2YYHA

Crystal structure of nudix family protein from aquifex aeolicus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
GFNVKTPLLATDVIIRLWDGENFKGIVLIERKYPPVGLALPGGFVEVGERVEEAAAREMREETGLEVRLHKLMGVYSDPERDPRAHVVSVVWIGDAQGEPKAGSDAKKVKVYRLEEIPLDKLVFDHKKIILDFLKGNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 8-OXO-dGTPase domain
publication title Crystal structure of Nudix family protein from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
total genus 31
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2yyhA00
3BAPA 2ICJA 3A6TA 2RRKA 1VC8A 1PPXA 2QKMB 3OGAA 2GT4A 3Q1PA 5DEQA 3X0MA 2O1CA 5I8UA 2A8RA 2A8PA 2YVOA 5ANUA 5ANTA 2DHOA 1SJYA 1I9AA 3COUA 3R03A 4JZTA 1JRKA 1NFSA 2R5WA 1SU2A 1V8UA 2G74A 5BS6A 4JZVA 4DYWA 2A8SA 2A8QA 3P5TA 2PQVA 3O61A 3X0QA 3O69A 3AC9A 3GZ8A 3Q91A 1U20A 3X0KA 4ZG0A 5ISYA 3QSJA 1G0SA 2KDVA 5LPGA 1JKNA 3EF5A 4HFQA 2A8TA 5FSKA 3RH7A 5HZXA 3FCMA 2FKBA 1NQZA 1VCDA 1VIQA 2B2KA 1MQWA 5GHQA 5DPKA 3BHOA 2B06A 4ICKA 5ANSA 4V14A 1F3YA 4N1TA 3HHJA 1IRYA 2DSCA 3DUPA 1VC9A 5ANWA 1NFZA 4KG3A 5GHOA 1V8LA 5GHMA 2DSBA 3HYQA 3X0JA 1PUSA 2I8TA 2GT2A 3BM4A 1PVFA 3X0IA 3SMDA 1V8TA 1VHGA 3GRNA 4KYXA 5GHIA 3ZR1A 3Q2TA 1PUQA 1SOIA 1RRSA 5DDGA 4S2XA 1X51A 4S2YA 4S2WA 2J8QA 2JVBA 2W4EA 3MDIA 3MDGA 1RYAA 1XSBA 4C9XA 1X84A 1V8MA 3DKUA 1V8VA 3N9UA 5DD4A 2AZWA 1V8IA 5C7QA 4N1UA 5CFJA 1Q54A 3O52A 5IW4A 5GHPA 3GZ5A 2I6KA 1K26A 2DSDA 1TUMA 2QJOA 3FFUA 5FSIA 2KDWA 5BONA 3GZ6A 3MGMA 1G9QA 1V8RA 3O6ZA 3A6UA 3EXQA 2GB5A 4YOQA 2ICKA 2FVVA 3A6VA 1Q27A 2Q9PA 2QJTA 1RRQA 1GA7A 1V8SA 2G73A 3FJYA 4JZSA 3O8SA 2XSQA 2YVMA 3KVHA 4NFXA 2CL3A 1MQEA 3I7VA 1VIUA 3L85A 2B0VA 3F13A 3X0RA 5CFIA 1KTGA 4S2VA 1Q33A 2FMLA 5IW5A 2PNYA 3EESA 4KTBA 3I9XA 1MK1A 1QVJA 3Q2SA 5GHNA 1NQYA 2O5WA 3H95A 3MCFA 3X0OA 1VRLA 5FSOA 3WHWA 3FK9A 3FSPA 2I8UA 3CNGA 1PPWA 2YVPA 5GHJA 2A6TA 5ANVA 5FSMA 1XSAA 1SZ3A 1MP2A 3U53A 1X83A 1XSCA 4HVYA 5FSNA 3X0LA 4YPHA 1MR2A 3E57A 3EEUA 3GG6A 3N77A 1V8WA 5C8LA 4MPOA 3X0SA 3Q93A 5FSLA 1V8NA 2O5FA 3X0NA 1PUNA 4ILQA 4KG4A 3ID9A 4NFWA 1KHZA 1KT9A 2YVNA 3P6YA 2VNQA 1K2EA 4IJXA 2DUKA 1OW2A 3G0QA 3A6SA 2YYHA 1MUTA 1HZTA 4JZUA 4YPRA 1PPVA 3I7UA 1VK6A 3SHDA 1HX3A 2VNPA 3Q4IA 1R67A 5C7TA 1VHZA 3X0PA 3ZR0A 3SONA 3ACAA 1V8YA 3GWYA 4C9WA 4K6EA 3J7Ye 3F6AA
