 1V8TA 5GHPA 3X0MA 5CFJA 1VK6A 1QVJA 2QKMB 2A8QA 3E57A 2CL3A 3BHOA 1VCDA 2VNQA 2YVOA 2A8SA 3O8SA 1X84A 3RH7A 4YPHA 3X0LA 2A8RA 1K2EA 3EXQA 2XSQA 5ANVA 4HFQA 1V8MA 3BM4A 4ZG0A 5FSIA 2A8TA 3F13A 3A6UA 1X51A 3AC9A 4S2WA 1V8SA 1SU2A 5FSLA 3X0JA 3ACAA 3R03A 3CNGA 1NFSA 1XSAA 3H95A 3QSJA 1SZ3A 1SJYA 3I7VA 4JZUA 5GHNA 5CFIA 2I8UA 2YYHA 1KT9A 1NQYA 3OGAA 3N77A 3SMDA 3X0OA 4S2YA 4YPRA 3GZ5A 1VHZA 4S2XA 1I9AA 4KG3A 3A6SA 1JKNA 2O1CA 1IRYA 3EEUA 1Q54A 2W4EA 1XSBA 3X0IA 4V14A 5BS6A 3GG6A 5GHOA 3MGMA 1JRKA 3SONA 1PUQA 3G0QA 3EESA 1GA7A 5ANTA 4K6EA 3FK9A 1PPWA 4KYXA 1R67A 2YVNA 1Q27A 3I9XA 2A8PA 5FSKA 3FJYA 3ZR1A 1XSCA 2A6TA 1MP2A 2KDVA 3EF5A 5IW5A 4YOQA 4ILQA 1V8YA 1V8LA 1HZTA 2QJOA 3Q4IA 1V8IA 2DUKA 5FSNA 2PNYA 3FCMA 1G0SA 5GHJA 3X0RA 5LPGA 2RRKA 2YVMA 2GB5A 5ANUA 3MDGA 1Q33A 3FFUA 3P5TA 3I7UA 1RRQA 1V8RA 1PPXA 2B0VA 3ID9A 1NFZA 3Q93A 4KTBA 1VHGA 1RRSA 1U20A 4JZSA 1VC8A 4N1TA 1G9QA 3MDIA 1MR2A 5ANWA 2GT4A 3Q1PA 5ISYA 1RYAA 3GZ8A 5DPKA 1MQEA 1PPVA 2DSBA 2DSDA 3N9UA 1PUNA 1MQWA 1VIQA 2ICJA 2KDWA 3X0NA 3A6VA 4JZVA 2ICKA 1V8WA 5DD4A 4NFXA 3HHJA 5DDGA 3J7Ye 5IW4A 2B06A 3DUPA 2DHOA 3MCFA 3F6AA 4S2VA 5GHIA 1K26A 1VIUA 2VNPA 4N1UA 4DYWA 3X0PA 3GRNA 1V8NA 1KTGA 2JVBA 2DSCA 3BAPA 3COUA 5FSOA 5BONA 3WHWA 1VC9A 2FMLA 2G73A 5ANSA 2FVVA 5C7TA 3P6YA 4KG4A 2B2KA 5GHQA 5HZXA 1MUTA 4C9XA 3GZ6A 2I8TA 3O61A 5GHMA 3Q91A 3X0QA 1PVFA 4C9WA 2O5FA 3SHDA 3X0KA 3A6TA 3Q2TA 1TUMA 3GWYA 4ICKA 3HYQA 1X83A 2O5WA 2AZWA 3O52A 3X0SA 1MK1A 4IJXA
chains in the Genus database with same CATH superfamily
4MPOA 3ZR0A 5FSMA 1V8UA 2G74A 3Q2SA 2YVPA 1SOIA 2FKBA 4NFWA 2QJTA 1KHZA 1HX3A 1F3YA 3L85A 1V8VA 3FSPA 2I6KA 2J8QA 3DKUA 1OW2A 4JZTA 5C8LA 3U53A 2R5WA 2PQVA 1NQZA 1PUSA 3O6ZA 3O69A 4J7HA 5C7QA 2GT2A 1VRLA 5DEQA 3KVHA 5I8UA 2Q9PA 4HVYA 1V8TA 5GHPA 3X0MA 5CFJA 1VK6A 1QVJA 2QKMB 2A8QA 3E57A 2CL3A 3BHOA 1VCDA 2VNQA 