1V8UA

Crystal structure analysis of the adp-ribose pyrophosphatase of e82q mutant with so4 and mg
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
159
structure length
154
Chain Sequence
RTYLYRGRILNLALEGRYEIVEHKPAVAVIALREGRMLFVRQMRPAVGLAPLEIPAGLIEPGEDPLEAARRQLAEETGLSGDLTYLFSYFVSPGFTDEKTHVFLAENLKEVEAEAIEVVWMRPEEALERHQRGEVEFSATGLVGVLYYHAFLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ADP-ribose pyrophosphatase
publication title Structural insights into the Thermus thermophilus ADP-ribose pyrophosphatase mechanism via crystal structures with the bound substrate and metal
pubmed doi rcsb
source organism Thermus thermophilus
total genus 37
structure length 154
sequence length 159
ec nomenclature ec 3.6.1.13: ADP-ribose diphosphatase.
pdb deposition date 2004-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1v8uA00
4JZVA 2DSCA 1KHZA 3X0IA 3EESA 4HVYA 4ZG0A 3COUA 1V8IA 2GT4A 1MUTA 1V8RA 1NQYA 3X0QA 1G9QA 4S2YA 1JKNA 4DYWA 2PNYA 2QKMB 1PPWA 1VC8A 5GHPA 5BONA 5DPKA 1QVJA 3X0LA 3X0PA 5GHJA 2A8SA 1VC9A 1SOIA 3O52A 1PUSA 3BHOA 5BS6A 2PQVA 3F13A 5GHNA 3HYQA 2DSBA 3BAPA 5FSIA 3SONA 3ID9A 3I7VA 3EXQA 3Q93A 5ANTA 5FSLA 3G0QA 2ICKA 2G74A 1X84A 2QJOA 3Q2SA 1VHZA 2B2KA 3EEUA 5GHOA 2G73A 2I6KA 5GHIA 1G0SA 1XSCA 3I7UA 2CL3A 3P5TA 5FSOA 1V8TA 5I8UA 3X0SA 1JRKA 1F3YA 1MR2A 4YOQA 1R67A 4IJXA 5ANUA 3J7Ye 1V8SA 3GRNA 2A8QA 3P6YA 3MGMA 1PUNA 1MQWA 3GG6A 4KG4A 4K6EA 4S2VA 3BM4A 3O6ZA 1KTGA 2GT2A 2O5WA 3Q4IA 3MDGA 1IRYA 4KTBA 2W4EA 4V14A 5FSNA 5C7TA 5ANWA 3GZ6A 5DD4A 2FVVA 3CNGA 1VK6A 5DEQA 1SU2A 3GZ8A 2A8TA 2J8QA 1VIUA 1PPVA 3FCMA 5ISYA 1XSAA 1HZTA 2GB5A 1VRLA 2QJTA 2R5WA 2A6TA 2FKBA 3A6SA 1Q33A 1KT9A 5HZXA 1K26A 3FK9A 1V8VA 3GZ5A 4HFQA 5C8LA 2DUKA 1SZ3A 2DHOA 1SJYA 5ANSA 3KVHA 3DKUA 4YPRA 1V8LA 2RRKA 4S2XA 2DSDA 3N77A 5ANVA 4JZUA 5IW5A 5IW4A 3X0OA 1X83A 3X0NA 2XSQA 3Q91A 1U20A 1Q27A 3O69A 2A8RA 4NFWA 3FJYA 3X0KA 4JZTA 2YVPA 3FSPA 1VCDA 4JZSA 1V8YA 1NQZA 1V8NA 4MPOA 2O5FA 4S2WA 2ICJA 1RYAA 1XSBA 5FSMA 5DDGA 2KDVA 3H95A 1RRSA 3A6TA 3GWYA 2B06A 3X0JA 3O8SA 3O61A 1V8MA 1K2EA 4ILQA 3WHWA 1NFZA 2VNQA 1PVFA 3A6UA 1Q54A 5GHQA 3AC9A 1MP2A 1RRQA 2YVNA 3HHJA 3OGAA 1V8UA 4C9WA 4YPHA 5LPGA 1MQEA 5FSKA 3MDIA 3X0RA 1HX3A 2YVOA 2KDWA 2A8PA 2VNPA 3MCFA 5CFIA 2I8TA 2AZWA 3F6AA 3DUPA 4N1TA 1I9AA 3U53A 2FMLA 3SHDA 5C7QA 1MK1A 2YVMA 1PPXA 2O1CA 3SMDA 3ZR1A 5GHMA 3X0MA 4KG3A 1OW2A 1V8WA 3L85A 1VHGA 2YYHA 3QSJA 4C9XA 5CFJA 2Q9PA 3Q2TA 2JVBA 3EF5A 3R03A 3RH7A 1GA7A 1X51A 3ZR0A 4KYXA 1TUMA 3FFUA 3Q1PA 4N1UA 3N9UA 3A6VA 3E57A 3ACAA 1NFSA 4ICKA 3I9XA 2I8UA 4NFXA 1PUQA 1VIQA 2B0VA
chains in the Genus database with same CATH superfamily
4JZVA 2DSCA 1KHZA 3X0IA 3EESA 4HVYA 4ZG0A 3COUA 1V8IA 2GT4A 1MUTA 1V8RA 1NQYA 3X0QA 1G9QA 4S2YA 1JKNA 4DYWA 2PNYA 2QKMB 1PPWA 1VC8A 5GHPA 5BONA 5DPKA 1QVJA 3X0LA 3X0PA 5GHJA 2A8SA 1VC9A 1SOIA 3O52A 1PUSA 3BHOA 5BS6A 2PQVA 3F13A 4J7GA 5GHNA 3HYQA 2DSBA 3BAPA 5FSIA 3SONA 3ID9A 3I7VA 3EXQA 3Q93A 5ANTA 5FSLA 3G0QA 2ICKA 2G74A 1X84A 2QJOA 3Q2SA 1VHZA 2B2KA 3EEUA 4J7HA 2G73A 2I6KA 5GHOA 5GHIA 1G0SA 1XSCA 3I7UA 2CL3A 3P5TA 5FSOA 1V8TA 5I8UA 3X0SA 1JRKA 1F3YA 1MR2A 4YOQA 1R67A 4IJXA 5ANUA 3J7Ye 1V8SA 3GRNA 2A8QA 3P6YA 3MGMA 1PUNA 1MQWA 3GG6A 4KG4A 4K6EA 4S2VA 3BM4A 3O6ZA 1KTGA 2GT2A 2O5WA 3Q4IA 3MDGA 1IRYA 4KTBA 2W4EA 4V14A 5FSNA 5C7TA 5ANWA 3GZ6A 5DD4A 2FVVA 3CNGA 1VK6A 5DEQA 1SU2A 3GZ8A 2A8TA 2J8QA 1VIUA 1PPVA 3FCMA 5ISYA 1XSAA 1HZTA 2GB5A 1VRLA 2QJTA 2R5WA 2A6TA 2FKBA 3A6SA 1Q33A 1KT9A 5HZXA 1K26A 3FK9A 1V8VA 3GZ5A 4HFQA 5C8LA 2DUKA 1SZ3A 2DHOA 1SJYA 5ANSA 3KVHA 3DKUA 4YPRA 1V8LA 2RRKA 4S2XA 2DSDA 3N77A 5ANVA 4JZUA 5IW5A 5IW4A 3X0OA 1X83A 3X0NA 2XSQA 3Q91A 2CZRA 1U20A 1Q27A 3O69A 2A8RA 4NFWA 3FJYA 3X0KA 4JZTA 2YVPA 3FSPA 1VCDA 4JZSA 1V8YA 1NQZA 1V8NA 4MPOA 2O5FA 4S2WA 2ICJA 1RYAA 1XSBA 5FSMA 5DDGA 2KDVA 3H95A 1RRSA 3A6TA 3GWYA 2B06A 3X0JA 3O8SA 3O61A 1V8MA 1K2EA 4ILQA 3WHWA 1NFZA 2VNQA 1PVFA 3A6UA 1Q54A 5GHQA 3AC9A 1MP2A 1RRQA 2YVNA 3HHJA 3OGAA 1V8UA 4C9WA 4YPHA 5LPGA 1MQEA 5FSKA 3MDIA 3X0RA 1HX3A 2YVOA 2KDWA 2A8PA 2VNPA 3MCFA 5CFIA 