3I7VA

Crystal structure of ap4a hydrolase complexed with ap4a (atp) (aq_158) from aquifex aeolicus vf5
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
134
structure length
134
Chain Sequence
MKKEFSAGGVLFKDGEVLLIKTPSNVWSFPKGNIEPGEKPEETAVREVWEETGVKGEILDYIGEIHYWYTLKGERIFKTVKYYLMKYKEGEPRPSWEVKDAKFFPIKEAKKLLKYKGDKEIFEKALKLKEKFKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords AP4A hydrolase
publication title Free and ATP-bound structures of Ap(4)A hydrolase from Aquifex aeolicus V5
pubmed doi rcsb
source organism Aquifex aeolicus vf5
total genus 33
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3i7vA01
1QVJA 4KTBA 3COUA 3R03A 5FSOA 3F6AA 1X51A 2RRKA 5GHQA 2PNYA 3MCFA 1V8NA 3N9UA 3FSPA 3F13A 4KG4A 1NFZA 2KDWA 3A6SA 1RRQA 1SU2A 4K6EA 2YVNA 3Q1PA 4YPHA 3U53A 1VHZA 3FJYA 1I9AA 1K2EA 1XSAA 2B2KA 1PUSA 3WHWA 5GHIA 5IW4A 5I8UA 1MQWA 3EXQA 5FSLA 4ZG0A 3G0QA 1RYAA 5BS6A 2I8TA 2XSQA 5C8LA 1IRYA 3N77A 3X0PA 1PUNA 1VIQA 3X0IA 2A6TA 4ILQA 1MP2A 2YYHA 4YPRA 1GA7A 1KTGA 1V8SA 1KT9A 1K26A 3MDGA 1V8LA 5ANUA 1MR2A 1NFSA 4JZTA 2YVPA 1V8IA 1V8TA 1MK1A 1XSBA 3GZ5A 3L85A 3O61A 2FVVA 1G9QA 4ICKA 4NFWA 3DKUA 3RH7A 1SJYA 4KYXA 5C7TA 3Q93A 3P6YA 1PPVA 1PUQA 1SOIA 5DEQA 2AZWA 2I8UA 1Q33A 3BHOA 1VCDA 3EF5A 3ID9A 3O69A 5CFJA 2O5FA 3FK9A 5FSIA 5GHNA 5LPGA 3HHJA 1NQZA 2QJOA 4JZSA 1TUMA 3DUPA 3X0NA 1HZTA 3AC9A 5ANWA 5ANVA 5ISYA 3GZ6A 3QSJA 5DPKA 3J7Ye 5DDGA 4S2VA 3I7UA 2DHOA 3GZ8A 3I7VA 2KDVA 4HFQA 1JRKA 3X0QA 2YVOA 3EESA 5GHJA 4S2YA 4V14A 2GT2A 3FFUA 3Q4IA 2YVMA 2O1CA 2R5WA 2I6KA 5FSNA 2B0VA 3X0KA 2A8SA 1OW2A 4N1UA 2VNPA 3SHDA 3Q2TA 4IJXA 4JZUA 3ZR1A 4HVYA 3I9XA 1V8UA 3MGMA 2Q9PA 1VRLA 2G73A 1F3YA 4KG3A 3A6UA 5CFIA 2A8QA 3Q91A 2GT4A 2DSBA 2J8QA 2PQVA 1SZ3A 4S2WA 3X0MA 4JZVA 3KVHA 5IW5A 5DD4A 5GHOA 3MDIA 1V8YA 2FKBA 1PPWA 3CNGA 3GWYA 5BONA 4C9XA 3O8SA 5C7QA 4N1TA 5GHMA 3X0OA 3A6VA 1VIUA 3ACAA 1MUTA 2O5WA 5ANTA 5HZXA 1V8MA 3X0SA 1VC9A 2A8PA 1NQYA 4DYWA 1V8VA 2DSCA 3SONA 2A8RA 1U20A 1R67A 1X83A 3ZR0A 