3O61A

Structure of the e100a e.coli gdp-mannose hydrolase (yffh) in complex with gdp-mannose and mg++
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
191
structure length
187
Chain Sequence
MTQQITLIKDKILSDNYFTLHNITYDLTRKDGEVIRHKREVYDRGNGATILLYNTKKKTVVLIRQFRVATWVNGNESGQLIESCAGLLDNDEPEVCIRKAAIEETGYEVGEVRKLFELYMSPGGVTELIHFFIAEYSDNQRANAGGEDIEVLELPFSQALEMIKTGEIRDGKTVLLLNYLQTSHLMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GDP-mannose pyrophosphatase nudK
publication title Structural studies of the Nudix GDP-mannose hydrolase from E. coli reveals a new motif for mannose recognition.
pubmed doi rcsb
source organism Escherichia coli
total genus 47
structure length 187
sequence length 191
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.-:
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3o61A00
1KTGA 2DSDA 3EXQA 1Q54A 1MUTA 1KT9A 2GT2A 2DUKA 3Q93A 3I9XA 5DD4A 3BHOA 3I7VA 1V8TA 3GRNA 4ICKA 1V8SA 3Q1PA 4KYXA 1K2EA 1VIQA 2ICJA 1XSAA 3BM4A 4S2WA 5BONA 5ISYA 1IRYA 2R5WA 2RRKA 4NFWA 5ANWA 5FSMA 3KVHA 1VRLA 1X83A 3QSJA 1PVFA 1PUSA 3F13A 3R03A 1TUMA 1V8MA 3CNGA 1G0SA 3O61A 3ZR0A 5FSKA 4N1TA 3X0LA 5I8UA 3X0SA 5C7TA 1QVJA 3X0IA 3X0NA 4V14A 3BAPA 2DSCA 3COUA 3DKUA 1V8IA 4ILQA 3EESA 5ANSA 5FSNA 3X0PA 5GHIA 1VC9A 5DPKA 1X84A 3X0MA 3FSPA 2KDVA 2B2KA 4C9XA 3Q2SA 1G9QA 3A6VA 2A8QA 4S2XA 4JZVA 1NFSA 2G73A 3O6ZA 5BS6A 2O1CA 3MGMA 3GZ8A 1HZTA 2FVVA 2GT4A 5GHQA 2XSQA 5IW4A 3FJYA 2QKMB 3O52A 1RRSA 3GG6A 3X0OA 2O5FA 4JZTA 1PUNA 1V8RA 2PQVA 4JZUA 1VHZA 2A6TA 2G74A 2GB5A 5GHJA 1PPVA 1RYAA 2I6KA 2J8QA 2DSBA 2W4EA 1MR2A 3EF5A 3HHJA 3P5TA 3L85A 5CFIA 3OGAA 3X0RA 3G0QA 3E57A 3MDGA 2PNYA 2A8SA 5C8LA 3U53A 5ANTA 3MDIA 3GWYA 3N9UA 1NQZA 4YPHA 4HFQA 3FK9A 2FKBA 5LPGA 1VK6A 2VNPA 1XSCA 1V8YA 5DEQA 1MQWA 5GHOA 1JKNA 1SZ3A 1V8WA 2B0VA 3EEUA 1Q27A 5FSIA 1VCDA 3F6AA 2YVOA 1X51A 2AZWA 2I8UA 4MPOA 1MQEA 5GHPA 3HYQA 5GHMA 3X0KA 3GZ6A 3I7UA 3O8SA 4YPRA 3P6YA 1NQYA 1V8NA 1SOIA 3Q4IA 4HVYA 1RRQA 3GZ5A 1HX3A 2A8TA 4DYWA 2A8PA 1I9AA 4YOQA 