chains in the Genus database with same CATH superfamily
3BAPA 2ICJA 3A6TA 2RRKA 1VC8A 1PPXA 2QKMB 3OGAA 2GT4A 3Q1PA 5DEQA 3X0MA 2O1CA 5I8UA 2A8RA 2A8PA 2YVOA 5ANUA 5ANTA 2DHOA 1SJYA 1I9AA 3COUA 3R03A 4JZTA 1JRKA 1NFSA 2R5WA 1SU2A 1V8UA 2G74A 5BS6A 4JZVA 4DYWA 2A8SA 2A8QA 3P5TA 2PQVA 3O61A 3X0QA 3O69A 3AC9A 3GZ8A 3Q91A 1U20A 3X0KA 4ZG0A 5ISYA 3QSJA 1G0SA 2KDVA 5LPGA 1JKNA 3EF5A 4HFQA 2A8TA 5FSKA 3RH7A 5HZXA 3FCMA 2FKBA 1NQZA 1VCDA 1VIQA 2B2KA 1MQWA 5GHQA 5DPKA 3BHOA 2B06A 4ICKA 5ANSA 4V14A 1F3YA 4N1TA 3HHJA 1IRYA 2DSCA 3DUPA 1VC9A 5ANWA 1NFZA 4KG3A 5GHOA 1V8LA 5GHMA 2DSBA 3HYQA 3X0JA 1PUSA 2CZRA 2I8TA 2GT2A 3BM4A 1PVFA 3X0IA 3SMDA 1V8TA 1VHGA 3GRNA 4KYXA 5GHIA 3ZR1A 3Q2TA 1PUQA 1SOIA 1RRSA 5DDGA 4S2XA 1X51A 4S2YA 4S2WA 2J8QA 2JVBA 2W4EA 3MDIA 3MDGA 1RYAA 1XSBA 4C9XA 1X84A 1V8MA 3DKUA 1V8VA 3N9UA 5DD4A 2AZWA 1V8IA 5C7QA 4N1UA 5CFJA 1Q54A 3O52A 5IW4A 5GHPA 3GZ5A 2I6KA 1K26A 2DSDA 1TUMA 2QJOA 3FFUA 5FSIA 2KDWA 5BONA 3GZ6A 3MGMA 1G9QA 1V8RA 3O6ZA 3A6UA 3EXQA 2GB5A 4YOQA 2ICKA 2FVVA 3A6VA 1Q27A 2Q9PA 2QJTA 1RRQA 1GA7A 1V8SA 2G73A 3FJYA 4JZSA 3O8SA 2XSQA 4J7GA 2YVMA 3KVHA 4NFXA 2CL3A 1MQEA 3I7VA 1VIUA 3L85A 2B0VA 3F13A 3X0RA 5CFIA 1KTGA 4S2VA 1Q33A 2FMLA 5IW5A 2PNYA 3EESA 4KTBA 3I9XA 1MK1A 1QVJA 3Q2SA 5GHNA 1NQYA 2O5WA 3H95A 3MCFA 3X0OA 1VRLA 5FSOA 3WHWA 3FK9A 3FSPA 2I8UA 3CNGA 1PPWA 2YVPA 5GHJA 2A6TA 5ANVA 5FSMA 1XSAA 1SZ3A 1MP2A 3U53A 1X83A 1XSCA 4HVYA 5FSNA 3X0LA 4YPHA 1MR2A 3E57A 3EEUA 3GG6A 3N77A 1V8WA 5C8LA 4MPOA 3X0SA 3Q93A 5FSLA 1V8NA 2O5FA 3X0NA 1PUNA 4ILQA 4KG4A 3ID9A 4NFWA 1KHZA 1KT9A 2YVNA 3P6YA 2VNQA 1K2EA 4IJXA 2DUKA 1OW2A 3G0QA 3A6SA 2YYHA 1MUTA 4J7HA 1HZTA 4JZUA 4YPRA 1PPVA 3I7UA 1VK6A 3SHDA 1HX3A 2VNPA 3Q4IA 1R67A 5C7TA 1VHZA 3X0PA 3ZR0A 3SONA 3ACAA 1V8YA 3GWYA 4C9WA 4K6EA 3J7Ye 3F6AA