1V8RA 3GRNA 4YOQA 1HX3A 3OGAA 3X0JA 4MPOA 1VHGA 2DSDA 1Q54A 3E57A 5GHPA 2G74A 3O52A 3SMDA 3X0RA 3EEUA 1G0SA 2DUKA 2VNQA 4S2XA 3X0LA 1VC8A 1X84A 1RRSA 1VK6A 3GG6A 3P5TA 5FSKA 3O6ZA 2A8TA 2QJTA 5FSMA 3BM4A 2QKMB 2CL3A 1KHZA 2GB5A 3BAPA 5ANSA 2FMLA 1PPXA 2ICJA 1JKNA 2W4EA 3Q2SA 3FCMA 2ICKA 1MQEA 2JVBA 3H95A 1Q27A 4NFXA 4C9WA 1PVFA 1V8WA 2B06A 3HYQA 3A6TA 1XSCA
chains in the Genus database with same CATH superfamily
1QVJA 4KTBA 3COUA 3R03A 4J7GA 5FSOA 3F6AA 1X51A 2RRKA 5GHQA 2PNYA 3MCFA 1V8NA 3N9UA 3FSPA 3F13A 4KG4A 1NFZA 2KDWA 3A6SA 1RRQA 1SU2A 4K6EA 2YVNA 3Q1PA 4YPHA 3U53A 1VHZA 3FJYA 1I9AA 1K2EA 1XSAA 2B2KA 1PUSA 3WHWA 5GHIA 5IW4A 5I8UA 1MQWA 3EXQA 5FSLA 4ZG0A 3G0QA 1RYAA 5BS6A 2I8TA 2XSQA 5C8LA 1IRYA 3N77A 3X0PA 1PUNA 1VIQA 3X0IA 2A6TA 4ILQA 1MP2A 2YYHA 4YPRA 1GA7A 1KTGA 1V8SA 1KT9A 1K26A 3MDGA 1V8LA 5ANUA 1MR2A 1NFSA 4JZTA 2YVPA 1V8IA 1V8TA 1MK1A 1XSBA 3GZ5A 3L85A 3O61A 2FVVA 1G9QA 4ICKA 4NFWA 3DKUA 3RH7A 1SJYA 4KYXA 5C7TA 3Q93A 3P6YA 1PPVA 1PUQA 1SOIA 5DEQA 2AZWA 2I8UA 1Q33A 3BHOA 1VCDA 3EF5A 3ID9A 3O69A 5CFJA 2O5FA 3FK9A 5FSIA 5GHNA 5LPGA 3HHJA 1NQZA 2QJOA 4JZSA 1TUMA 3DUPA 3X0NA 1HZTA 3AC9A 5ANWA 5ANVA 5ISYA 3GZ6A 3QSJA 5DPKA 3J7Ye 5DDGA 4S2VA 3I7UA 2DHOA 3GZ8A 3I7VA 2KDVA 4HFQA 1JRKA 3X0QA 2YVOA 3EESA 5GHJA 4S2YA 4V14A 2GT2A 3FFUA 3Q4IA 2YVMA 2O1CA 2R5WA 2I6KA 5FSNA 2B0VA 3X0KA 2A8SA 1OW2A 4N1UA 2VNPA 3SHDA 3Q2TA 4IJXA 4JZUA 3ZR1A 4HVYA 3I9XA 1V8UA 3MGMA 2Q9PA 1VRLA 2G73A 1F3YA 4KG3A 3A6UA 5CFIA 2A8QA 3Q91A 2GT4A 2DSBA 2J8QA 2PQVA 1SZ3A 4S2WA 3X0MA 4JZVA 3KVHA 5IW5A 5DD4A 5GHOA 3MDIA 1V8YA 2FKBA 4J7HA 1PPWA 3CNGA 3GWYA 5BONA 4C9XA 3O8SA 5C7QA 4N1TA 5GHMA 3X0OA 3A6VA 2CZRA 1VIUA 3ACAA 1MUTA 2O5WA 5ANTA 5HZXA 1V8MA 3X0SA 1VC9A 2A8PA 1NQYA 4DYWA 1V8VA 2DSCA 3SONA 2A8RA 1U20A 1R67A 1X83A 3ZR0A 1V8RA 3GRNA 4YOQA 1HX3A 3OGAA 3X0JA 4MPOA 1VHGA 2DSDA 1Q54A 3E57A 5GHPA 2G74A 3O52A 3SMDA 3X0RA 3EEUA 1G0SA 2DUKA 2VNQA 4S2XA 3X0LA 1VC8A 1X84A 1RRSA 1VK6A 3GG6A 3P5TA 5FSKA 3O6ZA 2A8TA 2QJTA 5FSMA 3BM4A 2QKMB 2CL3A 1KHZA 2GB5A 3BAPA 5ANSA 2FMLA 1PPXA 2ICJA 1JKNA 2W4EA 3Q2SA 3FCMA 2ICKA 1MQEA 2JVBA 3H95A 1Q27A 4NFXA 4C9WA 1PVFA 1V8WA 2B06A 3HYQA 3A6TA 1XSCA
