5ANSA

Potent and selective inhibitors of mth1 probe its role in cancer cell survival
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
155
structure length
155
Chain Sequence
GASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 7,8-DIHYDRO-8-OXOGUANINE TRIPHOSPHATASE
publication title Potent and Selective Inhibitors of Mth1 Probe its Role in Cancer Cell Survival.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 155
sequence length 155
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5ansA00
1PPVA 1XSCA 2JVBA 3O61A 3Q2SA 2AZWA 2VNPA 4YOQA 3X0OA 1VC8A 3X0NA 1KTGA 1SZ3A 1VHZA 2B06A 2YVPA 1TUMA 3I9XA 2FVVA 1HZTA 1X84A 5DD4A 2FMLA 2A8QA 1X51A 1NQZA 2YVOA 4JZSA 5GHQA 1X83A 1V8SA 1PUSA 4NFWA 1MK1A 3X0IA 3X0MA 1V8TA 2CL3A 1XSBA 5ANSA 5DDGA 3E57A 4KTBA 1MQWA 2I6KA 3O6ZA 2DSCA 2PNYA 1V8LA 2RRKA 3F13A 2DSBA 2QJTA 5FSOA 3ZR0A 1F3YA 3N9UA 3Q93A 5HZXA 1VK6A 5ANUA 2B0VA 4JZTA 2J8QA 1Q27A 3P5TA 5FSMA 1V8IA 1PUQA 2W4EA 2A6TA 4KG4A 5GHMA 5C7QA 1MQEA 5C8LA 3Q2TA 3MDIA 3FK9A 3KVHA 2I8TA 1VHGA 4YPRA 3DUPA 3SONA 3P6YA 1SJYA 2G73A 3HYQA 1I9AA 1KHZA 1NFZA 3U53A 5C7TA 1HX3A 5IW4A 5GHIA 1Q33A 4KYXA 1PPWA 3BHOA 4MPOA 3GZ6A 4S2XA 4JZVA 2XSQA 3MDGA 3J7Ye 2A8SA 3ID9A 1V8YA 1PVFA 1RRSA 2B2KA 1V8UA 1SU2A 2FKBA 5FSLA 3X0SA 3GZ5A 2YVMA 1VCDA 5FSKA 4HFQA 3O52A 1MUTA 2DSDA 3Q1PA 3X0QA 5GHPA 3X0RA 4ICKA 1VIUA 1G9QA 3N77A 1Q54A 1MR2A 2A8RA 1VIQA 3A6UA 3HHJA 3A6VA 1PPXA 3SMDA 4DYWA 3A6SA 3Q91A 4N1TA 4NFXA 2GB5A 3FCMA 2O5FA 3I7VA 1V8VA 3GZ8A 1U20A 3CNGA 3GRNA 2O1CA 2YYHA 5I8UA 3X0KA 1NQYA 3F6AA 4IJXA 5ANVA 4N1UA 5BS6A 3ZR1A 4C9WA 1RRQA 1G0SA 2ICJA 2A8PA 1R67A 3EEUA 2KDVA 3A6TA 5IW5A 5ANTA 3FJYA 2GT4A 5FSNA 3WHWA 2R5WA 3BAPA 1PUNA 3GWYA 1JKNA 5BONA 4HVYA 1V8MA 4YPHA 1K2EA 3X0PA 5DPKA 1VRLA 1V8NA 3I7UA 1V8RA 3FFUA 3O69A 2I8UA 4JZUA 1NFSA 3FSPA 4ILQA 3RH7A 5DEQA 4C9XA 4S2YA 3SHDA 5LPGA 5GHOA 4S2WA 2Q9PA 5CFIA 2DUKA 2G74A 3H95A 1RYAA 3G0QA 2YVNA 3AC9A 4S2VA 5GHNA 3COUA 3MCFA 3BM4A 5CFJA 2QKMB 4K6EA 1GA7A 5ANWA 4ZG0A 1K26A 1XSAA 3O8SA 3EF5A 2VNQA 3MGMA 1JRKA 1SOIA 1VC9A 5ISYA 4KG3A 2A8TA 2ICKA 1IRYA 2DHOA 3R03A 1MP2A 3ACAA 5GHJA 2O5WA 2QJOA 2PQVA 2KDWA 3DKUA 2GT2A 1V8WA 1QVJA 3EXQA 5FSIA 3EESA 3GG6A 3L85A 3Q4IA 1KT9A 1OW2A 3X0LA 3OGAA 3QSJA 3X0JA 4V14A