2YVOA 2CZRA 2A8SA 3O8SA 1X84A 3RH7A 4YPHA 3X0LA 2A8RA 1K2EA 3EXQA 2XSQA 5ANVA 4HFQA 1V8MA 3BM4A 4ZG0A 5FSIA 2A8TA 3F13A 3A6UA 1X51A 3AC9A 4S2WA 1V8SA 1SU2A 5FSLA 3X0JA 3ACAA 3R03A 3CNGA 1NFSA 1XSAA 3H95A 3QSJA 1SZ3A 1SJYA 3I7VA 4JZUA 5GHNA 5CFIA 2I8UA 2YYHA 1KT9A 1NQYA 3OGAA 3N77A 3SMDA 3X0OA 4S2YA 4YPRA 3GZ5A 1VHZA 4S2XA 1I9AA 4KG3A 3A6SA 1JKNA 2O1CA 1IRYA 3EEUA 1Q54A 2W4EA 1XSBA 3X0IA 4V14A 5BS6A 3GG6A 5GHOA 3MGMA 1JRKA 3SONA 1PUQA 3G0QA 3EESA 1GA7A 5ANTA 4K6EA 3FK9A 1PPWA 4KYXA 1R67A 2YVNA 1Q27A 3I9XA 2A8PA 5FSKA 3FJYA 3ZR1A 1XSCA 2A6TA 1MP2A 2KDVA 3EF5A 5IW5A 4YOQA 4ILQA 1V8YA 1V8LA 1HZTA 2QJOA 3Q4IA 1V8IA 2DUKA 5FSNA 2PNYA 3FCMA 1G0SA 5GHJA 3X0RA 5LPGA 2RRKA 2YVMA 2GB5A 5ANUA 3MDGA 1Q33A 3FFUA 3P5TA 3I7UA 1RRQA 1V8RA 1PPXA 2B0VA 3ID9A 1NFZA 3Q93A 4KTBA 1VHGA 1RRSA 1U20A 4JZSA 1VC8A 4N1TA 1G9QA 3MDIA 1MR2A 5ANWA 2GT4A 3Q1PA 5ISYA 1RYAA 3GZ8A 5DPKA 1MQEA 1PPVA 2DSBA 2DSDA 3N9UA 1PUNA 1MQWA 1VIQA 2ICJA 2KDWA 3X0NA 3A6VA 4JZVA 2ICKA 1V8WA 5DD4A 4NFXA 3HHJA 5DDGA 3J7Ye 5IW4A 2B06A 4J7GA 3DUPA 2DHOA 3MCFA 3F6AA 4S2VA 5GHIA 1K26A 1VIUA 2VNPA 4N1UA 4DYWA 3X0PA 3GRNA 1V8NA 1KTGA 2JVBA 2DSCA 3BAPA 3COUA 5FSOA 5BONA 3WHWA 1VC9A 2FMLA 2G73A 5ANSA 2FVVA 5C7TA 3P6YA 4KG4A 2B2KA 5GHQA 5HZXA 1MUTA 4C9XA 3GZ6A 2I8TA 3O61A 5GHMA 3Q91A 3X0QA 1PVFA 4C9WA 2O5FA 3SHDA 3X0KA 3A6TA 3Q2TA 1TUMA 3GWYA 4ICKA 3HYQA 1X83A 2O5WA 2AZWA 3O52A 3X0SA 1MK1A 4IJXA
chains in the Genus database with same CATH topology
4MPOA 3ZR0A 5FSMA 1V8UA 2G74A 3Q2SA 2YVPA 1SOIA 2FKBA 4NFWA 2QJTA 1KHZA 1HX3A 1F3YA 3L85A 1V8VA 3FSPA 2I6KA 2J8QA 3DKUA 1OW2A 4JZTA 5C8LA 3U53A 2R5WA 2PQVA 1NQZA 1PUSA 3O6ZA 3O69A 4J7HA 5C7QA 2GT2A 1VRLA 5DEQA 3KVHA 5I8UA 2Q9PA 4HVYA 1V8TA 5GHPA 3X0MA 5CFJA 1VK6A 1QVJA 2QKMB 2A8QA 3E57A 2CL3A 3BHOA 1VCDA 2VNQA 2YVOA 2CZRA 2A8SA 3O8SA 1X84A 3RH7A 4YPHA 3X0LA 2A8RA 1K2EA 3EXQA 2XSQA 5ANVA 