chains in the Genus database with same CATH topology
1QVJA 4KTBA 3COUA 3R03A 4J7GA 5FSOA 3F6AA 1X51A 2RRKA 5GHQA 2PNYA 3MCFA 1V8NA 3N9UA 3FSPA 3F13A 4KG4A 1NFZA 2KDWA 3A6SA 1RRQA 1SU2A 4K6EA 2YVNA 3Q1PA 4YPHA 3U53A 1VHZA 3FJYA 1I9AA 1K2EA 1XSAA 2B2KA 1PUSA 3WHWA 5GHIA 5IW4A 5I8UA 1MQWA 3EXQA 5FSLA 4ZG0A 3G0QA 1RYAA 5BS6A 2I8TA 2XSQA 5C8LA 1IRYA 3N77A 3X0PA 1PUNA 1VIQA 3X0IA 2A6TA 4ILQA 1MP2A 2YYHA 4YPRA 1GA7A 1KTGA 1V8SA 1KT9A 1K26A 3MDGA 1V8LA 5ANUA 1MR2A 1NFSA 4JZTA 2YVPA 1V8IA 1V8TA 1MK1A 1XSBA 3GZ5A 3L85A 3O61A 2FVVA 1G9QA 4ICKA 4NFWA 3DKUA 3RH7A 1SJYA 4KYXA 5C7TA 3Q93A 3P6YA 1PPVA 1PUQA 1SOIA 5DEQA 2AZWA 2I8UA 1Q33A 3BHOA 1VCDA 3EF5A 3ID9A 3O69A 5CFJA 2O5FA 3FK9A 5FSIA 5GHNA 5LPGA 3HHJA 1NQZA 2QJOA 4JZSA 1TUMA 3DUPA 3X0NA 1HZTA 3AC9A 5ANWA 5ANVA 5ISYA 3GZ6A 3QSJA 5DPKA 3J7Ye 5DDGA 4S2VA 3I7UA 2DHOA 3GZ8A 3I7VA 2KDVA 4HFQA 1JRKA 3X0QA 2YVOA 3EESA 5GHJA 4S2YA 4V14A 2GT2A 3FFUA 3Q4IA 2YVMA 2O1CA 2R5WA 2I6KA 5FSNA 2B0VA 3X0KA 2A8SA 1OW2A 4N1UA 2VNPA 3SHDA 3Q2TA 4IJXA 4JZUA 3ZR1A 4HVYA 3I9XA 1V8UA 3MGMA 2Q9PA 1VRLA 2G73A 1F3YA 4KG3A 3A6UA 5CFIA 2A8QA 3Q91A 2GT4A 2DSBA 2J8QA 2PQVA 1SZ3A 4S2WA 3X0MA 4JZVA 3KVHA 5IW5A 5DD4A 5GHOA 3MDIA 1V8YA 2FKBA 4J7HA 1PPWA 3CNGA 3GWYA 5BONA 4C9XA 3O8SA 5C7QA 4N1TA 5GHMA 3X0OA 3A6VA 2CZRA 1VIUA 3ACAA 1MUTA 2O5WA 5ANTA 5HZXA 1V8MA 3X0SA 1VC9A 2A8PA 1NQYA 4DYWA 1V8VA 2DSCA 3SONA 2A8RA 1U20A 1R67A 1X83A 3ZR0A 1V8RA 3GRNA 4YOQA 1HX3A 3OGAA 3X0JA 4MPOA 1VHGA 2DSDA 1Q54A 3E57A 5GHPA 2G74A 3O52A 3SMDA 3X0RA 3EEUA 1G0SA 2DUKA 2VNQA 4S2XA 3X0LA 1VC8A 1X84A 1RRSA 1VK6A 3GG6A 3P5TA 5FSKA 3O6ZA 2A8TA 2QJTA 5FSMA 3BM4A 2QKMB 2CL3A 1KHZA 2GB5A 3BAPA 5ANSA 2FMLA 1PPXA 2ICJA 1JKNA 2W4EA 3Q2SA 3FCMA 2ICKA 1MQEA 2JVBA 3H95A 1Q27A 4NFXA 4C9WA 1PVFA 1V8WA 2B06A 3HYQA 3A6TA 1XSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVJ A;  4KTB A;  3COU A;  3R03 A;  5FSO A;  3F6A A;  1X51 A;  2RRK A;  5GHQ A;  2PNY A;  3MCF A;  1V8N A;  3N9U A;  3FSP A;  3F13 A;  4KG4 A;  1NFZ A;  2KDW A;  3A6S A;  1RRQ A;  1SU2 A;  4K6E A;  2YVN A;  3Q1P A;  4YPH A;  3U53 A;  1VHZ A;  3FJY A;  1I9A A;  1K2E A;  1XSA A;  2B2K A;  1PUS A;  3WHW A;  5GHI A;  5IW4 A;  5I8U A;  1MQW A;  3EXQ A;  5FSL A;  4ZG0 A;  3G0Q A;  1RYA A;  5BS6 A;  2I8T A;  2XSQ A;  5C8L A;  1IRY A;  3N77 A;  3X0P A;  1PUN A;  1VIQ A;  3X0I A;  2A6T A;  4ILQ A;  1MP2 A;  2YYH A;  4YPR A;  1GA7 A;  1KTG A;  1V8S A;  1KT9 A;  1K26 A;  3MDG A;  1V8L A;  5ANU A;  1MR2 A;  1NFS A;  4JZT A;  2YVP A;  1V8I A;  1V8T A;  1MK1 A;  1XSB A;  3GZ5 A;  3L85 A;  3O61 A;  2FVV A;  1G9Q A;  4ICK A;  4NFW A;  3DKU A;  3RH7 A;  1SJY A;  4KYX A;  5C7T A;  3Q93 A;  3P6Y A;  1PPV A;  1PUQ A;  1SOI A;  5DEQ A;  2AZW A;  2I8U A;  1Q33 A;  3BHO A;  1VCD A;  3EF5 A;  3ID9 A;  3O69 A;  5CFJ A;  2O5F A;  3FK9 A;  5FSI A;  5GHN A;  5LPG A;  3HHJ A;  1NQZ A;  2QJO A;  4JZS A;  1TUM A;  3DUP A;  3X0N A;  1HZT A;  3AC9 A;  5ANW A;  5ANV A;  5ISY A;  3GZ6 A;  3QSJ A;  5DPK A;  3J7Y e;  5DDG A;  4S2V A;  3I7U A;  2DHO A;  3GZ8 A;  3I7V A;  2KDV A;  4HFQ A;  1JRK A;  3X0Q A;  2YVO A;  3EES A;  5GHJ A;  4S2Y A;  4V14 A;  2GT2 A;  3FFU A;  3Q4I A;  2YVM A;  2O1C A;  2R5W A;  2I6K A;  5FSN A;  2B0V A;  3X0K A;  2A8S A;  1OW2 A;  4N1U A;  2VNP A;  3SHD A;  3Q2T A;  4IJX A;  4JZU A;  3ZR1 A;  4HVY A;  3I9X A;  1V8U A;  3MGM A;  2Q9P A;  1VRL A;  2G73 A;  1F3Y A;  4KG3 A;  3A6U A;  5CFI A;  2A8Q A;  3Q91 A;  2GT4 A;  2DSB A;  2J8Q A;  2PQV A;  1SZ3 A;  4S2W A;  3X0M A;  4JZV A;  3KVH A;  5IW5 A;  5DD4 A;  5GHO A;  3MDI A;  1V8Y A;  2FKB A;  1PPW A;  3CNG A;  3GWY A;  5BON A;  4C9X A;  3O8S A;  5C7Q A;  4N1T A;  5GHM A;  3X0O A;  3A6V A;  1VIU A;  3ACA A;  1MUT A;  2O5W A;  5ANT A;  5HZX A;  1V8M A;  3X0S A;  1VC9 A;  2A8P A;  1NQY A;  4DYW A;  1V8V A;  2DSC A;  3SON A;  2A8R