chains in the Genus database with same CATH superfamily
1PPVA 1XSCA 2JVBA 3O61A 3Q2SA 2AZWA 2VNPA 4YOQA 3X0OA 1VC8A 3X0NA 1KTGA 1SZ3A 1VHZA 2B06A 2YVPA 1TUMA 3I9XA 2FVVA 1HZTA 1X84A 5DD4A 2FMLA 2A8QA 1X51A 1NQZA 2YVOA 4JZSA 5GHQA 1X83A 1V8SA 1PUSA 4NFWA 1MK1A 3X0IA 3X0MA 1V8TA 2CL3A 1XSBA 5ANSA 5DDGA 3E57A 4KTBA 1MQWA 2I6KA 3O6ZA 2DSCA 2PNYA 1V8LA 2RRKA 3F13A 2DSBA 2QJTA 5FSOA 3ZR0A 1F3YA 3N9UA 3Q93A 5HZXA 1VK6A 5ANUA 2B0VA 4JZTA 2J8QA 1Q27A 3P5TA 5FSMA 1V8IA 1PUQA 2W4EA 2A6TA 4KG4A 5GHMA 5C7QA 1MQEA 5C8LA 3Q2TA 3MDIA 3FK9A 3KVHA 2I8TA 1VHGA 4YPRA 3DUPA 3SONA 3P6YA 1SJYA 2G73A 3HYQA 1I9AA 1KHZA 1NFZA 3U53A 5C7TA 1HX3A 5IW4A 5GHIA 1Q33A 4KYXA 1PPWA 3BHOA 4MPOA 3GZ6A 4S2XA 4JZVA 2XSQA 3MDGA 3J7Ye 2A8SA 3ID9A 1V8YA 1PVFA 1RRSA 2B2KA 1V8UA 1SU2A 2FKBA 5FSLA 3X0SA 3GZ5A 2YVMA 1VCDA 5FSKA 4HFQA 3O52A 1MUTA 2DSDA 3Q1PA 3X0QA 5GHPA 3X0RA 4J7GA 4ICKA 1VIUA 1G9QA 3N77A 4J7HA 1Q54A 1MR2A 2A8RA 1VIQA 3A6UA 3HHJA 3A6VA 1PPXA 3SMDA 4DYWA 3A6SA 3Q91A 4N1TA 4NFXA 2GB5A 3FCMA 2O5FA 3I7VA 1V8VA 3GZ8A 1U20A 3CNGA 3GRNA 2O1CA 2YYHA 5I8UA 3X0KA 1NQYA 3F6AA 4IJXA 5ANVA 4N1UA 5BS6A 3ZR1A 4C9WA 1RRQA 1G0SA 2ICJA 2CZRA 2A8PA 1R67A 3EEUA 2KDVA 3A6TA 5IW5A 5ANTA 3FJYA 2GT4A 5FSNA 3WHWA 2R5WA 3BAPA 1PUNA 3GWYA 1JKNA 5BONA 4HVYA 1V8MA 4YPHA 1K2EA 3X0PA 5DPKA 1VRLA 1V8NA 3I7UA 1V8RA 3FFUA 3O69A 2I8UA 4JZUA 1NFSA 3FSPA 4ILQA 3RH7A 5DEQA 4C9XA 4S2YA 3SHDA 5LPGA 5GHOA 4S2WA 2Q9PA 5CFIA 2DUKA 2G74A 3H95A 1RYAA 3G0QA 2YVNA 3AC9A 4S2VA 5GHNA 3COUA 3MCFA 3BM4A 5CFJA 2QKMB 4K6EA 1GA7A 5ANWA 4ZG0A 1K26A 1XSAA 3O8SA 3EF5A 2VNQA 3MGMA 1JRKA 1SOIA 1VC9A 5ISYA 4KG3A 2A8TA 2ICKA 1IRYA 2DHOA 3R03A 1MP2A 3ACAA 5GHJA 2O5WA 2QJOA 2PQVA 2KDWA 3DKUA 2GT2A 1V8WA 1QVJA 3EXQA 5FSIA 3EESA 3GG6A 3L85A 3Q4IA 1KT9A 1OW2A 3X0LA 3OGAA 3QSJA 3X0JA 4V14A