chains in the Genus database with same CATH topology
3BAPA 2ICJA 3A6TA 2RRKA 1VC8A 1PPXA 2QKMB 3OGAA 2GT4A 3Q1PA 5DEQA 3X0MA 2O1CA 5I8UA 2A8RA 2A8PA 2YVOA 5ANUA 5ANTA 2DHOA 1SJYA 1I9AA 3COUA 3R03A 4JZTA 1JRKA 1NFSA 2R5WA 1SU2A 1V8UA 2G74A 5BS6A 4JZVA 4DYWA 2A8SA 2A8QA 3P5TA 2PQVA 3O61A 3X0QA 3O69A 3AC9A 3GZ8A 3Q91A 1U20A 3X0KA 4ZG0A 5ISYA 3QSJA 1G0SA 2KDVA 5LPGA 1JKNA 3EF5A 4HFQA 2A8TA 5FSKA 3RH7A 5HZXA 3FCMA 2FKBA 1NQZA 1VCDA 1VIQA 2B2KA 1MQWA 5GHQA 5DPKA 3BHOA 2B06A 4ICKA 5ANSA 4V14A 1F3YA 4N1TA 3HHJA 1IRYA 2DSCA 3DUPA 1VC9A 5ANWA 1NFZA 4KG3A 5GHOA 1V8LA 5GHMA 2DSBA 3HYQA 3X0JA 1PUSA 2CZRA 2I8TA 2GT2A 3BM4A 1PVFA 3X0IA 3SMDA 1V8TA 1VHGA 3GRNA 4KYXA 5GHIA 3ZR1A 3Q2TA 1PUQA 1SOIA 1RRSA 5DDGA 4S2XA 1X51A 4S2YA 4S2WA 2J8QA 2JVBA 2W4EA 3MDIA 3MDGA 1RYAA 1XSBA 4C9XA 1X84A 1V8MA 3DKUA 1V8VA 3N9UA 5DD4A 2AZWA 1V8IA 5C7QA 4N1UA 5CFJA 1Q54A 3O52A 5IW4A 5GHPA 3GZ5A 2I6KA 1K26A 2DSDA 1TUMA 2QJOA 3FFUA 5FSIA 2KDWA 5BONA 3GZ6A 3MGMA 1G9QA 1V8RA 3O6ZA 3A6UA 3EXQA 2GB5A 4YOQA 2ICKA 2FVVA 3A6VA 1Q27A 2Q9PA 2QJTA 1RRQA 1GA7A 1V8SA 2G73A 3FJYA 4JZSA 3O8SA 2XSQA 4J7GA 2YVMA 3KVHA 4NFXA 2CL3A 1MQEA 3I7VA 1VIUA 3L85A 2B0VA 3F13A 3X0RA 5CFIA 1KTGA 4S2VA 1Q33A 2FMLA 5IW5A 2PNYA 3EESA 4KTBA 3I9XA 1MK1A 1QVJA 3Q2SA 5GHNA 1NQYA 2O5WA 3H95A 3MCFA 3X0OA 1VRLA 5FSOA 3WHWA 3FK9A 3FSPA 2I8UA 3CNGA 1PPWA 2YVPA 5GHJA 2A6TA 5ANVA 5FSMA 1XSAA 1SZ3A 1MP2A 3U53A 1X83A 1XSCA 4HVYA 5FSNA 3X0LA 4YPHA 1MR2A 3E57A 3EEUA 3GG6A 3N77A 1V8WA 5C8LA 4MPOA 3X0SA 3Q93A 5FSLA 1V8NA 2O5FA 3X0NA 1PUNA 4ILQA 4KG4A 3ID9A 4NFWA 1KHZA 1KT9A 2YVNA 3P6YA 2VNQA 1K2EA 4IJXA 2DUKA 1OW2A 3G0QA 3A6SA 2YYHA 1MUTA 4J7HA 1HZTA 4JZUA 4YPRA 1PPVA 3I7UA 1VK6A 3SHDA 1HX3A 2VNPA 3Q4IA 1R67A 5C7TA 1VHZA 3X0PA 3ZR0A 3SONA 3ACAA 1V8YA 3GWYA 4C9WA 4K6EA 3J7Ye 3F6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BAP A;  2ICJ A;  3A6T A;  2RRK