1XSBA 4ZG0A 4KG3A 2CL3A 3H95A 5ANVA 1NFZA 1SJYA 2YYHA 3J7Ye 3AC9A 1MK1A 1VIUA 3O69A 2A8RA 3Q91A 1VHGA 1R67A 3MCFA 5GHNA 2O5WA 1JRKA 1Q33A 2QJTA 5C7QA 5CFJA 5FSOA 1PPWA 2YVNA 4N1UA 1SU2A 3X0JA 3DUPA 2I8TA 2B06A 3Q2TA 1K26A 5ANUA 1GA7A 2ICKA 3SHDA 1PUQA 1V8UA 2KDWA 1U20A 1PPXA 2YVMA 2FMLA 4IJXA 5DDGA 3A6SA 1V8LA 4JZSA 3SONA 3A6UA 4C9WA 1VC8A 3ACAA 4S2VA 3SMDA 2JVBA 3X0QA 3ZR1A 1MP2A 3A6TA 1V8VA 5HZXA 3FFUA 2VNQA 4NFXA 5FSLA 2Q9PA 4S2YA 2QJOA 1KHZA 3ID9A 3RH7A 3N77A 3WHWA 4KG4A 4KTBA 2DHOA 4K6EA 2YVPA 1OW2A 3FCMA 5IW5A 1F3YA
chains in the Genus database with same CATH superfamily
1KTGA 2DSDA 3EXQA 1Q54A 1MUTA 1KT9A 2GT2A 2DUKA 3Q93A 3I9XA 5DD4A 3BHOA 3I7VA 1V8TA 3GRNA 4ICKA 1V8SA 3Q1PA 4KYXA 1K2EA 1VIQA 2ICJA 1XSAA 3BM4A 4S2WA 5BONA 5ISYA 1IRYA 2R5WA 2RRKA 4NFWA 5ANWA 5FSMA 3KVHA 1VRLA 1X83A 3QSJA 1PVFA 1PUSA 3F13A 3R03A 1TUMA 1V8MA 3CNGA 1G0SA 3O61A 3ZR0A 5FSKA 4N1TA 3X0LA 5I8UA 3X0SA 5C7TA 1QVJA 3X0IA 3X0NA 4V14A 3BAPA 2DSCA 3COUA 3DKUA 1V8IA 4ILQA 3EESA 5ANSA 5FSNA 3X0PA 5GHIA 1VC9A 5DPKA 1X84A 3X0MA 3FSPA 2KDVA 2B2KA 4C9XA 3Q2SA 1G9QA 3A6VA 2A8QA 4S2XA 4JZVA 1NFSA 2G73A 3O6ZA 5BS6A 2O1CA 3MGMA 3GZ8A 1HZTA 2FVVA 2GT4A 5GHQA 2XSQA 5IW4A 3FJYA 2QKMB 3O52A 1RRSA 3GG6A 3X0OA 2O5FA 4JZTA 1PUNA 1V8RA 2PQVA 4JZUA 1VHZA 2A6TA 2G74A 2GB5A 5GHJA 1PPVA 1RYAA 2I6KA 2J8QA 2DSBA 2W4EA 1MR2A 3EF5A 3HHJA 3P5TA 3L85A 5CFIA 3OGAA 3X0RA 3G0QA 3E57A 3MDGA 2PNYA 2A8SA 5C8LA 3U53A 5ANTA 3MDIA 3GWYA 3N9UA 1NQZA 4YPHA 4HFQA 3FK9A 2FKBA 5LPGA 2CZRA 1VK6A 2VNPA 1XSCA 1V8YA 5DEQA 1MQWA 5GHOA 1JKNA 1SZ3A 1V8WA 2B0VA 3EEUA 1Q27A 5FSIA 1VCDA 3F6AA 2YVOA 1X51A 2AZWA 4J7HA 2I8UA 4MPOA 1MQEA 5GHPA 3HYQA 5GHMA 4J7GA 3X0KA 3I7UA 3O8SA 4YPRA 3GZ6A 1NQYA 1V8NA 1SOIA 3Q4IA 4HVYA 1RRQA 3P6YA 3GZ5A 1HX3A 2A8TA 4DYWA 2A8PA 1I9AA 4YOQA 1XSBA 4ZG0A 4KG3A 2CL3A 3H95A 5ANVA 1NFZA 1SJYA 2YYHA 3J7Ye 3AC9A 1MK1A 1VIUA 3O69A 2A8RA 3Q91A 1VHGA 1R67A 3MCFA 5GHNA 2O5WA 1JRKA 1Q33A 2QJTA 5C7QA 5CFJA 5FSOA 1PPWA 2YVNA 4N1UA 1SU2A 3X0JA 3DUPA 2I8TA 2B06A 3Q2TA 1K26A 