chains in the Genus database with same CATH topology
1PPVA 1XSCA 2JVBA 3O61A 3Q2SA 2AZWA 2VNPA 4YOQA 3X0OA 1VC8A 3X0NA 1KTGA 1SZ3A 1VHZA 2B06A 2YVPA 1TUMA 3I9XA 2FVVA 1HZTA 1X84A 5DD4A 2FMLA 2A8QA 1X51A 1NQZA 2YVOA 4JZSA 5GHQA 1X83A 1V8SA 1PUSA 4NFWA 1MK1A 3X0IA 3X0MA 1V8TA 2CL3A 1XSBA 5ANSA 5DDGA 3E57A 4KTBA 1MQWA 2I6KA 3O6ZA 2DSCA 2PNYA 1V8LA 2RRKA 3F13A 2DSBA 2QJTA 5FSOA 3ZR0A 1F3YA 3N9UA 3Q93A 5HZXA 1VK6A 5ANUA 2B0VA 4JZTA 2J8QA 1Q27A 3P5TA 5FSMA 1V8IA 1PUQA 2W4EA 2A6TA 4KG4A 5GHMA 5C7QA 1MQEA 5C8LA 3Q2TA 3MDIA 3FK9A 3KVHA 2I8TA 1VHGA 4YPRA 3DUPA 3SONA 3P6YA 1SJYA 2G73A 3HYQA 1I9AA 1KHZA 1NFZA 3U53A 5C7TA 1HX3A 5IW4A 5GHIA 1Q33A 4KYXA 1PPWA 3BHOA 4MPOA 3GZ6A 4S2XA 4JZVA 2XSQA 3MDGA 3J7Ye 2A8SA 3ID9A 1V8YA 1PVFA 1RRSA 2B2KA 1V8UA 1SU2A 2FKBA 5FSLA 3X0SA 3GZ5A 2YVMA 1VCDA 5FSKA 4HFQA 3O52A 1MUTA 2DSDA 3Q1PA 3X0QA 5GHPA 3X0RA 4J7GA 4ICKA 1VIUA 1G9QA 3N77A 4J7HA 1Q54A 1MR2A 2A8RA 1VIQA 3A6UA 3HHJA 3A6VA 1PPXA 3SMDA 4DYWA 3A6SA 3Q91A 4N1TA 4NFXA 2GB5A 3FCMA 2O5FA 3I7VA 1V8VA 3GZ8A 1U20A 3CNGA 3GRNA 2O1CA 2YYHA 5I8UA 3X0KA 1NQYA 3F6AA 4IJXA 5ANVA 4N1UA 5BS6A 3ZR1A 4C9WA 1RRQA 1G0SA 2ICJA 2CZRA 2A8PA 1R67A 3EEUA 2KDVA 3A6TA 5IW5A 5ANTA 3FJYA 2GT4A 5FSNA 3WHWA 2R5WA 3BAPA 1PUNA 3GWYA 1JKNA 5BONA 4HVYA 1V8MA 4YPHA 1K2EA 3X0PA 5DPKA 1VRLA 1V8NA 3I7UA 1V8RA 3FFUA 3O69A 2I8UA 4JZUA 1NFSA 3FSPA 4ILQA 3RH7A 5DEQA 4C9XA 4S2YA 3SHDA 5LPGA 5GHOA 4S2WA 2Q9PA 5CFIA 2DUKA 2G74A 3H95A 1RYAA 3G0QA 2YVNA 3AC9A 4S2VA 5GHNA 3COUA 3MCFA 3BM4A 5CFJA 2QKMB 4K6EA 1GA7A 5ANWA 4ZG0A 1K26A 1XSAA 3O8SA 3EF5A 2VNQA 3MGMA 1JRKA 1SOIA 1VC9A 5ISYA 4KG3A 2A8TA 2ICKA 1IRYA 2DHOA 3R03A 1MP2A 3ACAA 5GHJA 2O5WA 2QJOA 2PQVA 2KDWA 3DKUA 2GT2A 1V8WA 1QVJA 3EXQA 5FSIA 3EESA 3GG6A 3L85A 3Q4IA 1KT9A 1OW2A 3X0LA 3OGAA 3QSJA 3X0JA 4V14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PPV A;  1XSC A;  2JVB A;  3O61 A;  3Q2S