A;  1U20 A;  1R67 A;  1X83 A;  3ZR0 A;  1V8R A;  3GRN A;  4YOQ A;  1HX3 A;  3OGA A;  3X0J A;  4MPO A;  1VHG A;  2DSD A;  1Q54 A;  3E57 A;  5GHP A;  2G74 A;  3O52 A;  3SMD A;  3X0R A;  3EEU A;  1G0S A;  2DUK A;  2VNQ A;  4S2X A;  3X0L A;  1VC8 A;  1X84 A;  1RRS A;  1VK6 A;  3GG6 A;  3P5T A;  5FSK A;  3O6Z A;  2A8T A;  2QJT A;  5FSM A;  3BM4 A;  2QKM B;  2CL3 A;  1KHZ A;  2GB5 A;  3BAP A;  5ANS A;  2FML A;  1PPX A;  2ICJ A;  1JKN A;  2W4E A;  3Q2S A;  3FCM A;  2ICK A;  1MQE A;  2JVB A;  3H95 A;  1Q27 A;  4NFX A;  4C9W A;  1PVF A;  1V8W A;  2B06 A;  3HYQ A;  3A6T A;  1XSC A; 
#chains in the Genus database with same CATH topology
 1QVJ A;  4KTB A;  3COU A;  3R03 A;  4J7G A;  5FSO A;  3F6A A;  1X51 A;  2RRK A;  5GHQ A;  2PNY A;  3MCF A;  1V8N A;  3N9U A;  3FSP A;  3F13 A;  4KG4 A;  1NFZ A;  2KDW A;  3A6S A;  1RRQ A;  1SU2 A;  4K6E A;  2YVN A;  3Q1P A;  4YPH A;  3U53 A;  1VHZ A;  3FJY A;  1I9A A;  1K2E A;  1XSA A;  2B2K A;  1PUS A;  3WHW A;  5GHI A;  5IW4 A;  5I8U A;  1MQW A;  3EXQ A;  5FSL A;  4ZG0 A;  3G0Q A;  1RYA A;  5BS6 A;  2I8T A;  2XSQ A;  5C8L A;  1IRY A;  3N77 A;  3X0P A;  1PUN A;  1VIQ A;  3X0I A;  2A6T A;  4ILQ A;  1MP2 A;  2YYH A;  4YPR A;  1GA7 A;  1KTG A;  1V8S A;  1KT9 A;  1K26 A;  3MDG A;  1V8L A;  5ANU A;  1MR2 A;  1NFS A;  4JZT A;  2YVP A;  1V8I A;  1V8T A;  1MK1 A;  1XSB A;  3GZ5 A;  3L85 A;  3O61 A;  2FVV A;  1G9Q A;  4ICK A;  4NFW A;  3DKU A;  3RH7 A;  1SJY A;  4KYX A;  5C7T A;  3Q93 A;  3P6Y A;  1PPV A;  1PUQ A;  1SOI A;  5DEQ A;  2AZW A;  2I8U A;  1Q33 A;  3BHO A;  1VCD A;  3EF5 A;  3ID9 A;  3O69 A;  5CFJ A;  2O5F A;  3FK9 A;  5FSI A;  5GHN A;  5LPG A;  3HHJ A;  1NQZ A;  2QJO A;  4JZS A;  1TUM A;  3DUP A;  3X0N A;  1HZT A;  3AC9 A;  5ANW A;  5ANV A;  5ISY A;  3GZ6 A;  3QSJ A;  5DPK A;  3J7Y e;  5DDG A;  4S2V A;  3I7U A;  2DHO A;  3GZ8 A;  3I7V A;  2KDV A;  4HFQ A;  1JRK A;  3X0Q A;  2YVO A;  3EES A;  5GHJ A;  4S2Y A;  4V14 A;  2GT2 A;  3FFU A;  3Q4I A;  2YVM A;  