5ANUA 1GA7A 2ICKA 3SHDA 1PUQA 1V8UA 2KDWA 1U20A 1PPXA 2YVMA 2FMLA 4IJXA 5DDGA 3A6SA 1V8LA 4JZSA 3SONA 3A6UA 4C9WA 1VC8A 3ACAA 4S2VA 3SMDA 2JVBA 3X0QA 3ZR1A 1MP2A 3A6TA 1V8VA 5HZXA 3FFUA 2VNQA 4NFXA 5FSLA 2Q9PA 4S2YA 2QJOA 1KHZA 3ID9A 3RH7A 3N77A 3WHWA 4KG4A 4KTBA 2DHOA 4K6EA 2YVPA 1OW2A 3FCMA 5IW5A 1F3YA
chains in the Genus database with same CATH topology
1KTGA 2DSDA 3EXQA 1Q54A 1MUTA 1KT9A 2GT2A 2DUKA 3Q93A 3I9XA 5DD4A 3BHOA 3I7VA 1V8TA 3GRNA 4ICKA 1V8SA 3Q1PA 4KYXA 1K2EA 1VIQA 2ICJA 1XSAA 3BM4A 4S2WA 5BONA 5ISYA 1IRYA 2R5WA 2RRKA 4NFWA 5ANWA 5FSMA 3KVHA 1VRLA 1X83A 3QSJA 1PVFA 1PUSA 3F13A 3R03A 1TUMA 1V8MA 3CNGA 1G0SA 3O61A 3ZR0A 5FSKA 4N1TA 3X0LA 5I8UA 3X0SA 5C7TA 1QVJA 3X0IA 3X0NA 4V14A 3BAPA 2DSCA 3COUA 3DKUA 1V8IA 4ILQA 3EESA 5ANSA 5FSNA 3X0PA 5GHIA 1VC9A 5DPKA 1X84A 3X0MA 3FSPA 2KDVA 2B2KA 4C9XA 3Q2SA 1G9QA 3A6VA 2A8QA 4S2XA 4JZVA 1NFSA 2G73A 3O6ZA 5BS6A 2O1CA 3MGMA 3GZ8A 1HZTA 2FVVA 2GT4A 5GHQA 2XSQA 5IW4A 3FJYA 2QKMB 3O52A 1RRSA 3GG6A 3X0OA 2O5FA 4JZTA 1PUNA 1V8RA 2PQVA 4JZUA 1VHZA 2A6TA 2G74A 2GB5A 5GHJA 1PPVA 1RYAA 2I6KA 2J8QA 2DSBA 2W4EA 1MR2A 3EF5A 3HHJA 3P5TA 3L85A 5CFIA 3OGAA 3X0RA 3G0QA 3E57A 3MDGA 2PNYA 2A8SA 5C8LA 3U53A 5ANTA 3MDIA 3GWYA 3N9UA 1NQZA 4YPHA 4HFQA 3FK9A 2FKBA 5LPGA 2CZRA 1VK6A 2VNPA 1XSCA 1V8YA 5DEQA 1MQWA 5GHOA 1JKNA 1SZ3A 1V8WA 2B0VA 3EEUA 1Q27A 5FSIA 1VCDA 3F6AA 2YVOA 1X51A 2AZWA 4J7HA 2I8UA 4MPOA 1MQEA 5GHPA 3HYQA 5GHMA 4J7GA 3X0KA 3I7UA 3O8SA 4YPRA 3GZ6A 1NQYA 1V8NA 1SOIA 3Q4IA 4HVYA 1RRQA 3P6YA 3GZ5A 1HX3A 2A8TA 4DYWA 2A8PA 1I9AA 4YOQA 1XSBA 4ZG0A 4KG3A 2CL3A 3H95A 5ANVA 1NFZA 1SJYA 2YYHA 3J7Ye 3AC9A 1MK1A 1VIUA 3O69A 2A8RA 3Q91A 1VHGA 1R67A 3MCFA 5GHNA 2O5WA 1JRKA 1Q33A 2QJTA 5C7QA 5CFJA 5FSOA 1PPWA 2YVNA 4N1UA 1SU2A 3X0JA 3DUPA 2I8TA 2B06A 3Q2TA 1K26A 5ANUA 1GA7A 2ICKA 3SHDA 1PUQA 1V8UA 2KDWA 1U20A 1PPXA 2YVMA 2FMLA 4IJXA 5DDGA 3A6SA 1V8LA 4JZSA 3SONA 3A6UA 4C9WA 1VC8A 3ACAA 4S2VA 3SMDA 2JVBA 3X0QA 3ZR1A 1MP2A 3A6TA 1V8VA 5HZXA 3FFUA 2VNQA 4NFXA 5FSLA 2Q9PA 4S2YA 2QJOA 