1V8UA

Crystal structure analysis of the adp-ribose pyrophosphatase of e82q mutant with so4 and mg
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
159
structure length
154
Chain Sequence
RTYLYRGRILNLALEGRYEIVEHKPAVAVIALREGRMLFVRQMRPAVGLAPLEIPAGLIEPGEDPLEAARRQLAEETGLSGDLTYLFSYFVSPGFTDEKTHVFLAENLKEVEAEAIEVVWMRPEEALERHQRGEVEFSATGLVGVLYYHAFLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribose pyrophosphatase
publication title Structural insights into the Thermus thermophilus ADP-ribose pyrophosphatase mechanism via crystal structures with the bound substrate and metal
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 37
structure length 154
sequence length 159
ec nomenclature ec 3.6.1.13: ADP-ribose diphosphatase.
pdb deposition date 2004-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1v8uA00
2A8SA 3A6UA 3Q4IA 2J8QA 3E57A 4JZUA 1V8UA 2KDWA 3RH7A 3GZ5A 1XSAA 3FJYA 5DD4A 3FFUA 1KHZA 1VC8A 5DDGA 5DEQA 3FK9A 2Q9PA 2JVBA 2FMLA 4KTBA 1SU2A 3SMDA 2YVMA 1VK6A 2VNPA 3WHWA 2ICKA 3DKUA 2FVVA 3GRNA 1RRQA 5LPGA 2RRKA 5GHMA 4S2XA 4YPRA 3X0SA 3HYQA 2XSQA 1VC9A 4ZG0A 1K26A 2GT4A 4JZSA 5ANVA 5FSKA 2KDVA 3R03A 4KG4A 5CFJA 3CNGA 2O1CA 3MGMA 2GT2A 3DUPA 1V8WA 2R5WA 3FSPA 5GHJA 1VHZA 2I8TA 1Q33A 3I7UA 5BONA 4S2YA 4N1TA 5FSIA 4ILQA 2YVNA 2A8QA 1SOIA 1X51A 3Q2TA 3ZR1A 1IRYA 3SHDA 1V8RA 2I6KA 2PQVA 5C8LA 3N77A 3U53A 1R67A 4IJXA 3AC9A 1NQZA 2B06A 1G0SA 4HFQA 4N1UA 3P5TA 1VRLA 2A6TA 1I9AA 2YVOA 1KT9A 3OGAA 2A8RA 1JRKA 4K6EA 4HVYA 4JZVA 2ICJA 3J7Ye 3O6ZA 5IW4A 2AZWA 4YOQA 5IW5A 3HHJA 3EEUA 1MQEA 3MCFA 1NFZA 1PUNA 1NQYA 1VHGA 1PPVA 1TUMA 3BM4A 3GG6A 2G73A 4C9WA 1XSCA 5GHIA 2W4EA 1V8SA 3ZR0A 5FSLA 1PPXA 2PNYA 4NFWA 5DPKA 2CL3A 3ID9A 2A8PA 3BHOA 3KVHA 1XSBA 3FCMA 1NFSA 2QKMB 1MP2A 3Q93A 4S2VA 3MDIA 1MR2A 3EESA 1V8LA 3O69A 1X84A 4C9XA 5C7QA 1V8VA 1PVFA 1RYAA 1V8YA 2B2KA 4S2WA 5ANSA 5GHPA 3X0QA 1PUQA 3X0MA 1X83A 1HZTA 4MPOA 2QJOA 3GWYA 4YPHA 1G9QA 2QJTA 5CFIA 1V8MA 5FSOA 1VIQA 2G74A 1SZ3A 1Q54A 2O5WA 3A6VA 3I7VA 3X0IA 3P6YA 