A;  2AZW A;  2VNP A;  4YOQ A;  3X0O A;  1VC8 A;  3X0N A;  1KTG A;  1SZ3 A;  1VHZ A;  2B06 A;  2YVP A;  1TUM A;  3I9X A;  2FVV A;  1HZT A;  1X84 A;  5DD4 A;  2FML A;  2A8Q A;  1X51 A;  1NQZ A;  2YVO A;  4JZS A;  5GHQ A;  1X83 A;  1V8S A;  1PUS A;  4NFW A;  1MK1 A;  3X0I A;  3X0M A;  1V8T A;  2CL3 A;  1XSB A;  5ANS A;  5DDG A;  3E57 A;  4KTB A;  1MQW A;  2I6K A;  3O6Z A;  2DSC A;  2PNY A;  1V8L A;  2RRK A;  3F13 A;  2DSB A;  2QJT A;  5FSO A;  3ZR0 A;  1F3Y A;  3N9U A;  3Q93 A;  5HZX A;  1VK6 A;  5ANU A;  2B0V A;  4JZT A;  2J8Q A;  1Q27 A;  3P5T A;  5FSM A;  1V8I A;  1PUQ A;  2W4E A;  2A6T A;  4KG4 A;  5GHM A;  5C7Q A;  1MQE A;  5C8L A;  3Q2T A;  3MDI A;  3FK9 A;  3KVH A;  2I8T A;  1VHG A;  4YPR A;  3DUP A;  3SON A;  3P6Y A;  1SJY A;  2G73 A;  3HYQ A;  1I9A A;  1KHZ A;  1NFZ A;  3U53 A;  5C7T A;  1HX3 A;  5IW4 A;  5GHI A;  1Q33 A;  4KYX A;  1PPW A;  3BHO A;  4MPO A;  3GZ6 A;  4S2X A;  4JZV A;  2XSQ A;  3MDG A;  3J7Y e;  2A8S A;  3ID9 A;  1V8Y A;  1PVF A;  1RRS A;  2B2K A;  1V8U A;  1SU2 A;  2FKB A;  5FSL A;  3X0S A;  3GZ5 A;  2YVM A;  1VCD A;  5FSK A;  4HFQ A;  3O52 A;  1MUT A;  2DSD A;  3Q1P A;  3X0Q A;  5GHP A;  3X0R A;  4ICK A;  1VIU A;  1G9Q A;  3N77 A;  1Q54 A;  1MR2 A;  2A8R A;  1VIQ A;  3A6U A;  3HHJ A;  3A6V A;  1PPX A;  3SMD A;  4DYW A;  3A6S A;  3Q91 A;  4N1T A;  4NFX A;  2GB5 A;  3FCM A;  2O5F A;  3I7V A;  1V8V A;  3GZ8 A;  1U20 A;  3CNG A;  3GRN A;  2O1C A;  2YYH A;  5I8U A;  3X0K A;  1NQY A;  3F6A A;  4IJX A;  5ANV A;  4N1U A;  5BS6 A;  3ZR1 A;  4C9W A;  1RRQ A;  1G0S A;  2ICJ A;  2A8P A;  1R67 A;  3EEU A;  2KDV A;  3A6T A;  5IW5 A;  5ANT A;  3FJY A;  2GT4 A;  5FSN A;  3WHW A;  2R5W A;  3BAP A;  1PUN A;  3GWY A;  1JKN A;  5BON A;  4HVY A;  1V8M A;  4YPH A;  1K2E A;  3X0P A;  5DPK A;  1VRL A;  1V8N A;  3I7U A;  1V8R A;  3FFU A;  3O69 A;  2I8U A;  4JZU A;  1NFS A;  3FSP A;  4ILQ A;  3RH7 A;  5DEQ A;  4C9X A;  4S2Y A;  3SHD A;  5LPG A;  5GHO A;  4S2W A;  2Q9P