2O1C A;  2R5W A;  2I6K A;  5FSN A;  2B0V A;  3X0K A;  2A8S A;  1OW2 A;  4N1U A;  2VNP A;  3SHD A;  3Q2T A;  4IJX A;  4JZU A;  3ZR1 A;  4HVY A;  3I9X A;  1V8U A;  3MGM A;  2Q9P A;  1VRL A;  2G73 A;  1F3Y A;  4KG3 A;  3A6U A;  5CFI A;  2A8Q A;  3Q91 A;  2GT4 A;  2DSB A;  2J8Q A;  2PQV A;  1SZ3 A;  4S2W A;  3X0M A;  4JZV A;  3KVH A;  5IW5 A;  5DD4 A;  5GHO A;  3MDI A;  1V8Y A;  2FKB A;  4J7H A;  1PPW A;  3CNG A;  3GWY A;  5BON A;  4C9X A;  3O8S A;  5C7Q A;  4N1T A;  5GHM A;  3X0O A;  3A6V A;  2CZR A;  1VIU A;  3ACA A;  1MUT A;  2O5W A;  5ANT A;  5HZX A;  1V8M A;  3X0S A;  1VC9 A;  2A8P A;  1NQY A;  4DYW A;  1V8V A;  2DSC A;  3SON A;  2A8R A;  1U20 A;  1R67 A;  1X83 A;  3ZR0 A;  1V8R A;  3GRN A;  4YOQ A;  1HX3 A;  3OGA A;  3X0J A;  4MPO A;  1VHG A;  2DSD A;  1Q54 A;  3E57 A;  5GHP A;  2G74 A;  3O52 A;  3SMD A;  3X0R A;  3EEU A;  1G0S A;  2DUK A;  2VNQ A;  4S2X A;  3X0L A;  1VC8 A;  1X84 A;  1RRS A;  1VK6 A;  3GG6 A;  3P5T A;  5FSK A;  3O6Z A;  2A8T A;  2QJT A;  5FSM A;  3BM4 A;  2QKM B;  2CL3 A;  1KHZ A;  2GB5 A;  3BAP A;  5ANS A;  2FML A;  1PPX A;  2ICJ A;  1JKN A;  2W4E A;  3Q2S A;  3FCM A;  2ICK A;  1MQE A;  2JVB A;  3H95 A;  1Q27 A;  4NFX A;  4C9W A;  1PVF A;  1V8W A;  2B06 A;  3HYQ A;  3A6T A;  1XSC A; 
#chains in the Genus database with same CATH homology
 1QVJ A;  4KTB A;  3COU A;  3R03 A;  4J7G A;  5FSO A;  3F6A A;  1X51 A;  2RRK A;  5GHQ A;  2PNY A;  3MCF A;  1V8N A;  3N9U A;  3FSP A;  3F13 A;  4KG4 A;  1NFZ A;  2KDW A;  3A6S A;  1RRQ A;  1SU2 A;  4K6E A;  2YVN A;  3Q1P A;  4YPH A;  3U53 A;  1VHZ A;  3FJY A;  1I9A A;  1K2E A;  1XSA A;  2B2K A;  1PUS A;  3WHW A;  5GHI A;  5IW4 A;  5I8U A;  1MQW A;  3EXQ A;  5FSL A;  4ZG0 A;  3G0Q A;  1RYA A;  5BS6 A;  2I8T A;  2XSQ A;  5C8L A;  1IRY A;  3N77 A;  3X0P A;  1PUN A;  1VIQ A;  3X0I A;  2A6T A;  4ILQ A;  1MP2 A;  2YYH A;  4YPR A;  1GA7 A;  1KTG A;  1V8S A;  1KT9 A;  1K26 A;  3MDG A;  1V8L A;  5ANU A;  1MR2 A;  1NFS A;  4JZT A;  2YVP