2DSBA 3Q2SA 1K2EA 3N9UA 1QVJA 2DHOA 3O8SA 3X0KA 3X0RA 3ACAA 5ANUA 5I8UA 2VNQA 2DSDA 2I8UA 3X0OA 1GA7A 1U20A 5FSMA 1V8TA 3A6SA 1V8NA 2FKBA 5FSNA 5BS6A 1RRSA 3I9XA 1VIUA 2DUKA 4ICKA 2YVPA 3A6TA 3EF5A 3X0JA 5GHOA 1F3YA 1V8IA 4JZTA 3GZ8A 1Q27A 4KG3A 3X0LA 3G0QA 1KTGA 3COUA 3H95A 4NFXA 5HZXA 1MK1A 1MUTA 1SJYA 3O52A 4KYXA 3F6AA 5GHNA 3X0PA 2B0VA 3SONA 1PPWA 2O5FA 2YYHA 1JKNA 1MQWA 3Q1PA 3Q91A 2DSCA 3BAPA 5ANWA 5ISYA 3QSJA 4DYWA 1VCDA 1HX3A 3O61A 5C7TA 3MDGA 2A8TA 3EXQA 5ANTA 3F13A 1PUSA 3L85A 4V14A 3X0NA 1OW2A 3GZ6A 5GHQA 2GB5A
chains in the Genus database with same CATH superfamily
2A8SA 3A6UA 3Q4IA 2J8QA 3E57A 4JZUA 1V8UA 2KDWA 3RH7A 3GZ5A 1XSAA 3FJYA 5DD4A 3FFUA 1KHZA 1VC8A 5DDGA 5DEQA 3FK9A 2Q9PA 2JVBA 2FMLA 4KTBA 1SU2A 3SMDA 2YVMA 1VK6A 2VNPA 3WHWA 2ICKA 3DKUA 2FVVA 3GRNA 1RRQA 5LPGA 2RRKA 5GHMA 4S2XA 4YPRA 3X0SA 3HYQA 2XSQA 1VC9A 4ZG0A 1K26A 2GT4A 4JZSA 5ANVA 5FSKA 2KDVA 3R03A 4KG4A 5CFJA 3CNGA 2O1CA 3MGMA 2GT2A 3DUPA 1V8WA 2R5WA 3FSPA 5GHJA 1VHZA 2I8TA 1Q33A 3I7UA 5BONA 4S2YA 4N1TA 5FSIA 4ILQA 2YVNA 2A8QA 1SOIA 1X51A 3Q2TA 3ZR1A 1IRYA 3SHDA 1V8RA 2I6KA 2PQVA 5C8LA 3N77A 3U53A 1R67A 4IJXA 3AC9A 1NQZA 2B06A 1G0SA 4HFQA 4N1UA 3P5TA 1VRLA 2A6TA 1I9AA 4J7HA 2YVOA 1KT9A 3OGAA 2A8RA 1JRKA 4K6EA 4HVYA 4JZVA 2ICJA 3J7Ye 3O6ZA 5IW4A 2AZWA 4YOQA 5IW5A 3HHJA 3EEUA 1MQEA 3MCFA 1NFZA 1PUNA 1NQYA 1VHGA 1PPVA 1TUMA 3BM4A 3GG6A 2G73A 4C9WA 1XSCA 5GHIA 2W4EA 1V8SA 3ZR0A 5FSLA 1PPXA 2PNYA 4NFWA 5DPKA 2CL3A 3ID9A 2A8PA 3BHOA 3KVHA 1XSBA 3FCMA 1NFSA 2QKMB 1MP2A 3Q93A 4S2VA 3MDIA 1MR2A 3EESA 1V8LA 3O69A 1X84A 4C9XA 5C7QA 1V8VA 1PVFA 1RYAA 1V8YA 2B2KA 4S2WA 5ANSA 5GHPA 3X0QA 1PUQA 3X0MA 1X83A 1HZTA 4MPOA 2QJOA 3GWYA 4YPHA 1G9QA 2QJTA 5CFIA 1V8MA 5FSOA 1VIQA 2G74A 1SZ3A 1Q54A 2O5WA 3A6VA 3I7VA 3X0IA 3P6YA 2DSBA 3Q2SA 1K2EA 3N9UA 1QVJA 2DHOA 3O8SA 3X0KA 3X0RA 3ACAA 5ANUA 5I8UA 2VNQA 2DSDA 2I8UA 3X0OA 1GA7A 1U20A 5FSMA 1V8TA 3A6SA 1V8NA 2FKBA 5FSNA 5BS6A 1RRSA 3I9XA 1VIUA 2DUKA 4ICKA 2YVPA 3A6TA 3EF5A 3X0JA 5GHOA 1F3YA 1V8IA 4JZTA 