1KHZA 3ID9A 3RH7A 3N77A 3WHWA 4KG4A 4KTBA 2DHOA 4K6EA 2YVPA 1OW2A 3FCMA 5IW5A 1F3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KTG A;  2DSD A;  3EXQ A;  1Q54 A;  1MUT A;  1KT9 A;  2GT2 A;  2DUK A;  3Q93 A;  3I9X A;  5DD4 A;  3BHO A;  3I7V A;  1V8T A;  3GRN A;  4ICK A;  1V8S A;  3Q1P A;  4KYX A;  1K2E A;  1VIQ A;  2ICJ A;  1XSA A;  3BM4 A;  4S2W A;  5BON A;  5ISY A;  1IRY A;  2R5W A;  2RRK A;  4NFW A;  5ANW A;  5FSM A;  3KVH A;  1VRL A;  1X83 A;  3QSJ A;  1PVF A;  1PUS A;  3F13 A;  3R03 A;  1TUM A;  1V8M A;  3CNG A;  1G0S A;  3O61 A;  3ZR0 A;  5FSK A;  4N1T A;  3X0L A;  5I8U A;  3X0S A;  5C7T A;  1QVJ A;  3X0I A;  3X0N A;  4V14 A;  3BAP A;  2DSC A;  3COU A;  3DKU A;  1V8I A;  4ILQ A;  3EES A;  5ANS A;  5FSN A;  3X0P A;  5GHI A;  1VC9 A;  5DPK A;  1X84 A;  3X0M A;  3FSP A;  2KDV A;  2B2K A;  4C9X A;  3Q2S A;  1G9Q A;  3A6V A;  2A8Q A;  4S2X A;  4JZV A;  1NFS A;  2G73 A;  3O6Z A;  5BS6 A;  2O1C A;  3MGM A;  3GZ8 A;  1HZT A;  2FVV A;  2GT4 A;  5GHQ A;  2XSQ A;  5IW4 A;  3FJY A;  2QKM B;  3O52 A;  1RRS A;  3GG6 A;  3X0O A;  2O5F A;  4JZT A;  1PUN A;  1V8R A;  2PQV A;  4JZU A;  1VHZ A;  2A6T A;  2G74 A;  2GB5 A;  5GHJ A;  1PPV A;  1RYA A;  2I6K A;  2J8Q A;  2DSB A;  2W4E A;  1MR2 A;  3EF5 A;  3HHJ A;  3P5T A;  3L85 A;  5CFI A;  3OGA A;  3X0R A;  3G0Q A;  3E57 A;  3MDG A;  2PNY A;  2A8S A;  5C8L A;  3U53 A;  5ANT A;  3MDI A;  3GWY A;  3N9U A;  1NQZ A;  4YPH A;  4HFQ A;  3FK9 A;  2FKB A;  5LPG A;  1VK6 A;  2VNP A;  1XSC A;  1V8Y A;  5DEQ A;  1MQW A;  5GHO A;  1JKN A;  1SZ3 A;  1V8W A;  2B0V A;  3EEU A;  1Q27 A;  5FSI A;  1VCD A;  3F6A A;  2YVO A;  1X51 A;  2AZW A;  2I8U A;  4MPO A;  1MQE A;  5GHP A;  3HYQ A;  5GHM A;  3X0K A;  3GZ6 A;  3I7U A;  3O8S A;  4YPR A;  3P6Y A;  1NQY A;  1V8N A;  1SOI A;  3Q4I A;  4HVY A;  1RRQ A;  3GZ5 A;  1HX3 A;  2A8T A;  4DYW A;  2A8P A;  1I9A A;  4YOQ A;  1XSB A;  4ZG0 A;  4KG3 A;  2CL3 A;  3H95 A;  5ANV A;  1NFZ A;  1SJY A;  2YYH A;  3J7Y e;  3AC9 A;  1MK1 A;  1VIU A;  3O69 A;  