4HFQA 1V8MA 3BM4A 4ZG0A 5FSIA 2A8TA 3F13A 3A6UA 1X51A 3AC9A 4S2WA 1V8SA 1SU2A 5FSLA 3X0JA 3ACAA 3R03A 3CNGA 1NFSA 1XSAA 3H95A 3QSJA 1SZ3A 1SJYA 3I7VA 4JZUA 5GHNA 5CFIA 2I8UA 2YYHA 1KT9A 1NQYA 3OGAA 3N77A 3SMDA 3X0OA 4S2YA 4YPRA 3GZ5A 1VHZA 4S2XA 1I9AA 4KG3A 3A6SA 1JKNA 2O1CA 1IRYA 3EEUA 1Q54A 2W4EA 1XSBA 3X0IA 4V14A 5BS6A 3GG6A 5GHOA 3MGMA 1JRKA 3SONA 1PUQA 3G0QA 3EESA 1GA7A 5ANTA 4K6EA 3FK9A 1PPWA 4KYXA 1R67A 2YVNA 1Q27A 3I9XA 2A8PA 5FSKA 3FJYA 3ZR1A 1XSCA 2A6TA 1MP2A 2KDVA 3EF5A 5IW5A 4YOQA 4ILQA 1V8YA 1V8LA 1HZTA 2QJOA 3Q4IA 1V8IA 2DUKA 5FSNA 2PNYA 3FCMA 1G0SA 5GHJA 3X0RA 5LPGA 2RRKA 2YVMA 2GB5A 5ANUA 3MDGA 1Q33A 3FFUA 3P5TA 3I7UA 1RRQA 1V8RA 1PPXA 2B0VA 3ID9A 1NFZA 3Q93A 4KTBA 1VHGA 1RRSA 1U20A 4JZSA 1VC8A 4N1TA 1G9QA 3MDIA 1MR2A 5ANWA 2GT4A 3Q1PA 5ISYA 1RYAA 3GZ8A 5DPKA 1MQEA 1PPVA 2DSBA 2DSDA 3N9UA 1PUNA 1MQWA 1VIQA 2ICJA 2KDWA 3X0NA 3A6VA 4JZVA 2ICKA 1V8WA 5DD4A 4NFXA 3HHJA 5DDGA 3J7Ye 5IW4A 2B06A 4J7GA 3DUPA 2DHOA 3MCFA 3F6AA 4S2VA 5GHIA 1K26A 1VIUA 2VNPA 4N1UA 4DYWA 3X0PA 3GRNA 1V8NA 1KTGA 2JVBA 2DSCA 3BAPA 3COUA 5FSOA 5BONA 3WHWA 1VC9A 2FMLA 2G73A 5ANSA 2FVVA 5C7TA 3P6YA 4KG4A 2B2KA 5GHQA 5HZXA 1MUTA 4C9XA 3GZ6A 2I8TA 3O61A 5GHMA 3Q91A 3X0QA 1PVFA 4C9WA 2O5FA 3SHDA 3X0KA 3A6TA 3Q2TA 1TUMA 3GWYA 4ICKA 3HYQA 1X83A 2O5WA 2AZWA 3O52A 3X0SA 1MK1A 4IJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MPO A;  3ZR0 A;  5FSM A;  1V8U A;  2G74 A;  3Q2S A;  2YVP A;  1SOI A;  2FKB A;  4NFW A;  2QJT A;  1KHZ A;  1HX3 A;  1F3Y A;  3L85 A;  1V8V A;  3FSP A;  2I6K A;  2J8Q A;  3DKU A;  1OW2 A;  4JZT A;  5C8L A;  3U53 A;  2R5W A;  2PQV A;  1NQZ A;  1PUS A;  3O6Z A;  3O69 A;  5C7Q A;  2GT2 A;  1VRL A;  5DEQ A;  3KVH A;  5I8U A;  2Q9P A;  4HVY A;  1V8T A;  5GHP A;  3X0M A;  5CFJ A;  1VK6 A;  1QVJ A;  2QKM B;  2A8Q A;  3E57 A;  2CL3 A;  3BHO A;  1VCD A;  2VNQ A;  2YVO