A;  1VC8 A;  1PPX A;  2QKM B;  3OGA A;  2GT4 A;  3Q1P A;  5DEQ A;  3X0M A;  2O1C A;  5I8U A;  2A8R A;  2A8P A;  2YVO A;  5ANU A;  5ANT A;  2DHO A;  1SJY A;  1I9A A;  3COU A;  3R03 A;  4JZT A;  1JRK A;  1NFS A;  2R5W A;  1SU2 A;  1V8U A;  2G74 A;  5BS6 A;  4JZV A;  4DYW A;  2A8S A;  2A8Q A;  3P5T A;  2PQV A;  3O61 A;  3X0Q A;  3O69 A;  3AC9 A;  3GZ8 A;  3Q91 A;  1U20 A;  3X0K A;  4ZG0 A;  5ISY A;  3QSJ A;  1G0S A;  2KDV A;  5LPG A;  1JKN A;  3EF5 A;  4HFQ A;  2A8T A;  5FSK A;  3RH7 A;  5HZX A;  3FCM A;  2FKB A;  1NQZ A;  1VCD A;  1VIQ A;  2B2K A;  1MQW A;  5GHQ A;  5DPK A;  3BHO A;  2B06 A;  4ICK A;  5ANS A;  4V14 A;  1F3Y A;  4N1T A;  3HHJ A;  1IRY A;  2DSC A;  3DUP A;  1VC9 A;  5ANW A;  1NFZ A;  4KG3 A;  5GHO A;  1V8L A;  5GHM A;  2DSB A;  3HYQ A;  3X0J A;  1PUS A;  2I8T A;  2GT2 A;  3BM4 A;  1PVF A;  3X0I A;  3SMD A;  1V8T A;  1VHG A;  3GRN A;  4KYX A;  5GHI A;  3ZR1 A;  3Q2T A;  1PUQ A;  1SOI A;  1RRS A;  5DDG A;  4S2X A;  1X51 A;  4S2Y A;  4S2W A;  2J8Q A;  2JVB A;  2W4E A;  3MDI A;  3MDG A;  1RYA A;  1XSB A;  4C9X A;  1X84 A;  1V8M A;  3DKU A;  1V8V A;  3N9U A;  5DD4 A;  2AZW A;  1V8I A;  5C7Q A;  4N1U A;  5CFJ A;  1Q54 A;  3O52 A;  5IW4 A;  5GHP A;  3GZ5 A;  2I6K A;  1K26 A;  2DSD A;  1TUM A;  2QJO A;  3FFU A;  5FSI A;  2KDW A;  5BON A;  3GZ6 A;  3MGM A;  1G9Q A;  1V8R A;  3O6Z A;  3A6U A;  3EXQ A;  2GB5 A;  4YOQ A;  2ICK A;  2FVV A;  3A6V A;  1Q27 A;  2Q9P A;  2QJT A;  1RRQ A;  1GA7 A;  1V8S A;  2G73 A;  3FJY A;  4JZS A;  3O8S A;  2XSQ A;  2YVM A;  3KVH A;  4NFX A;  2CL3 A;  1MQE A;  3I7V A;  1VIU A;  3L85 A;  2B0V A;  3F13 A;  3X0R A;  5CFI A;  1KTG A;  4S2V A;  1Q33 A;  2FML A;  5IW5 A;  2PNY A;  3EES A;  4KTB A;  3I9X A;  1MK1 A;  1QVJ A;  3Q2S A;  5GHN A;  1NQY A;  2O5W A;  3H95 A;  3MCF A;  3X0O A;  1VRL A;  5FSO A;  3WHW A;  3FK9 A;  3FSP A;  2I8U A;  3CNG A;  1PPW A;  2YVP A;  5GHJ A;  2A6T A;  5ANV A;  5FSM A;  1XSA A;  1SZ3 A;  1MP2 A;  3U53 A;  1X83 A;  