2A8R A;  3Q91 A;  1VHG A;  1R67 A;  3MCF A;  5GHN A;  2O5W A;  1JRK A;  1Q33 A;  2QJT A;  5C7Q A;  5CFJ A;  5FSO A;  1PPW A;  2YVN A;  4N1U A;  1SU2 A;  3X0J A;  3DUP A;  2I8T A;  2B06 A;  3Q2T A;  1K26 A;  5ANU A;  1GA7 A;  2ICK A;  3SHD A;  1PUQ A;  1V8U A;  2KDW A;  1U20 A;  1PPX A;  2YVM A;  2FML A;  4IJX A;  5DDG A;  3A6S A;  1V8L A;  4JZS A;  3SON A;  3A6U A;  4C9W A;  1VC8 A;  3ACA A;  4S2V A;  3SMD A;  2JVB A;  3X0Q A;  3ZR1 A;  1MP2 A;  3A6T A;  1V8V A;  5HZX A;  3FFU A;  2VNQ A;  4NFX A;  5FSL A;  2Q9P A;  4S2Y A;  2QJO A;  1KHZ A;  3ID9 A;  3RH7 A;  3N77 A;  3WHW A;  4KG4 A;  4KTB A;  2DHO A;  4K6E A;  2YVP A;  1OW2 A;  3FCM A;  5IW5 A;  1F3Y A; 
#chains in the Genus database with same CATH topology
 1KTG A;  2DSD A;  3EXQ A;  1Q54 A;  1MUT A;  1KT9 A;  2GT2 A;  2DUK A;  3Q93 A;  3I9X A;  5DD4 A;  3BHO A;  3I7V A;  1V8T A;  3GRN A;  4ICK A;  1V8S A;  3Q1P A;  4KYX A;  1K2E A;  1VIQ A;  2ICJ A;  1XSA A;  3BM4 A;  4S2W A;  5BON A;  5ISY A;  1IRY A;  2R5W A;  2RRK A;  4NFW A;  5ANW A;  5FSM A;  3KVH A;  1VRL A;  1X83 A;  3QSJ A;  1PVF A;  1PUS A;  3F13 A;  3R03 A;  1TUM A;  1V8M A;  3CNG A;  1G0S A;  3O61 A;  3ZR0 A;  5FSK A;  4N1T A;  3X0L A;  5I8U A;  3X0S A;  5C7T A;  1QVJ A;  3X0I A;  3X0N A;  4V14 A;  3BAP A;  2DSC A;  3COU A;  3DKU A;  1V8I A;  4ILQ A;  3EES A;  5ANS A;  5FSN A;  3X0P A;  5GHI A;  1VC9 A;  5DPK A;  1X84 A;  3X0M A;  3FSP A;  2KDV A;  2B2K A;  4C9X A;  3Q2S A;  1G9Q A;  3A6V A;  2A8Q A;  4S2X A;  4JZV A;  1NFS A;  2G73 A;  3O6Z A;  5BS6 A;  2O1C A;  3MGM A;  3GZ8 A;  1HZT A;  2FVV A;  2GT4 A;  5GHQ A;  2XSQ A;  5IW4 A;  3FJY A;  2QKM B;  3O52 A;  1RRS A;  3GG6 A;  3X0O A;  2O5F A;  4JZT A;  1PUN A;  1V8R A;  2PQV A;  4JZU A;  1VHZ A;  2A6T A;  2G74 A;  2GB5 A;  5GHJ A;  1PPV A;  1RYA A;  2I6K A;  2J8Q A;  2DSB A;  2W4E A;  1MR2 A;  3EF5 A;  3HHJ A;  3P5T A;  3L85 A;  5CFI A;  3OGA A;  3X0R A;  3G0Q A;  3E57 A;  3MDG A;  2PNY A;  2A8S A;  5C8L A;  3U53 A;  5ANT A;  3MDI A;  3GWY