2I8TA 2AZWA 3F6AA 3DUPA 4N1TA 1I9AA 3U53A 2FMLA 3SHDA 5C7QA 1MK1A 2YVMA 1PPXA 2O1CA 3SMDA 3ZR1A 5GHMA 3X0MA 4KG3A 1OW2A 1V8WA 3L85A 1VHGA 2YYHA 3QSJA 4C9XA 5CFJA 2Q9PA 3Q2TA 2JVBA 3EF5A 3R03A 3RH7A 1GA7A 1X51A 3ZR0A 4KYXA 1TUMA 3FFUA 3Q1PA 4N1UA 3N9UA 3A6VA 3E57A 3ACAA 1NFSA 4ICKA 3I9XA 2I8UA 4NFXA 1PUQA 1VIQA 2B0VA
chains in the Genus database with same CATH topology
4JZVA 2DSCA 1KHZA 3X0IA 3EESA 4HVYA 4ZG0A 3COUA 1V8IA 2GT4A 1MUTA 1V8RA 1NQYA 3X0QA 1G9QA 4S2YA 1JKNA 4DYWA 2PNYA 2QKMB 1PPWA 1VC8A 5GHPA 5BONA 5DPKA 1QVJA 3X0LA 3X0PA 5GHJA 2A8SA 1VC9A 1SOIA 3O52A 1PUSA 3BHOA 5BS6A 2PQVA 3F13A 4J7GA 5GHNA 3HYQA 2DSBA 3BAPA 5FSIA 3SONA 3ID9A 3I7VA 3EXQA 3Q93A 5ANTA 5FSLA 3G0QA 2ICKA 2G74A 1X84A 2QJOA 3Q2SA 1VHZA 2B2KA 3EEUA 4J7HA 2G73A 2I6KA 5GHOA 5GHIA 1G0SA 1XSCA 3I7UA 2CL3A 3P5TA 5FSOA 1V8TA 5I8UA 3X0SA 1JRKA 1F3YA 1MR2A 4YOQA 1R67A 4IJXA 5ANUA 3J7Ye 1V8SA 3GRNA 2A8QA 3P6YA 3MGMA 1PUNA 1MQWA 3GG6A 4KG4A 4K6EA 4S2VA 3BM4A 3O6ZA 1KTGA 2GT2A 2O5WA 3Q4IA 3MDGA 1IRYA 4KTBA 2W4EA 4V14A 5FSNA 5C7TA 5ANWA 3GZ6A 5DD4A 2FVVA 3CNGA 1VK6A 5DEQA 1SU2A 3GZ8A 2A8TA 2J8QA 1VIUA 1PPVA 3FCMA 5ISYA 1XSAA 1HZTA 2GB5A 1VRLA 2QJTA 2R5WA 2A6TA 2FKBA 3A6SA 1Q33A 1KT9A 5HZXA 1K26A 3FK9A 1V8VA 3GZ5A 4HFQA 5C8LA 2DUKA 1SZ3A 2DHOA 1SJYA 5ANSA 3KVHA 3DKUA 4YPRA 1V8LA 2RRKA 4S2XA 2DSDA 3N77A 5ANVA 4JZUA 5IW5A 5IW4A 3X0OA 1X83A 3X0NA 2XSQA 3Q91A 2CZRA 1U20A 1Q27A 3O69A 2A8RA 4NFWA 3FJYA 3X0KA 4JZTA 2YVPA 3FSPA 1VCDA 4JZSA 1V8YA 1NQZA 1V8NA 4MPOA 2O5FA 4S2WA 2ICJA 1RYAA 1XSBA 5FSMA 5DDGA 2KDVA 3H95A 1RRSA 3A6TA 3GWYA 2B06A 3X0JA 3O8SA 3O61A 1V8MA 1K2EA 4ILQA 3WHWA 1NFZA 2VNQA 1PVFA 3A6UA 1Q54A 5GHQA 3AC9A 1MP2A 1RRQA 2YVNA 3HHJA 3OGAA 1V8UA 4C9WA 4YPHA 5LPGA 1MQEA 5FSKA 3MDIA 3X0RA 1HX3A 2YVOA 2KDWA 2A8PA 2VNPA 3MCFA 5CFIA 2I8TA 2AZWA 3F6AA 3DUPA 4N1TA 1I9AA 3U53A 2FMLA 3SHDA 5C7QA 1MK1A 2YVMA 1PPXA 2O1CA 3SMDA 3ZR1A 5GHMA 3X0MA 4KG3A 1OW2A 1V8WA 3L85A 1VHGA 2YYHA 3QSJA 4C9XA 5CFJA 2Q9PA 3Q2TA 2JVBA 3EF5A 3R03A 3RH7A 1GA7A 1X51A 3ZR0A 4KYXA 