A;  5CFI A;  2DUK A;  2G74 A;  3H95 A;  1RYA A;  3G0Q A;  2YVN A;  3AC9 A;  4S2V A;  5GHN A;  3COU A;  3MCF A;  3BM4 A;  5CFJ A;  2QKM B;  4K6E A;  1GA7 A;  5ANW A;  4ZG0 A;  1K26 A;  1XSA A;  3O8S A;  3EF5 A;  2VNQ A;  3MGM A;  1JRK A;  1SOI A;  1VC9 A;  5ISY A;  4KG3 A;  2A8T A;  2ICK A;  1IRY A;  2DHO A;  3R03 A;  1MP2 A;  3ACA A;  5GHJ A;  2O5W A;  2QJO A;  2PQV A;  2KDW A;  3DKU A;  2GT2 A;  1V8W A;  1QVJ A;  3EXQ A;  5FSI A;  3EES A;  3GG6 A;  3L85 A;  3Q4I A;  1KT9 A;  1OW2 A;  3X0L A;  3OGA A;  3QSJ A;  3X0J A;  4V14 A; 
#chains in the Genus database with same CATH topology
 1PPV A;  1XSC A;  2JVB A;  3O61 A;  3Q2S A;  2AZW A;  2VNP A;  4YOQ A;  3X0O A;  1VC8 A;  3X0N A;  1KTG A;  1SZ3 A;  1VHZ A;  2B06 A;  2YVP A;  1TUM A;  3I9X A;  2FVV A;  1HZT A;  1X84 A;  5DD4 A;  2FML A;  2A8Q A;  1X51 A;  1NQZ A;  2YVO A;  4JZS A;  5GHQ A;  1X83 A;  1V8S A;  1PUS A;  4NFW A;  1MK1 A;  3X0I A;  3X0M A;  1V8T A;  2CL3 A;  1XSB A;  5ANS A;  5DDG A;  3E57 A;  4KTB A;  1MQW A;  2I6K A;  3O6Z A;  2DSC A;  2PNY A;  1V8L A;  2RRK A;  3F13 A;  2DSB A;  2QJT A;  5FSO A;  3ZR0 A;  1F3Y A;  3N9U A;  3Q93 A;  5HZX A;  1VK6 A;  5ANU A;  2B0V A;  4JZT A;  2J8Q A;  1Q27 A;  3P5T A;  5FSM A;  1V8I A;  1PUQ A;  2W4E A;  2A6T A;  4KG4 A;  5GHM A;  5C7Q A;  1MQE A;  5C8L A;  3Q2T A;  3MDI A;  3FK9 A;  3KVH A;  2I8T A;  1VHG A;  4YPR A;  3DUP A;  3SON A;  3P6Y A;  1SJY A;  2G73 A;  3HYQ A;  1I9A A;  1KHZ A;  1NFZ A;  3U53 A;  5C7T A;  1HX3 A;  5IW4 A;  5GHI A;  1Q33 A;  4KYX A;  1PPW A;  3BHO A;  4MPO A;  3GZ6 A;  4S2X A;  4JZV A;  2XSQ A;  3MDG A;  3J7Y e;  2A8S A;  3ID9 A;  1V8Y A;  1PVF A;  1RRS A;  2B2K A;  1V8U A;  1SU2 A;  2FKB A;  5FSL A;  3X0S A;  3GZ5 A;  2YVM A;  1VCD A;  5FSK A;  4HFQ A;  3O52 A;  1MUT A;  2DSD A;  3Q1P A;  3X0Q A;  5GHP A;  3X0R A;  4J7G A;  4ICK A;  1VIU A;  1G9Q A;  3N77 A;  4J7H A;  1Q54 A;  1MR2 A;  2A8R A;  1VIQ A;  3A6U A;  3HHJ A;  3A6V A;  1PPX A;  3SMD