A;  3N9U A;  1NQZ A;  4YPH A;  4HFQ A;  3FK9 A;  2FKB A;  5LPG A;  2CZR A;  1VK6 A;  2VNP A;  1XSC A;  1V8Y A;  5DEQ A;  1MQW A;  5GHO A;  1JKN A;  1SZ3 A;  1V8W A;  2B0V A;  3EEU A;  1Q27 A;  5FSI A;  1VCD A;  3F6A A;  2YVO A;  1X51 A;  2AZW A;  4J7H A;  2I8U A;  4MPO A;  1MQE A;  5GHP A;  3HYQ A;  5GHM A;  4J7G A;  3X0K A;  3I7U A;  3O8S A;  4YPR A;  3GZ6 A;  1NQY A;  1V8N A;  1SOI A;  3Q4I A;  4HVY A;  1RRQ A;  3P6Y A;  3GZ5 A;  1HX3 A;  2A8T A;  4DYW A;  2A8P A;  1I9A A;  4YOQ A;  1XSB A;  4ZG0 A;  4KG3 A;  2CL3 A;  3H95 A;  5ANV A;  1NFZ A;  1SJY A;  2YYH A;  3J7Y e;  3AC9 A;  1MK1 A;  1VIU A;  3O69 A;  2A8R A;  3Q91 A;  1VHG A;  1R67 A;  3MCF A;  5GHN A;  2O5W A;  1JRK A;  1Q33 A;  2QJT A;  5C7Q A;  5CFJ A;  5FSO A;  1PPW A;  2YVN A;  4N1U A;  1SU2 A;  3X0J A;  3DUP A;  2I8T A;  2B06 A;  3Q2T A;  1K26 A;  5ANU A;  1GA7 A;  2ICK A;  3SHD A;  1PUQ A;  1V8U A;  2KDW A;  1U20 A;  1PPX A;  2YVM A;  2FML A;  4IJX A;  5DDG A;  3A6S A;  1V8L A;  4JZS A;  3SON A;  3A6U A;  4C9W A;  1VC8 A;  3ACA A;  4S2V A;  3SMD A;  2JVB A;  3X0Q A;  3ZR1 A;  1MP2 A;  3A6T A;  1V8V A;  5HZX A;  3FFU A;  2VNQ A;  4NFX A;  5FSL A;  2Q9P A;  4S2Y A;  2QJO A;  1KHZ A;  3ID9 A;  3RH7 A;  3N77 A;  3WHW A;  4KG4 A;  4KTB A;  2DHO A;  4K6E A;  2YVP A;  1OW2 A;  3FCM A;  5IW5 A;  1F3Y A; 
#chains in the Genus database with same CATH homology
 1KTG A;  2DSD A;  3EXQ A;  1Q54 A;  1MUT A;  1KT9 A;  2GT2 A;  2DUK A;  3Q93 A;  3I9X A;  5DD4 A;  3BHO A;  3I7V A;  1V8T A;  3GRN A;  4ICK A;  1V8S A;  3Q1P A;  4KYX A;  1K2E A;  1VIQ A;  2ICJ A;  1XSA A;  3BM4 A;  4S2W A;  5BON A;  5ISY A;  1IRY A;  2R5W A;  2RRK A;  4NFW A;  5ANW A;  5FSM A;  3KVH A;  1VRL A;  1X83 A;  3QSJ A;  1PVF A;  1PUS A;  3F13 A;  3R03 A;  1TUM A;  1V8M A;  3CNG A;  1G0S A;  3O61 A;  3ZR0 A;  5FSK A;  4N1T A;  3X0L A;  5I8U A;  3X0S A;  5C7T A;  1QVJ A;  3X0I A;  3X0N A;  4V14 A;  3BAP A;  2DSC A;  3COU A;  3DKU A;  1V8I A;  4ILQ A;  3EES A;  5ANS A;  5FSN A;  3X0P A;  5GHI