1MP2A

Structure of mt-adprase (apoenzyme), a nudix hydrolase from mycobacterium tuberculosis
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
202
structure length
187
Chain Sequence
FETISSETLHTGAIFALRRDQVRIVTREVVEHFGAVAIVAMDDNGNIPMVYQYRHTYGRRLWELPAGLLDVAGEPPHLTAARELREEVGLQASTWQVLVDLDTAPGFSDESVRVYLATGLREVGRTMGWYPIAEAARRVLRGEIVNSIAIAGVLAVHAVTTGFAQPRPLDTEWIDRPTAFAARRAER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ADPR pyrophosphatase
publication title Structure and mechanism of MT-ADPRase, a Nudix hydrolase from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 45
structure length 187
sequence length 202
ec nomenclature ec 3.6.1.13: ADP-ribose diphosphatase.
pdb deposition date 2002-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1mp2A00
3Q91A 3X0MA 5CFIA 4C9XA 1PUSA 2G74A 3O8SA 2DSCA 2W4EA 3FK9A 1V8TA 2DSBA 3R03A 3U53A 5DDGA 1RRSA 2QKMB 1VC9A 3H95A 5FSKA 3GRNA 2GT2A 5FSOA 1VHGA 2A8SA 2PNYA 5CFJA 2I6KA 2GB5A 1V8RA 2Q9PA 5FSLA 3CNGA 3O52A 1NFSA 3A6UA 5ANVA 2XSQA 5ANWA 1MR2A 2A8QA 3GWYA 5ANTA 5FSNA 4IJXA 4C9WA 3G0QA 1SZ3A 2FVVA 1RRQA 1F3YA 1X84A 1KT9A 5DPKA 3I9XA 1GA7A 5ANSA 3DUPA 4JZTA 3FJYA 1V8WA 3WHWA 2O5FA 4ZG0A 1V8YA 2A6TA 3ZR1A 5GHQA 3I7UA 4HFQA 1VC8A 2GT4A 3O61A 5ANUA 2A8PA 3J7Ye 3P6YA 3Q4IA 5FSIA 3BAPA 5GHIA 4HVYA 3F13A 3O6ZA 4S2YA 3N77A 4S2XA 1VCDA 3COUA 2FMLA 3SHDA 1HZTA 1U20A 5C8LA 3DKUA 3N9UA 2AZWA 4YOQA 3BHOA 3GG6A 5GHOA 4S2VA 1NFZA 4KG4A 4ILQA 3X0QA 5DD4A 1JKNA 2J8QA 3X0OA 4V14A 3MGMA 3SONA 2QJOA 4JZVA 3X0NA 1V8NA 1R67A 5GHPA 4JZSA 5C7TA 4ICKA 1XSCA 2YYHA 1SJYA 2A8TA 5FSMA 1V8UA 5LPGA 1K2EA 3EXQA 3RH7A 3MDIA 1NQYA 3Q2SA 5BS6A 5C7QA 3Q93A 1MQWA 1PUQA 2I8UA 1Q27A 3GZ8A 4KTBA 2A8RA 4KYXA 2JVBA 2VNPA 4YPRA 3X0PA 2PQVA 1NQZA 1V8IA 4S2WA 3EF5A 3ZR0A 2I8TA 3GZ5A 2R5WA 1KHZA 1PVFA 1PPXA 1VIQA 5I8UA 2DUKA 3FCMA 2QJTA 2KDVA 3X0RA 1K26A 1G0SA 3BM4A 3EESA 3HYQA 1X51A 4JZUA 1X83A 2B2KA 1MUTA 2O5WA 3A6VA 5GHNA 2G73A 3EEUA 1PPWA 1VIUA 3F6AA 3X0LA 1SOIA 3AC9A 5ISYA 4NFXA 3E57A 5DEQA 2CL3A 