A;  1V8I A;  1V8T A;  1MK1 A;  1XSB A;  3GZ5 A;  3L85 A;  3O61 A;  2FVV A;  1G9Q A;  4ICK A;  4NFW A;  3DKU A;  3RH7 A;  1SJY A;  4KYX A;  5C7T A;  3Q93 A;  3P6Y A;  1PPV A;  1PUQ A;  1SOI A;  5DEQ A;  2AZW A;  2I8U A;  1Q33 A;  3BHO A;  1VCD A;  3EF5 A;  3ID9 A;  3O69 A;  5CFJ A;  2O5F A;  3FK9 A;  5FSI A;  5GHN A;  5LPG A;  3HHJ A;  1NQZ A;  2QJO A;  4JZS A;  1TUM A;  3DUP A;  3X0N A;  1HZT A;  3AC9 A;  5ANW A;  5ANV A;  5ISY A;  3GZ6 A;  3QSJ A;  5DPK A;  3J7Y e;  5DDG A;  4S2V A;  3I7U A;  2DHO A;  3GZ8 A;  3I7V A;  2KDV A;  4HFQ A;  1JRK A;  3X0Q A;  2YVO A;  3EES A;  5GHJ A;  4S2Y A;  4V14 A;  2GT2 A;  3FFU A;  3Q4I A;  2YVM A;  2O1C A;  2R5W A;  2I6K A;  5FSN A;  2B0V A;  3X0K A;  2A8S A;  1OW2 A;  4N1U A;  2VNP A;  3SHD A;  3Q2T A;  4IJX A;  4JZU A;  3ZR1 A;  4HVY A;  3I9X A;  1V8U A;  3MGM A;  2Q9P A;  1VRL A;  2G73 A;  1F3Y A;  4KG3 A;  3A6U A;  5CFI A;  2A8Q A;  3Q91 A;  2GT4 A;  2DSB A;  2J8Q A;  2PQV A;  1SZ3 A;  4S2W A;  3X0M A;  4JZV A;  3KVH A;  5IW5 A;  5DD4 A;  5GHO A;  3MDI A;  1V8Y A;  2FKB A;  4J7H A;  1PPW A;  3CNG A;  3GWY A;  5BON A;  4C9X A;  3O8S A;  5C7Q A;  4N1T A;  5GHM A;  3X0O A;  3A6V A;  2CZR A;  1VIU A;  3ACA A;  1MUT A;  2O5W A;  5ANT A;  5HZX A;  1V8M A;  3X0S A;  1VC9 A;  2A8P A;  1NQY A;  4DYW A;  1V8V A;  2DSC A;  3SON A;  2A8R A;  1U20 A;  1R67 A;  1X83 A;  3ZR0 A;  1V8R A;  3GRN A;  4YOQ A;  1HX3 A;  3OGA A;  3X0J A;  4MPO A;  1VHG A;  2DSD A;  1Q54 A;  3E57 A;  5GHP A;  2G74 A;  3O52 A;  3SMD A;  3X0R A;  3EEU A;  1G0S A;  2DUK A;  2VNQ A;  4S2X A;  3X0L A;  1VC8 A;  1X84 A;  1RRS A;  1VK6 A;  3GG6 A;  3P5T A;  5FSK A;  3O6Z A;  2A8T A;  2QJT A;  5FSM A;  3BM4 A;  2QKM B;  2CL3 A;  1KHZ A;  2GB5 A;  3BAP A;  5ANS A;  2FML A;  1PPX A;  2ICJ A;  1JKN A;  2W4E A;  3Q2S A;  3FCM A;  2ICK A;  1MQE A;  2JVB A;  3H95 A;  1Q27 A;  4NFX A;  4C9W A;  1PVF A;  1V8W A;  2B06 A;  3HYQ A;  3A6T A;  1XSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...