3GZ8A 1Q27A 4J7GA 4KG3A 3X0LA 3G0QA 1KTGA 3COUA 3H95A 4NFXA 5HZXA 1MK1A 1MUTA 1SJYA 3O52A 4KYXA 3F6AA 5GHNA 3X0PA 2B0VA 3SONA 1PPWA 2O5FA 2YYHA 1JKNA 1MQWA 3Q1PA 2CZRA 3Q91A 2DSCA 3BAPA 5ANWA 5ISYA 3QSJA 4DYWA 1VCDA 1HX3A 3O61A 5C7TA 3MDGA 2A8TA 3EXQA 5ANTA 3F13A 1PUSA 3L85A 4V14A 3X0NA 1OW2A 3GZ6A 5GHQA 2GB5A
chains in the Genus database with same CATH topology
2A8SA 3A6UA 3Q4IA 2J8QA 3E57A 4JZUA 1V8UA 2KDWA 3RH7A 3GZ5A 1XSAA 3FJYA 5DD4A 3FFUA 1KHZA 1VC8A 5DDGA 5DEQA 3FK9A 2Q9PA 2JVBA 2FMLA 4KTBA 1SU2A 3SMDA 2YVMA 1VK6A 2VNPA 3WHWA 2ICKA 3DKUA 2FVVA 3GRNA 1RRQA 5LPGA 2RRKA 5GHMA 4S2XA 4YPRA 3X0SA 3HYQA 2XSQA 1VC9A 4ZG0A 1K26A 2GT4A 4JZSA 5ANVA 5FSKA 2KDVA 3R03A 4KG4A 5CFJA 3CNGA 2O1CA 3MGMA 2GT2A 3DUPA 1V8WA 2R5WA 3FSPA 5GHJA 1VHZA 2I8TA 1Q33A 3I7UA 5BONA 4S2YA 4N1TA 5FSIA 4ILQA 2YVNA 2A8QA 1SOIA 1X51A 3Q2TA 3ZR1A 1IRYA 3SHDA 1V8RA 2I6KA 2PQVA 5C8LA 3N77A 3U53A 1R67A 4IJXA 3AC9A 1NQZA 2B06A 1G0SA 4HFQA 4N1UA 3P5TA 1VRLA 2A6TA 1I9AA 4J7HA 2YVOA 1KT9A 3OGAA 2A8RA 1JRKA 4K6EA 4HVYA 4JZVA 2ICJA 3J7Ye 3O6ZA 5IW4A 2AZWA 4YOQA 5IW5A 3HHJA 3EEUA 1MQEA 3MCFA 1NFZA 1PUNA 1NQYA 1VHGA 1PPVA 1TUMA 3BM4A 3GG6A 2G73A 4C9WA 1XSCA 5GHIA 2W4EA 1V8SA 3ZR0A 5FSLA 1PPXA 2PNYA 4NFWA 5DPKA 2CL3A 3ID9A 2A8PA 3BHOA 3KVHA 1XSBA 3FCMA 1NFSA 2QKMB 1MP2A 3Q93A 4S2VA 3MDIA 1MR2A 3EESA 1V8LA 3O69A 1X84A 4C9XA 5C7QA 1V8VA 1PVFA 1RYAA 1V8YA 2B2KA 4S2WA 5ANSA 5GHPA 3X0QA 1PUQA 3X0MA 1X83A 1HZTA 4MPOA 2QJOA 3GWYA 4YPHA 1G9QA 2QJTA 5CFIA 1V8MA 5FSOA 1VIQA 2G74A 1SZ3A 1Q54A 2O5WA 3A6VA 3I7VA 3X0IA 3P6YA 2DSBA 3Q2SA 1K2EA 3N9UA 1QVJA 2DHOA 3O8SA 3X0KA 3X0RA 3ACAA 5ANUA 5I8UA 2VNQA 2DSDA 2I8UA 3X0OA 1GA7A 1U20A 5FSMA 1V8TA 3A6SA 1V8NA 2FKBA 5FSNA 5BS6A 1RRSA 3I9XA 1VIUA 2DUKA 4ICKA 2YVPA 3A6TA 3EF5A 3X0JA 5GHOA 1F3YA 1V8IA 4JZTA 3GZ8A 1Q27A 4J7GA 4KG3A 3X0LA 3G0QA 1KTGA 3COUA 3H95A 4NFXA 5HZXA 1MK1A 1MUTA 1SJYA 3O52A 4KYXA 3F6AA 5GHNA 3X0PA 2B0VA 3SONA 1PPWA 2O5FA 2YYHA 1JKNA 1MQWA 3Q1PA 2CZRA 3Q91A 2DSCA 3BAPA 5ANWA 5ISYA 3QSJA 4DYWA 1VCDA 1HX3A 3O61A 5C7TA 3MDGA 2A8TA 3EXQA 5ANTA 3F13A 1PUSA 3L85A 4V14A 3X0NA 1OW2A 3GZ6A 5GHQA 2GB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A8S A;  3A6U A;  3Q4I A;  2J8Q A;  3E57 A;  4JZU A;  1V8U A;  2KDW A;  3RH7 A;  3GZ5 A;  1XSA A;  3FJY A;  5DD4 A;  3FFU A;  1KHZ A;  1VC8 A;  5DDG A;  5DEQ A;  3FK9 A;  2Q9P A;  2JVB A;  2FML A;  4KTB A;  1SU2 A;  3SMD A;  2YVM A;  1VK6 A;  2VNP A;  3WHW A;  2ICK A;  3DKU A;  2FVV A;  3GRN A;  1RRQ A;  5LPG A;  2RRK A;  5GHM A;  4S2X A;  4YPR A;  3X0S A;  3HYQ A;  2XSQ A;  1VC9 A;  4ZG0 A;  1K26 A;  2GT4 A;  4JZS A;  5ANV A;  5FSK A;  2KDV A;  3R03 A;  4KG4 A;  5CFJ A;  3CNG A;  2O1C A;  3MGM A;  2GT2 A;  3DUP A;  1V8W A;  2R5W A;  3FSP A;  5GHJ A;  1VHZ A;  2I8T A;  1Q33 A;  3I7U A;  5BON A;  4S2Y A;  4N1T A;  5FSI A;  4ILQ A;  2YVN A;  2A8Q A;  1SOI A;  1X51 A;  3Q2T A;  3ZR1 A;  1IRY A;  3SHD A;  1V8R A;  2I6K A;  2PQV A;  5C8L A;  3N77 A;  3U53 A;  1R67 A;  4IJX A;  3AC9 A;  1NQZ A;  2B06 A;  1G0S A;  4HFQ A;  4N1U A;  3P5T A;  1VRL A;  2A6T A;  1I9A A;  2YVO A;  1KT9 A;  3OGA A;  2A8R A;  1JRK A;  4K6E A;  4HVY A;  4JZV A;  2ICJ A;  3J7Y e;  3O6Z A;  5IW4 A;  2AZW A;  4YOQ A;  5IW5 A;  3HHJ A;  3EEU A;  1MQE A;  3MCF A;  1NFZ A;  1PUN A;  1NQY A;  1VHG A;  1PPV A;  1TUM A;  3BM4 A;  3GG6 A;  2G73 A;  4C9W A;  1XSC A;  5GHI A;  2W4E A;  1V8S A;  3ZR0 A;  5FSL A;  1PPX A;  2PNY A;  4NFW A;  5DPK A;  2CL3 A;  3ID9 A;  2A8P A;  3BHO A;  3KVH A;  1XSB A;  3FCM A;  1NFS A;  2QKM B;  1MP2 A;  3Q93 A;  4S2V A;  3MDI A;  1MR2 A;  3EES A;  1V8L A;  3O69 A;  1X84 A;  4C9X A;  5C7Q A;  1V8V A;  1PVF A;  1RYA A;  1V8Y A;  2B2K A;  4S2W A;  5ANS A;  5GHP A;  3X0Q A;  1PUQ A;  3X0M A;  1X83 A;  1HZT A;  4MPO A;  2QJO A;  3GWY A;  4YPH A;  1G9Q A;  2QJT A;  5CFI A;  1V8M A;  5FSO A;  1VIQ A;  2G74 A;  1SZ3 A;  1Q54 A;  2O5W A;  3A6V A;  3I7V A;  3X0I A;  3P6Y A;  2DSB A;  3Q2S A;  1K2E A;  3N9U A;  1QVJ A;  2DHO A;  3O8S A;  3X0K A;  3X0R A;  3ACA A;  5ANU A;  5I8U A;  2VNQ A;  2DSD A;  