2ICJA 2KDWA 1Q54A 5GHJA 1Q33A 4KG3A 3GZ6A 1VHZA 2VNQA 4N1UA 3FSPA 2DSDA 2YVOA 3L85A 4N1TA 3MCFA 1QVJA 4MPOA 1V8LA 1XSAA 2ICKA 3Q2TA 3X0KA 2FKBA 4NFWA 5IW5A 2B0VA 1G9QA 3ACAA 3X0SA 1V8MA 2B06A 3X0IA 1OW2A 1SU2A 3Q1PA 1MQEA 2YVPA 1PUNA 3X0JA 1TUMA 3A6SA 2DHOA 3I7VA 3A6TA 1XSBA 1VRLA 3KVHA 2YVNA 1V8VA 1KTGA 1JRKA 3O69A 4K6EA 5BONA 1VK6A 5GHMA 5HZXA 1I9AA 1MK1A 3ID9A 1HX3A 2RRKA 3P5TA 3FFUA 3SMDA 4YPHA 1RYAA 1MP2A 5IW4A 1PPVA 2YVMA 1V8SA 3MDGA 3HHJA 2O1CA 3OGAA 1IRYA 4DYWA 3QSJA
chains in the Genus database with same CATH superfamily
3Q91A 3X0MA 5CFIA 4C9XA 1PUSA 2G74A 3O8SA 2DSCA 2W4EA 3FK9A 1V8TA 2DSBA 3R03A 3U53A 5DDGA 1RRSA 2QKMB 1VC9A 3H95A 5FSKA 3GRNA 2GT2A 5FSOA 1VHGA 2A8SA 2PNYA 5CFJA 2I6KA 2GB5A 1V8RA 2Q9PA 5FSLA 3CNGA 3O52A 1NFSA 3A6UA 5ANVA 2XSQA 5ANWA 1MR2A 2A8QA 3GWYA 5ANTA 2CZRA 4IJXA 5FSNA 4C9WA 1SZ3A 2FVVA 3G0QA 1RRQA 1X84A 1F3YA 1KT9A 5DPKA 3I9XA 1GA7A 5ANSA 3DUPA 4JZTA 3FJYA 1V8WA 3WHWA 2O5FA 4ZG0A 1V8YA 2A6TA 3ZR1A 5GHQA 3I7UA 4HFQA 1VC8A 2GT4A 3O61A 5ANUA 2A8PA 3J7Ye 3P6YA 3Q4IA 5FSIA 3BAPA 5GHIA 4HVYA 3F13A 3O6ZA 4S2YA 3N77A 4S2XA 1VCDA 3COUA 2FMLA 3SHDA 1HZTA 1U20A 5C8LA 3DKUA 3N9UA 2AZWA 4YOQA 3BHOA 3GG6A 5GHOA 4S2VA 1NFZA 4KG4A 4ILQA 3X0QA 5DD4A 1JKNA 2J8QA 3X0OA 4V14A 3MGMA 3SONA 2QJOA 4JZVA 3X0NA 1V8NA 1R67A 5GHPA 4JZSA 5C7TA 4ICKA 1XSCA 2YYHA 1SJYA 2A8TA 5FSMA 1V8UA 5LPGA 1K2EA 3EXQA 3RH7A 3MDIA 1NQYA 3Q2SA 5BS6A 5C7QA 3Q93A 1MQWA 1PUQA 2I8UA 1Q27A 3GZ8A 4KTBA 2A8RA 4KYXA 2JVBA 2VNPA 4YPRA 3X0PA 2PQVA 1NQZA 1V8IA 4S2WA 3EF5A 3ZR0A 2I8TA 3GZ5A 2R5WA 1KHZA 1PVFA 1PPXA 1VIQA 5I8UA 2DUKA 3FCMA 2QJTA 2KDVA 3X0RA 1K26A 1G0SA 3BM4A 3EESA 3HYQA 1X51A 4JZUA 1X83A 2B2KA 1MUTA 2O5WA 3A6VA 4J7HA 2G73A 3EEUA 1PPWA 1VIUA 3F6AA 5GHNA 3X0LA 1SOIA 3AC9A 5ISYA 4NFXA 3E57A 5DEQA 2CL3A 2ICJA 2KDWA 1Q54A 5GHJA 1Q33A 4KG3A 3GZ6A 1VHZA 2VNQA 4N1UA 3FSPA 2DSDA 2YVOA 3L85A 4J7GA 3MCFA 4N1TA 1QVJA 4MPOA 1V8LA 1XSAA 2ICKA 3Q2TA 3X0KA 2FKBA 4NFWA 5IW5A 2B0VA 1G9QA 3ACAA 3X0SA 1V8MA 2B06A 3X0IA 1OW2A 1SU2A 3Q1PA 1MQEA 2YVPA 1PUNA 3X0JA 1TUMA 3A6SA 2DHOA 3I7VA 3A6TA 1XSBA 1VRLA 3KVHA 2YVNA 1V8VA 1KTGA 1JRKA 3O69A 4K6EA 5BONA 1VK6A 5GHMA 5HZXA 1I9AA 1MK1A 3ID9A 1HX3A 2RRKA 3P5TA 3FFUA 3SMDA 4YPHA 1RYAA 1MP2A 5IW4A 1PPVA 2YVMA 1V8SA 3MDGA 3HHJA 2O1CA 3OGAA 1IRYA 4DYWA 3QSJA