1TUMA 3FFUA 3Q1PA 4N1UA 3N9UA 3A6VA 3E57A 3ACAA 1NFSA 4ICKA 3I9XA 2I8UA 4NFXA 1PUQA 1VIQA 2B0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZV A;  2DSC A;  1KHZ A;  3X0I A;  3EES A;  4HVY A;  4ZG0 A;  3COU A;  1V8I A;  2GT4 A;  1MUT A;  1V8R A;  1NQY A;  3X0Q A;  1G9Q A;  4S2Y A;  1JKN A;  4DYW A;  2PNY A;  2QKM B;  1PPW A;  1VC8 A;  5GHP A;  5BON A;  5DPK A;  1QVJ A;  3X0L A;  3X0P A;  5GHJ A;  2A8S A;  1VC9 A;  1SOI A;  3O52 A;  1PUS A;  3BHO A;  5BS6 A;  2PQV A;  3F13 A;  5GHN A;  3HYQ A;  2DSB A;  3BAP A;  5FSI A;  3SON A;  3ID9 A;  3I7V A;  3EXQ A;  3Q93 A;  5ANT A;  5FSL A;  3G0Q A;  2ICK A;  2G74 A;  1X84 A;  2QJO A;  3Q2S A;  1VHZ A;  2B2K A;  3EEU A;  5GHO A;  2G73 A;  2I6K A;  5GHI A;  1G0S A;  1XSC A;  3I7U A;  2CL3 A;  3P5T A;  5FSO A;  1V8T A;  5I8U A;  3X0S A;  1JRK A;  1F3Y A;  1MR2 A;  4YOQ A;  1R67 A;  4IJX A;  5ANU A;  3J7Y e;  1V8S A;  3GRN A;  2A8Q A;  3P6Y A;  3MGM A;  1PUN A;  1MQW A;  3GG6 A;  4KG4 A;  4K6E A;  4S2V A;  3BM4 A;  3O6Z A;  1KTG A;  2GT2 A;  2O5W A;  3Q4I A;  3MDG A;  1IRY A;  4KTB A;  2W4E A;  4V14 A;  5FSN A;  5C7T A;  5ANW A;  3GZ6 A;  5DD4 A;  2FVV A;  3CNG A;  1VK6 A;  5DEQ A;  1SU2 A;  3GZ8 A;  2A8T A;  2J8Q A;  1VIU A;  1PPV A;  3FCM A;  5ISY A;  1XSA A;  1HZT A;  2GB5 A;  1VRL A;  2QJT A;  2R5W A;  2A6T A;  2FKB A;  3A6S A;  1Q33 A;  1KT9 A;  5HZX A;  1K26 A;  3FK9 A;  1V8V A;  3GZ5 A;  4HFQ A;  5C8L A;  2DUK A;  1SZ3 A;  2DHO A;  1SJY A;  5ANS A;  3KVH A;  3DKU A;  4YPR A;  1V8L A;  2RRK A;  4S2X A;  2DSD A;  3N77 A;  5ANV A;  4JZU A;  5IW5 A;  5IW4 A;  3X0O A;  1X83 A;  3X0N A;  2XSQ A;  3Q91 A;  1U20 A;  1Q27 A;  3O69 A;  2A8R A;  4NFW A;  3FJY A;  3X0K A;  4JZT A;  2YVP A;  3FSP A;  1VCD A;  4JZS A;  1V8Y A;  1NQZ A;  1V8N A;  4MPO A;  2O5F A;  4S2W A;  2ICJ A;  1RYA A;  1XSB A;  5FSM A;  5DDG A;  2KDV A;  3H95 A;  1RRS A;  3A6T A;  3GWY A;  2B06 A;  3X0J A;  3O8S A;  3O61 A;  1V8M A;  1K2E A;  4ILQ A;  3WHW A;  1NFZ A;  2VNQ A;  1PVF A;  3A6U A;  1Q54 A;  