2I8U A;  3X0O A;  1GA7 A;  1U20 A;  5FSM A;  1V8T A;  3A6S A;  1V8N A;  2FKB A;  5FSN A;  5BS6 A;  1RRS A;  3I9X A;  1VIU A;  2DUK A;  4ICK A;  2YVP A;  3A6T A;  3EF5 A;  3X0J A;  5GHO A;  1F3Y A;  1V8I A;  4JZT A;  3GZ8 A;  1Q27 A;  4KG3 A;  3X0L A;  3G0Q A;  1KTG A;  3COU A;  3H95 A;  4NFX A;  5HZX A;  1MK1 A;  1MUT A;  1SJY A;  3O52 A;  4KYX A;  3F6A A;  5GHN A;  3X0P A;  2B0V A;  3SON A;  1PPW A;  2O5F A;  2YYH A;  1JKN A;  1MQW A;  3Q1P A;  3Q91 A;  2DSC A;  3BAP A;  5ANW A;  5ISY A;  3QSJ A;  4DYW A;  1VCD A;  1HX3 A;  3O61 A;  5C7T A;  3MDG A;  2A8T A;  3EXQ A;  5ANT A;  3F13 A;  1PUS A;  3L85 A;  4V14 A;  3X0N A;  1OW2 A;  3GZ6 A;  5GHQ A;  2GB5 A; 
#chains in the Genus database with same CATH topology
 2A8S A;  3A6U A;  3Q4I A;  2J8Q A;  3E57 A;  4JZU A;  1V8U A;  2KDW A;  3RH7 A;  3GZ5 A;  1XSA A;  3FJY A;  5DD4 A;  3FFU A;  1KHZ A;  1VC8 A;  5DDG A;  5DEQ A;  3FK9 A;  2Q9P A;  2JVB A;  2FML A;  4KTB A;  1SU2 A;  3SMD A;  2YVM A;  1VK6 A;  2VNP A;  3WHW A;  2ICK A;  3DKU A;  2FVV A;  3GRN A;  1RRQ A;  5LPG A;  2RRK A;  5GHM A;  4S2X A;  4YPR A;  3X0S A;  3HYQ A;  2XSQ A;  1VC9 A;  4ZG0 A;  1K26 A;  2GT4 A;  4JZS A;  5ANV A;  5FSK A;  2KDV A;  3R03 A;  4KG4 A;  5CFJ A;  3CNG A;  2O1C A;  3MGM A;  2GT2 A;  3DUP A;  1V8W A;  2R5W A;  3FSP A;  5GHJ A;  1VHZ A;  2I8T A;  1Q33 A;  3I7U A;  5BON A;  4S2Y A;  4N1T A;  5FSI A;  4ILQ A;  2YVN A;  2A8Q A;  1SOI A;  1X51 A;  3Q2T A;  3ZR1 A;  1IRY A;  3SHD A;  1V8R A;  2I6K A;  2PQV A;  5C8L A;  3N77 A;  3U53 A;  1R67 A;  4IJX A;  3AC9 A;  1NQZ A;  2B06 A;  1G0S A;  4HFQ A;  4N1U A;  3P5T A;  1VRL A;  2A6T A;  1I9A A;  4J7H A;  2YVO A;  1KT9 A;  3OGA A;  2A8R A;  1JRK A;  4K6E A;  4HVY A;  4JZV A;  2ICJ A;  3J7Y e;  3O6Z A;  5IW4 A;  2AZW A;  4YOQ A;  5IW5 A;  3HHJ A;  3EEU A;  1MQE A;  3MCF A;  1NFZ A;  1PUN A;  1NQY A;  1VHG A;  1PPV A;  1TUM A;  3BM4 A;  3GG6 A;  2G73 A;  4C9W A;  1XSC A;  5GHI A;  2W4E A;  1V8S A;  3ZR0 A;  5FSL A;  1PPX A;  2PNY A;  4NFW