chains in the Genus database with same CATH topology
3Q91A 3X0MA 5CFIA 4C9XA 1PUSA 2G74A 3O8SA 2DSCA 2W4EA 3FK9A 1V8TA 2DSBA 3R03A 3U53A 5DDGA 1RRSA 2QKMB 1VC9A 3H95A 5FSKA 3GRNA 2GT2A 5FSOA 1VHGA 2A8SA 2PNYA 5CFJA 2I6KA 2GB5A 1V8RA 2Q9PA 5FSLA 3CNGA 3O52A 1NFSA 3A6UA 5ANVA 2XSQA 5ANWA 1MR2A 2A8QA 3GWYA 5ANTA 2CZRA 4IJXA 5FSNA 4C9WA 1SZ3A 2FVVA 3G0QA 1RRQA 1X84A 1F3YA 1KT9A 5DPKA 3I9XA 1GA7A 5ANSA 3DUPA 4JZTA 3FJYA 1V8WA 3WHWA 2O5FA 4ZG0A 1V8YA 2A6TA 3ZR1A 5GHQA 3I7UA 4HFQA 1VC8A 2GT4A 3O61A 5ANUA 2A8PA 3J7Ye 3P6YA 3Q4IA 5FSIA 3BAPA 5GHIA 4HVYA 3F13A 3O6ZA 4S2YA 3N77A 4S2XA 1VCDA 3COUA 2FMLA 3SHDA 1HZTA 1U20A 5C8LA 3DKUA 3N9UA 2AZWA 4YOQA 3BHOA 3GG6A 5GHOA 4S2VA 1NFZA 4KG4A 4ILQA 3X0QA 5DD4A 1JKNA 2J8QA 3X0OA 4V14A 3MGMA 3SONA 2QJOA 4JZVA 3X0NA 1V8NA 1R67A 5GHPA 4JZSA 5C7TA 4ICKA 1XSCA 2YYHA 1SJYA 2A8TA 5FSMA 1V8UA 5LPGA 1K2EA 3EXQA 3RH7A 3MDIA 1NQYA 3Q2SA 5BS6A 5C7QA 3Q93A 1MQWA 1PUQA 2I8UA 1Q27A 3GZ8A 4KTBA 2A8RA 4KYXA 2JVBA 2VNPA 4YPRA 3X0PA 2PQVA 1NQZA 1V8IA 4S2WA 3EF5A 3ZR0A 2I8TA 3GZ5A 2R5WA 1KHZA 1PVFA 1PPXA 1VIQA 5I8UA 2DUKA 3FCMA 2QJTA 2KDVA 3X0RA 1K26A 1G0SA 3BM4A 3EESA 3HYQA 1X51A 4JZUA 1X83A 2B2KA 1MUTA 2O5WA 3A6VA 4J7HA 2G73A 3EEUA 1PPWA 1VIUA 3F6AA 5GHNA 3X0LA 1SOIA 3AC9A 5ISYA 4NFXA 3E57A 5DEQA 2CL3A 2ICJA 2KDWA 1Q54A 5GHJA 1Q33A 4KG3A 3GZ6A 1VHZA 2VNQA 4N1UA 3FSPA 2DSDA 2YVOA 3L85A 4J7GA 3MCFA 4N1TA 1QVJA 4MPOA 1V8LA 1XSAA 2ICKA 3Q2TA 3X0KA 2FKBA 4NFWA 5IW5A 2B0VA 1G9QA 3ACAA 3X0SA 1V8MA 2B06A 3X0IA 1OW2A 1SU2A 3Q1PA 1MQEA 2YVPA 1PUNA 3X0JA 1TUMA 3A6SA 2DHOA 3I7VA 3A6TA 1XSBA 1VRLA 3KVHA 2YVNA 1V8VA 1KTGA 1JRKA 3O69A 4K6EA 5BONA 1VK6A 5GHMA 5HZXA 1I9AA 1MK1A 3ID9A 1HX3A 2RRKA 3P5TA 3FFUA 3SMDA 4YPHA 1RYAA 1MP2A 5IW4A 1PPVA 