1XSC A;  4HVY A;  5FSN A;  3X0L A;  4YPH A;  1MR2 A;  3E57 A;  3EEU A;  3GG6 A;  3N77 A;  1V8W A;  5C8L A;  4MPO A;  3X0S A;  3Q93 A;  5FSL A;  1V8N A;  2O5F A;  3X0N A;  1PUN A;  4ILQ A;  4KG4 A;  3ID9 A;  4NFW A;  1KHZ A;  1KT9 A;  2YVN A;  3P6Y A;  2VNQ A;  1K2E A;  4IJX A;  2DUK A;  1OW2 A;  3G0Q A;  3A6S A;  2YYH A;  1MUT A;  1HZT A;  4JZU A;  4YPR A;  1PPV A;  3I7U A;  1VK6 A;  3SHD A;  1HX3 A;  2VNP A;  3Q4I A;  1R67 A;  5C7T A;  1VHZ A;  3X0P A;  3ZR0 A;  3SON A;  3ACA A;  1V8Y A;  3GWY A;  4C9W A;  4K6E A;  3J7Y e;  3F6A A; 
#chains in the Genus database with same CATH topology
 3BAP A;  2ICJ A;  3A6T A;  2RRK A;  1VC8 A;  1PPX A;  2QKM B;  3OGA A;  2GT4 A;  3Q1P A;  5DEQ A;  3X0M A;  2O1C A;  5I8U A;  2A8R A;  2A8P A;  2YVO A;  5ANU A;  5ANT A;  2DHO A;  1SJY A;  1I9A A;  3COU A;  3R03 A;  4JZT A;  1JRK A;  1NFS A;  2R5W A;  1SU2 A;  1V8U A;  2G74 A;  5BS6 A;  4JZV A;  4DYW A;  2A8S A;  2A8Q A;  3P5T A;  2PQV A;  3O61 A;  3X0Q A;  3O69 A;  3AC9 A;  3GZ8 A;  3Q91 A;  1U20 A;  3X0K A;  4ZG0 A;  5ISY A;  3QSJ A;  1G0S A;  2KDV A;  5LPG A;  1JKN A;  3EF5 A;  4HFQ A;  2A8T A;  5FSK A;  3RH7 A;  5HZX A;  3FCM A;  2FKB A;  1NQZ A;  1VCD A;  1VIQ A;  2B2K A;  1MQW A;  5GHQ A;  5DPK A;  3BHO A;  2B06 A;  4ICK A;  5ANS A;  4V14 A;  1F3Y A;  4N1T A;  3HHJ A;  1IRY A;  2DSC A;  3DUP A;  1VC9 A;  5ANW A;  1NFZ A;  4KG3 A;  5GHO A;  1V8L A;  5GHM A;  2DSB A;  3HYQ A;  3X0J A;  1PUS A;  2CZR A;  2I8T A;  2GT2 A;  3BM4 A;  1PVF A;  3X0I A;  3SMD A;  1V8T A;  1VHG A;  3GRN A;  4KYX A;  5GHI A;  3ZR1 A;  3Q2T A;  1PUQ A;  1SOI A;  1RRS A;  5DDG A;  4S2X A;  1X51 A;  4S2Y A;  4S2W A;  2J8Q A;  2JVB A;  2W4E A;  3MDI A;  3MDG A;  1RYA A;  1XSB A;  4C9X A;  1X84 A;  1V8M A;  3DKU A;  1V8V A;  3N9U A;  5DD4 A;  2AZW A;  1V8I A;  5C7Q A;  4N1U A;  5CFJ A;  1Q54 A;  3O52 A;  5IW4 A;  5GHP A;  3GZ5 A;  2I6K A;  1K26 A;  2DSD A;  1TUM A;  2QJO A;  3FFU A;  5FSI A;  2KDW A;  5BON A;  