A;  5DPK A;  2CL3 A;  3ID9 A;  2A8P A;  3BHO A;  3KVH A;  1XSB A;  3FCM A;  1NFS A;  2QKM B;  1MP2 A;  3Q93 A;  4S2V A;  3MDI A;  1MR2 A;  3EES A;  1V8L A;  3O69 A;  1X84 A;  4C9X A;  5C7Q A;  1V8V A;  1PVF A;  1RYA A;  1V8Y A;  2B2K A;  4S2W A;  5ANS A;  5GHP A;  3X0Q A;  1PUQ A;  3X0M A;  1X83 A;  1HZT A;  4MPO A;  2QJO A;  3GWY A;  4YPH A;  1G9Q A;  2QJT A;  5CFI A;  1V8M A;  5FSO A;  1VIQ A;  2G74 A;  1SZ3 A;  1Q54 A;  2O5W A;  3A6V A;  3I7V A;  3X0I A;  3P6Y A;  2DSB A;  3Q2S A;  1K2E A;  3N9U A;  1QVJ A;  2DHO A;  3O8S A;  3X0K A;  3X0R A;  3ACA A;  5ANU A;  5I8U A;  2VNQ A;  2DSD A;  2I8U A;  3X0O A;  1GA7 A;  1U20 A;  5FSM A;  1V8T A;  3A6S A;  1V8N A;  2FKB A;  5FSN A;  5BS6 A;  1RRS A;  3I9X A;  1VIU A;  2DUK A;  4ICK A;  2YVP A;  3A6T A;  3EF5 A;  3X0J A;  5GHO A;  1F3Y A;  1V8I A;  4JZT A;  3GZ8 A;  1Q27 A;  4J7G A;  4KG3 A;  3X0L A;  3G0Q A;  1KTG A;  3COU A;  3H95 A;  4NFX A;  5HZX A;  1MK1 A;  1MUT A;  1SJY A;  3O52 A;  4KYX A;  3F6A A;  5GHN A;  3X0P A;  2B0V A;  3SON A;  1PPW A;  2O5F A;  2YYH A;  1JKN A;  1MQW A;  3Q1P A;  2CZR A;  3Q91 A;  2DSC A;  3BAP A;  5ANW A;  5ISY A;  3QSJ A;  4DYW A;  1VCD A;  1HX3 A;  3O61 A;  5C7T A;  3MDG A;  2A8T A;  3EXQ A;  5ANT A;  3F13 A;  1PUS A;  3L85 A;  4V14 A;  3X0N A;  1OW2 A;  3GZ6 A;  5GHQ A;  2GB5 A; 
#chains in the Genus database with same CATH homology
 2A8S A;  3A6U A;  3Q4I A;  2J8Q A;  3E57 A;  4JZU A;  1V8U A;  2KDW A;  3RH7 A;  3GZ5 A;  1XSA A;  3FJY A;  5DD4 A;  3FFU A;  1KHZ A;  1VC8 A;  5DDG A;  5DEQ A;  3FK9 A;  2Q9P A;  2JVB A;  2FML A;  4KTB A;  1SU2 A;  3SMD A;  2YVM A;  1VK6 A;  2VNP A;  3WHW A;  2ICK A;  3DKU A;  2FVV A;  3GRN A;  1RRQ A;  5LPG A;  2RRK A;  5GHM A;  4S2X A;  4YPR A;  3X0S A;  3HYQ A;  2XSQ A;  1VC9 A;  4ZG0 A;  1K26 A;  2GT4 A;  4JZS A;  5ANV A;  5FSK A;  2KDV A;  3R03 A;  4KG4 A;  5CFJ A;  3CNG A;  2O1C A;  3MGM A;  2GT2 A;  3DUP A;  1V8W A;  2R5W A;  3FSP A;  5GHJ A;  1VHZ A;  2I8T A;  1Q33 A;  3I7U A;  5BON A;  4S2Y