5GHQ A;  3AC9 A;  1MP2 A;  1RRQ A;  2YVN A;  3HHJ A;  3OGA A;  1V8U A;  4C9W A;  4YPH A;  5LPG A;  1MQE A;  5FSK A;  3MDI A;  3X0R A;  1HX3 A;  2YVO A;  2KDW A;  2A8P A;  2VNP A;  3MCF A;  5CFI A;  2I8T A;  2AZW A;  3F6A A;  3DUP A;  4N1T A;  1I9A A;  3U53 A;  2FML A;  3SHD A;  5C7Q A;  1MK1 A;  2YVM A;  1PPX A;  2O1C A;  3SMD A;  3ZR1 A;  5GHM A;  3X0M A;  4KG3 A;  1OW2 A;  1V8W A;  3L85 A;  1VHG A;  2YYH A;  3QSJ A;  4C9X A;  5CFJ A;  2Q9P A;  3Q2T A;  2JVB A;  3EF5 A;  3R03 A;  3RH7 A;  1GA7 A;  1X51 A;  3ZR0 A;  4KYX A;  1TUM A;  3FFU A;  3Q1P A;  4N1U A;  3N9U A;  3A6V A;  3E57 A;  3ACA A;  1NFS A;  4ICK A;  3I9X A;  2I8U A;  4NFX A;  1PUQ A;  1VIQ A;  2B0V A; 
#chains in the Genus database with same CATH topology
 4JZV A;  2DSC A;  1KHZ A;  3X0I A;  3EES A;  4HVY A;  4ZG0 A;  3COU A;  1V8I A;  2GT4 A;  1MUT A;  1V8R A;  1NQY A;  3X0Q A;  1G9Q A;  4S2Y A;  1JKN A;  4DYW A;  2PNY A;  2QKM B;  1PPW A;  1VC8 A;  5GHP A;  5BON A;  5DPK A;  1QVJ A;  3X0L A;  3X0P A;  5GHJ A;  2A8S A;  1VC9 A;  1SOI A;  3O52 A;  1PUS A;  3BHO A;  5BS6 A;  2PQV A;  3F13 A;  4J7G A;  5GHN A;  3HYQ A;  2DSB A;  3BAP A;  5FSI A;  3SON A;  3ID9 A;  3I7V A;  3EXQ A;  3Q93 A;  5ANT A;  5FSL A;  3G0Q A;  2ICK A;  2G74 A;  1X84 A;  2QJO A;  3Q2S A;  1VHZ A;  2B2K A;  3EEU A;  4J7H A;  2G73 A;  2I6K A;  5GHO A;  5GHI A;  1G0S A;  1XSC A;  3I7U A;  2CL3 A;  3P5T A;  5FSO A;  1V8T A;  5I8U A;  3X0S A;  1JRK A;  1F3Y A;  1MR2 A;  4YOQ A;  1R67 A;  4IJX A;  5ANU A;  3J7Y e;  1V8S A;  3GRN A;  2A8Q A;  3P6Y A;  3MGM A;  1PUN A;  1MQW A;  3GG6 A;  4KG4 A;  4K6E A;  4S2V A;  3BM4 A;  3O6Z A;  1KTG A;  2GT2 A;  2O5W A;  3Q4I A;  3MDG A;  1IRY A;  4KTB A;  2W4E A;  4V14 A;  5FSN A;  5C7T A;  5ANW A;  3GZ6 A;  5DD4 A;  2FVV A;  3CNG A;  1VK6 A;  5DEQ A;  1SU2 A;  3GZ8 A;  2A8T A;  2J8Q A;  1VIU A;  1PPV A;  3FCM A;  5ISY A;  1XSA A;  1HZT A;  2GB5 A;  1VRL A;  2QJT A;  2R5W A;  2A6T A;  2FKB A;  3A6S A;  1Q33 A;  1KT9 A;  5HZX A;  1K26 A;  3FK9 A;  1V8V