A;  1VC9 A;  5DPK A;  1X84 A;  3X0M A;  3FSP A;  2KDV A;  2B2K A;  4C9X A;  3Q2S A;  1G9Q A;  3A6V A;  2A8Q A;  4S2X A;  4JZV A;  1NFS A;  2G73 A;  3O6Z A;  5BS6 A;  2O1C A;  3MGM A;  3GZ8 A;  1HZT A;  2FVV A;  2GT4 A;  5GHQ A;  2XSQ A;  5IW4 A;  3FJY A;  2QKM B;  3O52 A;  1RRS A;  3GG6 A;  3X0O A;  2O5F A;  4JZT A;  1PUN A;  1V8R A;  2PQV A;  4JZU A;  1VHZ A;  2A6T A;  2G74 A;  2GB5 A;  5GHJ A;  1PPV A;  1RYA A;  2I6K A;  2J8Q A;  2DSB A;  2W4E A;  1MR2 A;  3EF5 A;  3HHJ A;  3P5T A;  3L85 A;  5CFI A;  3OGA A;  3X0R A;  3G0Q A;  3E57 A;  3MDG A;  2PNY A;  2A8S A;  5C8L A;  3U53 A;  5ANT A;  3MDI A;  3GWY A;  3N9U A;  1NQZ A;  4YPH A;  4HFQ A;  3FK9 A;  2FKB A;  5LPG A;  2CZR A;  1VK6 A;  2VNP A;  1XSC A;  1V8Y A;  5DEQ A;  1MQW A;  5GHO A;  1JKN A;  1SZ3 A;  1V8W A;  2B0V A;  3EEU A;  1Q27 A;  5FSI A;  1VCD A;  3F6A A;  2YVO A;  1X51 A;  2AZW A;  4J7H A;  2I8U A;  4MPO A;  1MQE A;  5GHP A;  3HYQ A;  5GHM A;  4J7G A;  3X0K A;  3I7U A;  3O8S A;  4YPR A;  3GZ6 A;  1NQY A;  1V8N A;  1SOI A;  3Q4I A;  4HVY A;  1RRQ A;  3P6Y A;  3GZ5 A;  1HX3 A;  2A8T A;  4DYW A;  2A8P A;  1I9A A;  4YOQ A;  1XSB A;  4ZG0 A;  4KG3 A;  2CL3 A;  3H95 A;  5ANV A;  1NFZ A;  1SJY A;  2YYH A;  3J7Y e;  3AC9 A;  1MK1 A;  1VIU A;  3O69 A;  2A8R A;  3Q91 A;  1VHG A;  1R67 A;  3MCF A;  5GHN A;  2O5W A;  1JRK A;  1Q33 A;  2QJT A;  5C7Q A;  5CFJ A;  5FSO A;  1PPW A;  2YVN A;  4N1U A;  1SU2 A;  3X0J A;  3DUP A;  2I8T A;  2B06 A;  3Q2T A;  1K26 A;  5ANU A;  1GA7 A;  2ICK A;  3SHD A;  1PUQ A;  1V8U A;  2KDW A;  1U20 A;  1PPX A;  2YVM A;  2FML A;  4IJX A;  5DDG A;  3A6S A;  1V8L A;  4JZS A;  3SON A;  3A6U A;  4C9W A;  1VC8 A;  3ACA A;  4S2V A;  3SMD A;  2JVB A;  3X0Q A;  3ZR1 A;  1MP2 A;  3A6T A;  1V8V A;  5HZX A;  3FFU A;  2VNQ A;  4NFX A;  5FSL A;  2Q9P A;  4S2Y A;  2QJO A;  1KHZ A;  3ID9 A;  3RH7 A;  3N77 A;  3WHW A;  4KG4 A;  4KTB A;  2DHO A;  4K6E A;  2YVP A;  1OW2 A;  3FCM A;  5IW5 A;  1F3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...