A;  4DYW A;  3A6S A;  3Q91 A;  4N1T A;  4NFX A;  2GB5 A;  3FCM A;  2O5F A;  3I7V A;  1V8V A;  3GZ8 A;  1U20 A;  3CNG A;  3GRN A;  2O1C A;  2YYH A;  5I8U A;  3X0K A;  1NQY A;  3F6A A;  4IJX A;  5ANV A;  4N1U A;  5BS6 A;  3ZR1 A;  4C9W A;  1RRQ A;  1G0S A;  2ICJ A;  2CZR A;  2A8P A;  1R67 A;  3EEU A;  2KDV A;  3A6T A;  5IW5 A;  5ANT A;  3FJY A;  2GT4 A;  5FSN A;  3WHW A;  2R5W A;  3BAP A;  1PUN A;  3GWY A;  1JKN A;  5BON A;  4HVY A;  1V8M A;  4YPH A;  1K2E A;  3X0P A;  5DPK A;  1VRL A;  1V8N A;  3I7U A;  1V8R A;  3FFU A;  3O69 A;  2I8U A;  4JZU A;  1NFS A;  3FSP A;  4ILQ A;  3RH7 A;  5DEQ A;  4C9X A;  4S2Y A;  3SHD A;  5LPG A;  5GHO A;  4S2W A;  2Q9P A;  5CFI A;  2DUK A;  2G74 A;  3H95 A;  1RYA A;  3G0Q A;  2YVN A;  3AC9 A;  4S2V A;  5GHN A;  3COU A;  3MCF A;  3BM4 A;  5CFJ A;  2QKM B;  4K6E A;  1GA7 A;  5ANW A;  4ZG0 A;  1K26 A;  1XSA A;  3O8S A;  3EF5 A;  2VNQ A;  3MGM A;  1JRK A;  1SOI A;  1VC9 A;  5ISY A;  4KG3 A;  2A8T A;  2ICK A;  1IRY A;  2DHO A;  3R03 A;  1MP2 A;  3ACA A;  5GHJ A;  2O5W A;  2QJO A;  2PQV A;  2KDW A;  3DKU A;  2GT2 A;  1V8W A;  1QVJ A;  3EXQ A;  5FSI A;  3EES A;  3GG6 A;  3L85 A;  3Q4I A;  1KT9 A;  1OW2 A;  3X0L A;  3OGA A;  3QSJ A;  3X0J A;  4V14 A; 
#chains in the Genus database with same CATH homology
 1PPV A;  1XSC A;  2JVB A;  3O61 A;  3Q2S A;  2AZW A;  2VNP A;  4YOQ A;  3X0O A;  1VC8 A;  3X0N A;  1KTG A;  1SZ3 A;  1VHZ A;  2B06 A;  2YVP A;  1TUM A;  3I9X A;  2FVV A;  1HZT A;  1X84 A;  5DD4 A;  2FML A;  2A8Q A;  1X51 A;  1NQZ A;  2YVO A;  4JZS A;  5GHQ A;  1X83 A;  1V8S A;  1PUS A;  4NFW A;  1MK1 A;  3X0I A;  3X0M A;  1V8T A;  2CL3 A;  1XSB A;  5ANS A;  5DDG A;  3E57 A;  4KTB A;  1MQW A;  2I6K A;  3O6Z A;  2DSC A;  2PNY A;  1V8L A;  2RRK A;  3F13 A;  2DSB A;  2QJT A;  5FSO A;  3ZR0 A;  1F3Y A;  3N9U A;  3Q93 A;  5HZX A;  1VK6 A;  5ANU A;  2B0V A;  4JZT A;  2J8Q A;  1Q27 A;  3P5T A;  5FSM A;  1V8I A;  1PUQ A;  2W4E A;  2A6T A;  4KG4 A;  5GHM