A;  3GZ5 A;  4HFQ A;  5C8L A;  2DUK A;  1SZ3 A;  2DHO A;  1SJY A;  5ANS A;  3KVH A;  3DKU A;  4YPR A;  1V8L A;  2RRK A;  4S2X A;  2DSD A;  3N77 A;  5ANV A;  4JZU A;  5IW5 A;  5IW4 A;  3X0O A;  1X83 A;  3X0N A;  2XSQ A;  3Q91 A;  2CZR A;  1U20 A;  1Q27 A;  3O69 A;  2A8R A;  4NFW A;  3FJY A;  3X0K A;  4JZT A;  2YVP A;  3FSP A;  1VCD A;  4JZS A;  1V8Y A;  1NQZ A;  1V8N A;  4MPO A;  2O5F A;  4S2W A;  2ICJ A;  1RYA A;  1XSB A;  5FSM A;  5DDG A;  2KDV A;  3H95 A;  1RRS A;  3A6T A;  3GWY A;  2B06 A;  3X0J A;  3O8S A;  3O61 A;  1V8M A;  1K2E A;  4ILQ A;  3WHW A;  1NFZ A;  2VNQ A;  1PVF A;  3A6U A;  1Q54 A;  5GHQ A;  3AC9 A;  1MP2 A;  1RRQ A;  2YVN A;  3HHJ A;  3OGA A;  1V8U A;  4C9W A;  4YPH A;  5LPG A;  1MQE A;  5FSK A;  3MDI A;  3X0R A;  1HX3 A;  2YVO A;  2KDW A;  2A8P A;  2VNP A;  3MCF A;  5CFI A;  2I8T A;  2AZW A;  3F6A A;  3DUP A;  4N1T A;  1I9A A;  3U53 A;  2FML A;  3SHD A;  5C7Q A;  1MK1 A;  2YVM A;  1PPX A;  2O1C A;  3SMD A;  3ZR1 A;  5GHM A;  3X0M A;  4KG3 A;  1OW2 A;  1V8W A;  3L85 A;  1VHG A;  2YYH A;  3QSJ A;  4C9X A;  5CFJ A;  2Q9P A;  3Q2T A;  2JVB A;  3EF5 A;  3R03 A;  3RH7 A;  1GA7 A;  1X51 A;  3ZR0 A;  4KYX A;  1TUM A;  3FFU A;  3Q1P A;  4N1U A;  3N9U A;  3A6V A;  3E57 A;  3ACA A;  1NFS A;  4ICK A;  3I9X A;  2I8U A;  4NFX A;  1PUQ A;  1VIQ A;  2B0V A; 
#chains in the Genus database with same CATH homology
 4JZV A;  2DSC A;  1KHZ A;  3X0I A;  3EES A;  4HVY A;  4ZG0 A;  3COU A;  1V8I A;  2GT4 A;  1MUT A;  1V8R A;  1NQY A;  3X0Q A;  1G9Q A;  4S2Y A;  1JKN A;  4DYW A;  2PNY A;  2QKM B;  1PPW A;  1VC8 A;  5GHP A;  5BON A;  5DPK A;  1QVJ A;  3X0L A;  3X0P A;  5GHJ A;  2A8S A;  1VC9 A;  1SOI A;  3O52 A;  1PUS A;  3BHO A;  5BS6 A;  2PQV A;  3F13 A;  4J7G A;  5GHN A;  3HYQ A;  2DSB A;  3BAP A;  5FSI A;  3SON A;  3ID9 A;  3I7V A;  3EXQ A;  3Q93 A;  5ANT A;  5FSL A;  3G0Q A;  2ICK A;  2G74 A;  1X84 A;  2QJO A;  3Q2S A;  1VHZ A;  2B2K A;  3EEU A;  4J7H A;  2G73 A;  2I6K A;  5GHO A;  5GHI A;  1G0S A;  1XSC A;  3I7U