A;  2A8S A;  3O8S A;  1X84 A;  3RH7 A;  4YPH A;  3X0L A;  2A8R A;  1K2E A;  3EXQ A;  2XSQ A;  5ANV A;  4HFQ A;  1V8M A;  3BM4 A;  4ZG0 A;  5FSI A;  2A8T A;  3F13 A;  3A6U A;  1X51 A;  3AC9 A;  4S2W A;  1V8S A;  1SU2 A;  5FSL A;  3X0J A;  3ACA A;  3R03 A;  3CNG A;  1NFS A;  1XSA A;  3H95 A;  3QSJ A;  1SZ3 A;  1SJY A;  3I7V A;  4JZU A;  5GHN A;  5CFI A;  2I8U A;  2YYH A;  1KT9 A;  1NQY A;  3OGA A;  3N77 A;  3SMD A;  3X0O A;  4S2Y A;  4YPR A;  3GZ5 A;  1VHZ A;  4S2X A;  1I9A A;  4KG3 A;  3A6S A;  1JKN A;  2O1C A;  1IRY A;  3EEU A;  1Q54 A;  2W4E A;  1XSB A;  3X0I A;  4V14 A;  5BS6 A;  3GG6 A;  5GHO A;  3MGM A;  1JRK A;  3SON A;  1PUQ A;  3G0Q A;  3EES A;  1GA7 A;  5ANT A;  4K6E A;  3FK9 A;  1PPW A;  4KYX A;  1R67 A;  2YVN A;  1Q27 A;  3I9X A;  2A8P A;  5FSK A;  3FJY A;  3ZR1 A;  1XSC A;  2A6T A;  1MP2 A;  2KDV A;  3EF5 A;  5IW5 A;  4YOQ A;  4ILQ A;  1V8Y A;  1V8L A;  1HZT A;  2QJO A;  3Q4I A;  1V8I A;  2DUK A;  5FSN A;  2PNY A;  3FCM A;  1G0S A;  5GHJ A;  3X0R A;  5LPG A;  2RRK A;  2YVM A;  2GB5 A;  5ANU A;  3MDG A;  1Q33 A;  3FFU A;  3P5T A;  3I7U A;  1RRQ A;  1V8R A;  1PPX A;  2B0V A;  3ID9 A;  1NFZ A;  3Q93 A;  4KTB A;  1VHG A;  1RRS A;  1U20 A;  4JZS A;  1VC8 A;  4N1T A;  1G9Q A;  3MDI A;  1MR2 A;  5ANW A;  2GT4 A;  3Q1P A;  5ISY A;  1RYA A;  3GZ8 A;  5DPK A;  1MQE A;  1PPV A;  2DSB A;  2DSD A;  3N9U A;  1PUN A;  1MQW A;  1VIQ A;  2ICJ A;  2KDW A;  3X0N A;  3A6V A;  4JZV A;  2ICK A;  1V8W A;  5DD4 A;  4NFX A;  3HHJ A;  5DDG A;  3J7Y e;  5IW4 A;  2B06 A;  3DUP A;  2DHO A;  3MCF A;  3F6A A;  4S2V A;  5GHI A;  1K26 A;  1VIU A;  2VNP A;  4N1U A;  4DYW A;  3X0P A;  3GRN A;  1V8N A;  1KTG A;  2JVB A;  2DSC A;  3BAP A;  3COU A;  5FSO A;  5BON A;  3WHW A;  1VC9 A;  2FML A;  2G73 A;  5ANS A;  2FVV A;  5C7T A;  3P6Y A;  4KG4 A;  2B2K A;  5GHQ A;  5HZX A;  1MUT A;  4C9X A;  3GZ6 A;  2I8T A;  3O61 A;  5GHM A;  3Q91 A;  3X0Q A;  1PVF A;  4C9W A;  2O5F A;  3SHD A;  3X0K A;  3A6T A;  3Q2T A;  1TUM A;  3GWY A;  4ICK A;  3HYQ A;  1X83 A;  2O5W A;  2AZW A;  3O52 A;  3X0S A;  1MK1 A;  4IJX A; 