3GZ6 A;  3MGM A;  1G9Q A;  1V8R A;  3O6Z A;  3A6U A;  3EXQ A;  2GB5 A;  4YOQ A;  2ICK A;  2FVV A;  3A6V A;  1Q27 A;  2Q9P A;  2QJT A;  1RRQ A;  1GA7 A;  1V8S A;  2G73 A;  3FJY A;  4JZS A;  3O8S A;  2XSQ A;  4J7G A;  2YVM A;  3KVH A;  4NFX A;  2CL3 A;  1MQE A;  3I7V A;  1VIU A;  3L85 A;  2B0V A;  3F13 A;  3X0R A;  5CFI A;  1KTG A;  4S2V A;  1Q33 A;  2FML A;  5IW5 A;  2PNY A;  3EES A;  4KTB A;  3I9X A;  1MK1 A;  1QVJ A;  3Q2S A;  5GHN A;  1NQY A;  2O5W A;  3H95 A;  3MCF A;  3X0O A;  1VRL A;  5FSO A;  3WHW A;  3FK9 A;  3FSP A;  2I8U A;  3CNG A;  1PPW A;  2YVP A;  5GHJ A;  2A6T A;  5ANV A;  5FSM A;  1XSA A;  1SZ3 A;  1MP2 A;  3U53 A;  1X83 A;  1XSC A;  4HVY A;  5FSN A;  3X0L A;  4YPH A;  1MR2 A;  3E57 A;  3EEU A;  3GG6 A;  3N77 A;  1V8W A;  5C8L A;  4MPO A;  3X0S A;  3Q93 A;  5FSL A;  1V8N A;  2O5F A;  3X0N A;  1PUN A;  4ILQ A;  4KG4 A;  3ID9 A;  4NFW A;  1KHZ A;  1KT9 A;  2YVN A;  3P6Y A;  2VNQ A;  1K2E A;  4IJX A;  2DUK A;  1OW2 A;  3G0Q A;  3A6S A;  2YYH A;  1MUT A;  4J7H A;  1HZT A;  4JZU A;  4YPR A;  1PPV A;  3I7U A;  1VK6 A;  3SHD A;  1HX3 A;  2VNP A;  3Q4I A;  1R67 A;  5C7T A;  1VHZ A;  3X0P A;  3ZR0 A;  3SON A;  3ACA A;  1V8Y A;  3GWY A;  4C9W A;  4K6E A;  3J7Y e;  3F6A A; 
#chains in the Genus database with same CATH homology
 3BAP A;  2ICJ A;  3A6T A;  2RRK A;  1VC8 A;  1PPX A;  2QKM B;  3OGA A;  2GT4 A;  3Q1P A;  5DEQ A;  3X0M A;  2O1C A;  5I8U A;  2A8R A;  2A8P A;  2YVO A;  5ANU A;  5ANT A;  2DHO A;  1SJY A;  1I9A A;  3COU A;  3R03 A;  4JZT A;  1JRK A;  1NFS A;  2R5W A;  1SU2 A;  1V8U A;  2G74 A;  5BS6 A;  4JZV A;  4DYW A;  2A8S A;  2A8Q A;  3P5T A;  2PQV A;  3O61 A;  3X0Q A;  3O69 A;  3AC9 A;  3GZ8 A;  3Q91 A;  1U20 A;  3X0K A;  4ZG0 A;  5ISY A;  3QSJ A;  1G0S A;  2KDV A;  5LPG A;  1JKN A;  3EF5 A;  4HFQ A;  2A8T A;  5FSK A;  3RH7 A;  5HZX A;  3FCM A;  2FKB A;  1NQZ A;  1VCD A;  1VIQ A;  2B2K A;  1MQW A;  5GHQ A;  5DPK A;  3BHO A;  2B06 A;  4ICK A;  5ANS A;  