2YVMA 1V8SA 3MDGA 3HHJA 2O1CA 3OGAA 1IRYA 4DYWA 3QSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q91 A;  3X0M A;  5CFI A;  4C9X A;  1PUS A;  2G74 A;  3O8S A;  2DSC A;  2W4E A;  3FK9 A;  1V8T A;  2DSB A;  3R03 A;  3U53 A;  5DDG A;  1RRS A;  2QKM B;  1VC9 A;  3H95 A;  5FSK A;  3GRN A;  2GT2 A;  5FSO A;  1VHG A;  2A8S A;  2PNY A;  5CFJ A;  2I6K A;  2GB5 A;  1V8R A;  2Q9P A;  5FSL A;  3CNG A;  3O52 A;  1NFS A;  3A6U A;  5ANV A;  2XSQ A;  5ANW A;  1MR2 A;  2A8Q A;  3GWY A;  5ANT A;  5FSN A;  4IJX A;  4C9W A;  3G0Q A;  1SZ3 A;  2FVV A;  1RRQ A;  1F3Y A;  1X84 A;  1KT9 A;  5DPK A;  3I9X A;  1GA7 A;  5ANS A;  3DUP A;  4JZT A;  3FJY A;  1V8W A;  3WHW A;  2O5F A;  4ZG0 A;  1V8Y A;  2A6T A;  3ZR1 A;  5GHQ A;  3I7U A;  4HFQ A;  1VC8 A;  2GT4 A;  3O61 A;  5ANU A;  2A8P A;  3J7Y e;  3P6Y A;  3Q4I A;  5FSI A;  3BAP A;  5GHI A;  4HVY A;  3F13 A;  3O6Z A;  4S2Y A;  3N77 A;  4S2X A;  1VCD A;  3COU A;  2FML A;  3SHD A;  1HZT A;  1U20 A;  5C8L A;  3DKU A;  3N9U A;  2AZW A;  4YOQ A;  3BHO A;  3GG6 A;  5GHO A;  4S2V A;  1NFZ A;  4KG4 A;  4ILQ A;  3X0Q A;  5DD4 A;  1JKN A;  2J8Q A;  3X0O A;  4V14 A;  3MGM A;  3SON A;  2QJO A;  4JZV A;  3X0N A;  1V8N A;  1R67 A;  5GHP A;  4JZS A;  5C7T A;  4ICK A;  1XSC A;  2YYH A;  1SJY A;  2A8T A;  5FSM A;  1V8U A;  5LPG A;  1K2E A;  3EXQ A;  3RH7 A;  3MDI A;  1NQY A;  3Q2S A;  5BS6 A;  5C7Q A;  3Q93 A;  1MQW A;  1PUQ A;  2I8U A;  1Q27 A;  3GZ8 A;  4KTB A;  2A8R A;  4KYX A;  2JVB A;  2VNP A;  4YPR A;  3X0P A;  2PQV A;  1NQZ A;  1V8I A;  4S2W A;  3EF5 A;  3ZR0 A;  2I8T A;  3GZ5 A;  2R5W A;  1KHZ A;  1PVF A;  1PPX A;  1VIQ A;  5I8U A;  2DUK A;  3FCM A;  2QJT A;  2KDV A;  3X0R A;  1K26 A;  1G0S A;  3BM4 A;  3EES A;  3HYQ A;  1X51 A;  4JZU A;  1X83 A;  2B2K A;  1MUT A;  2O5W A;  3A6V A;  5GHN A;  2G73 A;  3EEU A;  1PPW A;  1VIU A;  3F6A A;  3X0L A;  1SOI A;  3AC9 A;  5ISY A;  4NFX A;  3E57 A;  5DEQ A;  2CL3 A;  2ICJ A;  2KDW A;  1Q54 A;  5GHJ A;  1Q33 A;  4KG3 A;  3GZ6 A;  1VHZ A;  2VNQ A;  4N1U A;  3FSP A;  2DSD A;  2YVO A;  3L85 A;  4N1T A;  3MCF A;  1QVJ A;  4MPO A;  1V8L A;  1XSA A;  2ICK A;  3Q2T A;  3X0K A;  2FKB A;  4NFW A;  5IW5 A;  2B0V A;  1G9Q A;  3ACA A;  3X0S A;  1V8M A;  2B06 A;  3X0I A;  1OW2 A;  1SU2 A;  3Q1P A;  1MQE A;  2YVP A;  1PUN A;  3X0J A;  1TUM A;  3A6S A;  2DHO A;  3I7V A;  3A6T A;  1XSB A;  1VRL A;  3KVH A;  2YVN A;  1V8V A;  1KTG A;  1JRK A;  3O69 A;  4K6E A;  5BON A;  1VK6 A;  5GHM A;  5HZX A;  1I9A A;  1MK1 A;  3ID9 A;  1HX3 A;  2RRK A;  3P5T A;  3FFU A;  3SMD A;  4YPH A;  1RYA A;  1MP2 A;  5IW4 A;  1PPV A;  2YVM A;  1V8S A;  3MDG A;  3HHJ A;  2O1C A;  3OGA A;  1IRY A;  4DYW A;  3QSJ A; 
#chains in the Genus database with same CATH topology
 3Q91 A;  3X0M A;  5CFI A;  4C9X A;  1PUS A;  2G74 A;  3O8S A;  2DSC A;  2W4E A;  3FK9 A;  1V8T A;  2DSB A;  3R03 A;  3U53 A;  5DDG A;  1RRS A;  2QKM B;  1VC9 A;  3H95 A;  5FSK A;  3GRN A;  2GT2 A;  5FSO A;  1VHG A;  2A8S A;  2PNY A;  5CFJ A;  2I6K A;  2GB5 A;  1V8R A;  2Q9P A;  5FSL A;  3CNG A;  3O52 A;  1NFS A;  3A6U A;  5ANV A;  2XSQ A;  5ANW A;  1MR2 A;  2A8Q A;  3GWY A;  5ANT A;  2CZR A;  4IJX A;  5FSN A;  4C9W A;  1SZ3 A;  2FVV A;  3G0Q A;  1RRQ A;  1X84 A;  1F3Y A;  1KT9 A;  5DPK A;  3I9X A;  1GA7 A;  5ANS A;  3DUP A;  4JZT A;  3FJY A;  1V8W A;  3WHW A;  2O5F A;  4ZG0 A;  1V8Y A;  2A6T A;  3ZR1 A;  5GHQ A;  3I7U A;  4HFQ A;  1VC8 A;  2GT4 A;  3O61 A;  5ANU A;  2A8P A;  3J7Y e;  3P6Y A;  3Q4I A;  5FSI A;  3BAP A;  5GHI A;  4HVY A;  3F13 A;  3O6Z A;  4S2Y A;  3N77 A;  4S2X A;  1VCD A;  3COU A;  2FML A;  3SHD A;  1HZT A;  1U20 A;  5C8L A;  3DKU A;  3N9U A;  2AZW A;  4YOQ A;  3BHO A;  3GG6 A;  5GHO A;  4S2V A;  1NFZ A;  4KG4 A;  4ILQ A;  3X0Q A;  5DD4 A;  1JKN A;  2J8Q A;  3X0O A;  4V14 A;  3MGM A;  3SON A;  2QJO A;  4JZV A;  3X0N A;  1V8N A;  1R67 A;  5GHP A;  4JZS A;  5C7T A;  4ICK A;  1XSC A;  2YYH A;  1SJY A;  2A8T A;  5FSM A;  1V8U A;  5LPG A;  1K2E A;  3EXQ A;  3RH7 A;  3MDI A;  1NQY A;  3Q2S A;  5BS6 A;  5C7Q