#chains in the Genus database with same CATH topology
 4MPO A;  3ZR0 A;  5FSM A;  1V8U A;  2G74 A;  3Q2S A;  2YVP A;  1SOI A;  2FKB A;  4NFW A;  2QJT A;  1KHZ A;  1HX3 A;  1F3Y A;  3L85 A;  1V8V A;  3FSP A;  2I6K A;  2J8Q A;  3DKU A;  1OW2 A;  4JZT A;  5C8L A;  3U53 A;  2R5W A;  2PQV A;  1NQZ A;  1PUS A;  3O6Z A;  3O69 A;  4J7H A;  5C7Q A;  2GT2 A;  1VRL A;  5DEQ A;  3KVH A;  5I8U A;  2Q9P A;  4HVY A;  1V8T A;  5GHP A;  3X0M A;  5CFJ A;  1VK6 A;  1QVJ A;  2QKM B;  2A8Q A;  3E57 A;  2CL3 A;  3BHO A;  1VCD A;  2VNQ A;  2YVO A;  2CZR A;  2A8S A;  3O8S A;  1X84 A;  3RH7 A;  4YPH A;  3X0L A;  2A8R A;  1K2E A;  3EXQ A;  2XSQ A;  5ANV A;  4HFQ A;  1V8M A;  3BM4 A;  4ZG0 A;  5FSI A;  2A8T A;  3F13 A;  3A6U A;  1X51 A;  3AC9 A;  4S2W A;  1V8S A;  1SU2 A;  5FSL A;  3X0J A;  3ACA A;  3R03 A;  3CNG A;  1NFS A;  1XSA A;  3H95 A;  3QSJ A;  1SZ3 A;  1SJY A;  3I7V A;  4JZU A;  5GHN A;  5CFI A;  2I8U A;  2YYH A;  1KT9 A;  1NQY A;  3OGA A;  3N77 A;  3SMD A;  3X0O A;  4S2Y A;  4YPR A;  3GZ5 A;  1VHZ A;  4S2X A;  1I9A A;  4KG3 A;  3A6S A;  1JKN A;  2O1C A;  1IRY A;  3EEU A;  1Q54 A;  2W4E A;  1XSB A;  3X0I A;  4V14 A;  5BS6 A;  3GG6 A;  5GHO A;  3MGM A;  1JRK A;  3SON A;  1PUQ A;  3G0Q A;  3EES A;  1GA7 A;  5ANT A;  4K6E A;  3FK9 A;  1PPW A;  4KYX A;  1R67 A;  2YVN A;  1Q27 A;  3I9X A;  2A8P A;  5FSK A;  3FJY A;  3ZR1 A;  1XSC A;  2A6T A;  1MP2 A;  2KDV A;  3EF5 A;  5IW5 A;  4YOQ A;  4ILQ A;  1V8Y A;  1V8L A;  1HZT A;  2QJO A;  3Q4I A;  1V8I A;  2DUK A;  5FSN A;  2PNY A;  3FCM A;  1G0S A;  5GHJ A;  3X0R A;  5LPG A;  2RRK A;  2YVM A;  2GB5 A;  5ANU A;  3MDG A;  1Q33 A;  3FFU A;  3P5T A;  3I7U A;  1RRQ A;  1V8R A;  1PPX A;  2B0V A;  3ID9 A;  1NFZ A;  3Q93 A;  4KTB A;  1VHG A;  1RRS A;  1U20 A;  4JZS A;  1VC8 A;  4N1T A;  1G9Q A;  3MDI A;  1MR2 A;  5ANW A;  2GT4 A;  3Q1P A;  5ISY A;  1RYA A;  3GZ8 A;  5DPK A;  1MQE A;  1PPV A;  2DSB A;  2DSD A;  3N9U A;  1PUN A;  1MQW A;  1VIQ A;  2ICJ A;  2KDW A;  3X0N A;  3A6V A;  4JZV A;  2ICK A;  1V8W A;  5DD4 A;  4NFX A;  3HHJ A;  5DDG A;  3J7Y e;  5IW4 A;  2B06 A;  4J7G A;  3DUP A;  2DHO A;  3MCF A;  3F6A A;  4S2V A;  5GHI A;  1K26 A;  1VIU A;  2VNP A;  4N1U A;  4DYW A;  3X0P A;  3GRN A;  1V8N A;  1KTG A;  2JVB A;  2DSC A;  3BAP A;  3COU A;  5FSO A;  5BON A;  3WHW A;  1VC9 A;  2FML A;  2G73 A;  5ANS A;  2FVV A;  5C7T A;  3P6Y A;  4KG4 A;  2B2K A;  5GHQ A;  5HZX A;  1MUT A;  4C9X A;  3GZ6 A;  2I8T A;  3O61 A;  5GHM A;  3Q91 A;  3X0Q A;  1PVF A;  4C9W A;  2O5F A;  3SHD A;  3X0K A;  3A6T A;  3Q2T A;  1TUM A;  3GWY A;  4ICK A;  3HYQ A;  1X83 A;  2O5W A;  2AZW A;  3O52 A;  3X0S A;  1MK1 A;  4IJX A; 
#chains in the Genus database with same CATH homology
 4MPO A;  3ZR0 A;  5FSM A;  1V8U A;  2G74 A;  3Q2S A;  2YVP A;  1SOI A;  2FKB A;  4NFW A;  2QJT A;  1KHZ A;  1HX3 A;  1F3Y A;  3L85 A;  1V8V A;  3FSP A;  2I6K A;  2J8Q A;  3DKU A;  1OW2 A;  4JZT A;  5C8L A;  3U53 A;  2R5W A;  2PQV A;  1NQZ A;  1PUS A;  3O6Z A;  3O69 A;  4J7H A;  5C7Q A;  2GT2 A;  1VRL A;  5DEQ A;  3KVH A;  5I8U A;  2Q9P A;  4HVY A;  1V8T A;  5GHP A;  3X0M A;  5CFJ A;  1VK6 A;  1QVJ A;  2QKM B;  2A8Q A;  3E57 A;  2CL3 A;  3BHO A;  1VCD A;  2VNQ A;  2YVO A;  2CZR A;  2A8S A;  3O8S A;  1X84 A;  3RH7 A;  4YPH A;  3X0L A;  2A8R A;  1K2E A;  3EXQ A;  2XSQ A;  5ANV A;  4HFQ A;  1V8M A;  3BM4 A;  4ZG0 A;  5FSI A;  2A8T A;  3F13 A;  3A6U A;  1X51 A;  3AC9 A;  4S2W A;  1V8S A;  1SU2 A;  5FSL A;  3X0J A;  3ACA A;  3R03 A;  3CNG A;  1NFS A;  