A;  4N1T A;  5FSI A;  4ILQ A;  2YVN A;  2A8Q A;  1SOI A;  1X51 A;  3Q2T A;  3ZR1 A;  1IRY A;  3SHD A;  1V8R A;  2I6K A;  2PQV A;  5C8L A;  3N77 A;  3U53 A;  1R67 A;  4IJX A;  3AC9 A;  1NQZ A;  2B06 A;  1G0S A;  4HFQ A;  4N1U A;  3P5T A;  1VRL A;  2A6T A;  1I9A A;  4J7H A;  2YVO A;  1KT9 A;  3OGA A;  2A8R A;  1JRK A;  4K6E A;  4HVY A;  4JZV A;  2ICJ A;  3J7Y e;  3O6Z A;  5IW4 A;  2AZW A;  4YOQ A;  5IW5 A;  3HHJ A;  3EEU A;  1MQE A;  3MCF A;  1NFZ A;  1PUN A;  1NQY A;  1VHG A;  1PPV A;  1TUM A;  3BM4 A;  3GG6 A;  2G73 A;  4C9W A;  1XSC A;  5GHI A;  2W4E A;  1V8S A;  3ZR0 A;  5FSL A;  1PPX A;  2PNY A;  4NFW A;  5DPK A;  2CL3 A;  3ID9 A;  2A8P A;  3BHO A;  3KVH A;  1XSB A;  3FCM A;  1NFS A;  2QKM B;  1MP2 A;  3Q93 A;  4S2V A;  3MDI A;  1MR2 A;  3EES A;  1V8L A;  3O69 A;  1X84 A;  4C9X A;  5C7Q A;  1V8V A;  1PVF A;  1RYA A;  1V8Y A;  2B2K A;  4S2W A;  5ANS A;  5GHP A;  3X0Q A;  1PUQ A;  3X0M A;  1X83 A;  1HZT A;  4MPO A;  2QJO A;  3GWY A;  4YPH A;  1G9Q A;  2QJT A;  5CFI A;  1V8M A;  5FSO A;  1VIQ A;  2G74 A;  1SZ3 A;  1Q54 A;  2O5W A;  3A6V A;  3I7V A;  3X0I A;  3P6Y A;  2DSB A;  3Q2S A;  1K2E A;  3N9U A;  1QVJ A;  2DHO A;  3O8S A;  3X0K A;  3X0R A;  3ACA A;  5ANU A;  5I8U A;  2VNQ A;  2DSD A;  2I8U A;  3X0O A;  1GA7 A;  1U20 A;  5FSM A;  1V8T A;  3A6S A;  1V8N A;  2FKB A;  5FSN A;  5BS6 A;  1RRS A;  3I9X A;  1VIU A;  2DUK A;  4ICK A;  2YVP A;  3A6T A;  3EF5 A;  3X0J A;  5GHO A;  1F3Y A;  1V8I A;  4JZT A;  3GZ8 A;  1Q27 A;  4J7G A;  4KG3 A;  3X0L A;  3G0Q A;  1KTG A;  3COU A;  3H95 A;  4NFX A;  5HZX A;  1MK1 A;  1MUT A;  1SJY A;  3O52 A;  4KYX A;  3F6A A;  5GHN A;  3X0P A;  2B0V A;  3SON A;  1PPW A;  2O5F A;  2YYH A;  1JKN A;  1MQW A;  3Q1P A;  2CZR A;  3Q91 A;  2DSC A;  3BAP A;  5ANW A;  5ISY A;  3QSJ A;  4DYW A;  1VCD A;  1HX3 A;  3O61 A;  5C7T A;  3MDG A;  2A8T A;  3EXQ A;  5ANT A;  3F13 A;  1PUS A;  3L85 A;  4V14 A;  3X0N A;  1OW2 A;  3GZ6 A;  5GHQ A;  2GB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...