A;  3Q93 A;  1MQW A;  1PUQ A;  2I8U A;  1Q27 A;  3GZ8 A;  4KTB A;  2A8R A;  4KYX A;  2JVB A;  2VNP A;  4YPR A;  3X0P A;  2PQV A;  1NQZ A;  1V8I A;  4S2W A;  3EF5 A;  3ZR0 A;  2I8T A;  3GZ5 A;  2R5W A;  1KHZ A;  1PVF A;  1PPX A;  1VIQ A;  5I8U A;  2DUK A;  3FCM A;  2QJT A;  2KDV A;  3X0R A;  1K26 A;  1G0S A;  3BM4 A;  3EES A;  3HYQ A;  1X51 A;  4JZU A;  1X83 A;  2B2K A;  1MUT A;  2O5W A;  3A6V A;  4J7H A;  2G73 A;  3EEU A;  1PPW A;  1VIU A;  3F6A A;  5GHN A;  3X0L A;  1SOI A;  3AC9 A;  5ISY A;  4NFX A;  3E57 A;  5DEQ A;  2CL3 A;  2ICJ A;  2KDW A;  1Q54 A;  5GHJ A;  1Q33 A;  4KG3 A;  3GZ6 A;  1VHZ A;  2VNQ A;  4N1U A;  3FSP A;  2DSD A;  2YVO A;  3L85 A;  4J7G A;  3MCF A;  4N1T A;  1QVJ A;  4MPO A;  1V8L A;  1XSA A;  2ICK A;  3Q2T A;  3X0K A;  2FKB A;  4NFW A;  5IW5 A;  2B0V A;  1G9Q A;  3ACA A;  3X0S A;  1V8M A;  2B06 A;  3X0I A;  1OW2 A;  1SU2 A;  3Q1P A;  1MQE A;  2YVP A;  1PUN A;  3X0J A;  1TUM A;  3A6S A;  2DHO A;  3I7V A;  3A6T A;  1XSB A;  1VRL A;  3KVH A;  2YVN A;  1V8V A;  1KTG A;  1JRK A;  3O69 A;  4K6E A;  5BON A;  1VK6 A;  5GHM A;  5HZX A;  1I9A A;  1MK1 A;  3ID9 A;  1HX3 A;  2RRK A;  3P5T A;  3FFU A;  3SMD A;  4YPH A;  1RYA A;  1MP2 A;  5IW4 A;  1PPV A;  2YVM A;  1V8S A;  3MDG A;  3HHJ A;  2O1C A;  3OGA A;  1IRY A;  4DYW A;  3QSJ A; 
#chains in the Genus database with same CATH homology
 3Q91 A;  3X0M A;  5CFI A;  4C9X A;  1PUS A;  2G74 A;  3O8S A;  2DSC A;  2W4E A;  3FK9 A;  1V8T A;  2DSB A;  3R03 A;  3U53 A;  5DDG A;  1RRS A;  2QKM B;  1VC9 A;  3H95 A;  5FSK A;  3GRN A;  2GT2 A;  5FSO A;  1VHG A;  2A8S A;  2PNY A;  5CFJ A;  2I6K A;  2GB5 A;  1V8R A;  2Q9P A;  5FSL A;  3CNG A;  3O52 A;  1NFS A;  3A6U A;  5ANV A;  2XSQ A;  5ANW A;  1MR2 A;  2A8Q A;  3GWY A;  5ANT A;  2CZR A;  4IJX A;  5FSN A;  4C9W A;  1SZ3 A;  2FVV A;  3G0Q A;  1RRQ A;  1X84 A;  1F3Y A;  1KT9 A;  5DPK A;  3I9X A;  1GA7 A;  5ANS A;  3DUP A;  4JZT A;  3FJY A;  1V8W A;  3WHW A;  2O5F A;  4ZG0 A;  1V8Y A;  2A6T A;  3ZR1 A;  5GHQ A;  3I7U A;  4HFQ A;  1VC8 A;  2GT4 A;  3O61 A;  5ANU A;  2A8P A;  3J7Y e;  3P6Y A;  3Q4I A;  5FSI A;  3BAP A;  5GHI A;  4HVY A;  3F13 A;  3O6Z A;  4S2Y A;  3N77 A;  4S2X A;  1VCD A;  3COU A;  2FML A;  3SHD A;  1HZT A;  1U20 A;  5C8L A;  3DKU A;  3N9U A;  2AZW A;  4YOQ A;  3BHO A;  3GG6 A;  5GHO A;  4S2V A;  1NFZ A;  4KG4 A;  4ILQ A;  3X0Q A;  5DD4 A;  1JKN A;  2J8Q A;  3X0O A;  4V14 A;  3MGM A;  3SON A;  2QJO A;  4JZV A;  3X0N A;  1V8N A;  1R67 A;  5GHP A;  4JZS A;  5C7T A;  4ICK A;  1XSC A;  2YYH A;  1SJY A;  2A8T A;  5FSM A;  1V8U A;  5LPG A;  1K2E A;  3EXQ A;  3RH7 A;  3MDI A;  1NQY A;  3Q2S A;  5BS6 A;  5C7Q A;  3Q93 A;  1MQW A;  1PUQ A;  2I8U A;  1Q27 A;  3GZ8 A;  4KTB A;  2A8R A;  4KYX A;  2JVB A;  2VNP A;  4YPR A;  3X0P A;  2PQV A;  1NQZ A;  1V8I A;  4S2W A;  3EF5 A;  3ZR0 A;  2I8T A;  3GZ5 A;  2R5W A;  1KHZ A;  1PVF A;  1PPX A;  1VIQ A;  5I8U A;  2DUK A;  3FCM A;  2QJT A;  2KDV A;  3X0R A;  1K26 A;  1G0S A;  3BM4 A;  3EES A;  3HYQ A;  1X51 A;  4JZU A;  1X83 A;  2B2K A;  1MUT A;  2O5W A;  3A6V A;  4J7H A;  2G73 A;  3EEU A;  1PPW A;  1VIU A;  3F6A A;  5GHN A;  3X0L A;  1SOI A;  3AC9 A;  5ISY A;  4NFX A;  3E57 A;  5DEQ A;  2CL3 A;  2ICJ A;  2KDW A;  1Q54 A;  5GHJ A;  1Q33 A;  4KG3 A;  3GZ6 A;  1VHZ A;  2VNQ A;  4N1U A;  3FSP A;  2DSD A;  2YVO A;  3L85 A;  4J7G A;  3MCF A;  4N1T A;  1QVJ A;  4MPO A;  1V8L A;  1XSA A;  2ICK A;  3Q2T A;  3X0K A;  2FKB A;  4NFW A;  5IW5 A;  2B0V A;  1G9Q A;  3ACA A;  3X0S A;  1V8M A;  2B06 A;  3X0I A;  1OW2 A;  1SU2 A;  3Q1P A;  1MQE A;  2YVP A;  1PUN A;  3X0J A;  1TUM A;  3A6S A;  2DHO A;  3I7V A;  3A6T A;  1XSB A;  1VRL A;  3KVH A;  2YVN A;  1V8V A;  1KTG A;  1JRK A;  3O69 A;  4K6E A;  5BON A;  1VK6 A;  5GHM A;  5HZX A;  1I9A A;  1MK1 A;  3ID9 A;  1HX3 A;  2RRK A;  3P5T A;  3FFU A;  3SMD A;  4YPH A;  1RYA A;  1MP2 A;  5IW4 A;  1PPV A;  2YVM A;  1V8S A;  3MDG A;  3HHJ A;  2O1C A;  3OGA A;  1IRY A;  4DYW A;  3QSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...