A;  2CL3 A;  3P5T A;  5FSO A;  1V8T A;  5I8U A;  3X0S A;  1JRK A;  1F3Y A;  1MR2 A;  4YOQ A;  1R67 A;  4IJX A;  5ANU A;  3J7Y e;  1V8S A;  3GRN A;  2A8Q A;  3P6Y A;  3MGM A;  1PUN A;  1MQW A;  3GG6 A;  4KG4 A;  4K6E A;  4S2V A;  3BM4 A;  3O6Z A;  1KTG A;  2GT2 A;  2O5W A;  3Q4I A;  3MDG A;  1IRY A;  4KTB A;  2W4E A;  4V14 A;  5FSN A;  5C7T A;  5ANW A;  3GZ6 A;  5DD4 A;  2FVV A;  3CNG A;  1VK6 A;  5DEQ A;  1SU2 A;  3GZ8 A;  2A8T A;  2J8Q A;  1VIU A;  1PPV A;  3FCM A;  5ISY A;  1XSA A;  1HZT A;  2GB5 A;  1VRL A;  2QJT A;  2R5W A;  2A6T A;  2FKB A;  3A6S A;  1Q33 A;  1KT9 A;  5HZX A;  1K26 A;  3FK9 A;  1V8V A;  3GZ5 A;  4HFQ A;  5C8L A;  2DUK A;  1SZ3 A;  2DHO A;  1SJY A;  5ANS A;  3KVH A;  3DKU A;  4YPR A;  1V8L A;  2RRK A;  4S2X A;  2DSD A;  3N77 A;  5ANV A;  4JZU A;  5IW5 A;  5IW4 A;  3X0O A;  1X83 A;  3X0N A;  2XSQ A;  3Q91 A;  2CZR A;  1U20 A;  1Q27 A;  3O69 A;  2A8R A;  4NFW A;  3FJY A;  3X0K A;  4JZT A;  2YVP A;  3FSP A;  1VCD A;  4JZS A;  1V8Y A;  1NQZ A;  1V8N A;  4MPO A;  2O5F A;  4S2W A;  2ICJ A;  1RYA A;  1XSB A;  5FSM A;  5DDG A;  2KDV A;  3H95 A;  1RRS A;  3A6T A;  3GWY A;  2B06 A;  3X0J A;  3O8S A;  3O61 A;  1V8M A;  1K2E A;  4ILQ A;  3WHW A;  1NFZ A;  2VNQ A;  1PVF A;  3A6U A;  1Q54 A;  5GHQ A;  3AC9 A;  1MP2 A;  1RRQ A;  2YVN A;  3HHJ A;  3OGA A;  1V8U A;  4C9W A;  4YPH A;  5LPG A;  1MQE A;  5FSK A;  3MDI A;  3X0R A;  1HX3 A;  2YVO A;  2KDW A;  2A8P A;  2VNP A;  3MCF A;  5CFI A;  2I8T A;  2AZW A;  3F6A A;  3DUP A;  4N1T A;  1I9A A;  3U53 A;  2FML A;  3SHD A;  5C7Q A;  1MK1 A;  2YVM A;  1PPX A;  2O1C A;  3SMD A;  3ZR1 A;  5GHM A;  3X0M A;  4KG3 A;  1OW2 A;  1V8W A;  3L85 A;  1VHG A;  2YYH A;  3QSJ A;  4C9X A;  5CFJ A;  2Q9P A;  3Q2T A;  2JVB A;  3EF5 A;  3R03 A;  3RH7 A;  1GA7 A;  1X51 A;  3ZR0 A;  4KYX A;  1TUM A;  3FFU A;  3Q1P A;  4N1U A;  3N9U A;  3A6V A;  3E57 A;  3ACA A;  1NFS A;  4ICK A;  3I9X A;  2I8U A;  4NFX A;  1PUQ A;  1VIQ A;  2B0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...