1XSA A;  3H95 A;  3QSJ A;  1SZ3 A;  1SJY A;  3I7V A;  4JZU A;  5GHN A;  5CFI A;  2I8U A;  2YYH A;  1KT9 A;  1NQY A;  3OGA A;  3N77 A;  3SMD A;  3X0O A;  4S2Y A;  4YPR A;  3GZ5 A;  1VHZ A;  4S2X A;  1I9A A;  4KG3 A;  3A6S A;  1JKN A;  2O1C A;  1IRY A;  3EEU A;  1Q54 A;  2W4E A;  1XSB A;  3X0I A;  4V14 A;  5BS6 A;  3GG6 A;  5GHO A;  3MGM A;  1JRK A;  3SON A;  1PUQ A;  3G0Q A;  3EES A;  1GA7 A;  5ANT A;  4K6E A;  3FK9 A;  1PPW A;  4KYX A;  1R67 A;  2YVN A;  1Q27 A;  3I9X A;  2A8P A;  5FSK A;  3FJY A;  3ZR1 A;  1XSC A;  2A6T A;  1MP2 A;  2KDV A;  3EF5 A;  5IW5 A;  4YOQ A;  4ILQ A;  1V8Y A;  1V8L A;  1HZT A;  2QJO A;  3Q4I A;  1V8I A;  2DUK A;  5FSN A;  2PNY A;  3FCM A;  1G0S A;  5GHJ A;  3X0R A;  5LPG A;  2RRK A;  2YVM A;  2GB5 A;  5ANU A;  3MDG A;  1Q33 A;  3FFU A;  3P5T A;  3I7U A;  1RRQ A;  1V8R A;  1PPX A;  2B0V A;  3ID9 A;  1NFZ A;  3Q93 A;  4KTB A;  1VHG A;  1RRS A;  1U20 A;  4JZS A;  1VC8 A;  4N1T A;  1G9Q A;  3MDI A;  1MR2 A;  5ANW A;  2GT4 A;  3Q1P A;  5ISY A;  1RYA A;  3GZ8 A;  5DPK A;  1MQE A;  1PPV A;  2DSB A;  2DSD A;  3N9U A;  1PUN A;  1MQW A;  1VIQ A;  2ICJ A;  2KDW A;  3X0N A;  3A6V A;  4JZV A;  2ICK A;  1V8W A;  5DD4 A;  4NFX A;  3HHJ A;  5DDG A;  3J7Y e;  5IW4 A;  2B06 A;  4J7G A;  3DUP A;  2DHO A;  3MCF A;  3F6A A;  4S2V A;  5GHI A;  1K26 A;  1VIU A;  2VNP A;  4N1U A;  4DYW A;  3X0P A;  3GRN A;  1V8N A;  1KTG A;  2JVB A;  2DSC A;  3BAP A;  3COU A;  5FSO A;  5BON A;  3WHW A;  1VC9 A;  2FML A;  2G73 A;  5ANS A;  2FVV A;  5C7T A;  3P6Y A;  4KG4 A;  2B2K A;  5GHQ A;  5HZX A;  1MUT A;  4C9X A;  3GZ6 A;  2I8T A;  3O61 A;  5GHM A;  3Q91 A;  3X0Q A;  1PVF A;  4C9W A;  2O5F A;  3SHD A;  3X0K A;  3A6T A;  3Q2T A;  1TUM A;  3GWY A;  4ICK A;  3HYQ A;  1X83 A;  2O5W A;  2AZW A;  3O52 A;  3X0S A;  1MK1 A;  4IJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...