4V14 A;  1F3Y A;  4N1T A;  3HHJ A;  1IRY A;  2DSC A;  3DUP A;  1VC9 A;  5ANW A;  1NFZ A;  4KG3 A;  5GHO A;  1V8L A;  5GHM A;  2DSB A;  3HYQ A;  3X0J A;  1PUS A;  2CZR A;  2I8T A;  2GT2 A;  3BM4 A;  1PVF A;  3X0I A;  3SMD A;  1V8T A;  1VHG A;  3GRN A;  4KYX A;  5GHI A;  3ZR1 A;  3Q2T A;  1PUQ A;  1SOI A;  1RRS A;  5DDG A;  4S2X A;  1X51 A;  4S2Y A;  4S2W A;  2J8Q A;  2JVB A;  2W4E A;  3MDI A;  3MDG A;  1RYA A;  1XSB A;  4C9X A;  1X84 A;  1V8M A;  3DKU A;  1V8V A;  3N9U A;  5DD4 A;  2AZW A;  1V8I A;  5C7Q A;  4N1U A;  5CFJ A;  1Q54 A;  3O52 A;  5IW4 A;  5GHP A;  3GZ5 A;  2I6K A;  1K26 A;  2DSD A;  1TUM A;  2QJO A;  3FFU A;  5FSI A;  2KDW A;  5BON A;  3GZ6 A;  3MGM A;  1G9Q A;  1V8R A;  3O6Z A;  3A6U A;  3EXQ A;  2GB5 A;  4YOQ A;  2ICK A;  2FVV A;  3A6V A;  1Q27 A;  2Q9P A;  2QJT A;  1RRQ A;  1GA7 A;  1V8S A;  2G73 A;  3FJY A;  4JZS A;  3O8S A;  2XSQ A;  4J7G A;  2YVM A;  3KVH A;  4NFX A;  2CL3 A;  1MQE A;  3I7V A;  1VIU A;  3L85 A;  2B0V A;  3F13 A;  3X0R A;  5CFI A;  1KTG A;  4S2V A;  1Q33 A;  2FML A;  5IW5 A;  2PNY A;  3EES A;  4KTB A;  3I9X A;  1MK1 A;  1QVJ A;  3Q2S A;  5GHN A;  1NQY A;  2O5W A;  3H95 A;  3MCF A;  3X0O A;  1VRL A;  5FSO A;  3WHW A;  3FK9 A;  3FSP A;  2I8U A;  3CNG A;  1PPW A;  2YVP A;  5GHJ A;  2A6T A;  5ANV A;  5FSM A;  1XSA A;  1SZ3 A;  1MP2 A;  3U53 A;  1X83 A;  1XSC A;  4HVY A;  5FSN A;  3X0L A;  4YPH A;  1MR2 A;  3E57 A;  3EEU A;  3GG6 A;  3N77 A;  1V8W A;  5C8L A;  4MPO A;  3X0S A;  3Q93 A;  5FSL A;  1V8N A;  2O5F A;  3X0N A;  1PUN A;  4ILQ A;  4KG4 A;  3ID9 A;  4NFW A;  1KHZ A;  1KT9 A;  2YVN A;  3P6Y A;  2VNQ A;  1K2E A;  4IJX A;  2DUK A;  1OW2 A;  3G0Q A;  3A6S A;  2YYH A;  1MUT A;  4J7H A;  1HZT A;  4JZU A;  4YPR A;  1PPV A;  3I7U A;  1VK6 A;  3SHD A;  1HX3 A;  2VNP A;  3Q4I A;  1R67 A;  5C7T A;  1VHZ A;  3X0P A;  3ZR0 A;  3SON A;  3ACA A;  1V8Y A;  3GWY A;  4C9W A;  4K6E A;  3J7Y e;  3F6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...