A;  5C7Q A;  1MQE A;  5C8L A;  3Q2T A;  3MDI A;  3FK9 A;  3KVH A;  2I8T A;  1VHG A;  4YPR A;  3DUP A;  3SON A;  3P6Y A;  1SJY A;  2G73 A;  3HYQ A;  1I9A A;  1KHZ A;  1NFZ A;  3U53 A;  5C7T A;  1HX3 A;  5IW4 A;  5GHI A;  1Q33 A;  4KYX A;  1PPW A;  3BHO A;  4MPO A;  3GZ6 A;  4S2X A;  4JZV A;  2XSQ A;  3MDG A;  3J7Y e;  2A8S A;  3ID9 A;  1V8Y A;  1PVF A;  1RRS A;  2B2K A;  1V8U A;  1SU2 A;  2FKB A;  5FSL A;  3X0S A;  3GZ5 A;  2YVM A;  1VCD A;  5FSK A;  4HFQ A;  3O52 A;  1MUT A;  2DSD A;  3Q1P A;  3X0Q A;  5GHP A;  3X0R A;  4J7G A;  4ICK A;  1VIU A;  1G9Q A;  3N77 A;  4J7H A;  1Q54 A;  1MR2 A;  2A8R A;  1VIQ A;  3A6U A;  3HHJ A;  3A6V A;  1PPX A;  3SMD A;  4DYW A;  3A6S A;  3Q91 A;  4N1T A;  4NFX A;  2GB5 A;  3FCM A;  2O5F A;  3I7V A;  1V8V A;  3GZ8 A;  1U20 A;  3CNG A;  3GRN A;  2O1C A;  2YYH A;  5I8U A;  3X0K A;  1NQY A;  3F6A A;  4IJX A;  5ANV A;  4N1U A;  5BS6 A;  3ZR1 A;  4C9W A;  1RRQ A;  1G0S A;  2ICJ A;  2CZR A;  2A8P A;  1R67 A;  3EEU A;  2KDV A;  3A6T A;  5IW5 A;  5ANT A;  3FJY A;  2GT4 A;  5FSN A;  3WHW A;  2R5W A;  3BAP A;  1PUN A;  3GWY A;  1JKN A;  5BON A;  4HVY A;  1V8M A;  4YPH A;  1K2E A;  3X0P A;  5DPK A;  1VRL A;  1V8N A;  3I7U A;  1V8R A;  3FFU A;  3O69 A;  2I8U A;  4JZU A;  1NFS A;  3FSP A;  4ILQ A;  3RH7 A;  5DEQ A;  4C9X A;  4S2Y A;  3SHD A;  5LPG A;  5GHO A;  4S2W A;  2Q9P A;  5CFI A;  2DUK A;  2G74 A;  3H95 A;  1RYA A;  3G0Q A;  2YVN A;  3AC9 A;  4S2V A;  5GHN A;  3COU A;  3MCF A;  3BM4 A;  5CFJ A;  2QKM B;  4K6E A;  1GA7 A;  5ANW A;  4ZG0 A;  1K26 A;  1XSA A;  3O8S A;  3EF5 A;  2VNQ A;  3MGM A;  1JRK A;  1SOI A;  1VC9 A;  5ISY A;  4KG3 A;  2A8T A;  2ICK A;  1IRY A;  2DHO A;  3R03 A;  1MP2 A;  3ACA A;  5GHJ A;  2O5W A;  2QJO A;  2PQV A;  2KDW A;  3DKU A;  2GT2 A;  1V8W A;  1QVJ A;  3EXQ A;  5FSI A;  3EES A;  3GG6 A;  3L85 A;  3Q4I A;  1KT9 A;  1OW2 A;  3X0L A;  3OGA A;  3QSJ A;  3X0J A;  4V14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...