1MP2A

Structure of mt-adprase (apoenzyme), a nudix hydrolase from mycobacterium tuberculosis
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
202
structure length
187
Chain Sequence
FETISSETLHTGAIFALRRDQVRIVTREVVEHFGAVAIVAMDDNGNIPMVYQYRHTYGRRLWELPAGLLDVAGEPPHLTAARELREEVGLQASTWQVLVDLDTAPGFSDESVRVYLATGLREVGRTMGWYPIAEAARRVLRGEIVNSIAIAGVLAVHAVTTGFAQPRPLDTEWIDRPTAFAARRAER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADPR pyrophosphatase
publication title Structure and mechanism of MT-ADPRase, a Nudix hydrolase from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 45
structure length 187
sequence length 202
ec nomenclature ec 3.6.1.13: ADP-ribose diphosphatase.
pdb deposition date 2002-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1mp2A00
1KT9A 1V8WA 2RRKA 3A6UA 4N1UA 3X0KA 3O61A 3X0SA 5GHJA 2W4EA 5ISYA 3SONA 1KHZA 3FCMA 1VC8A 1X51A 3SHDA 5BONA 1VHZA 5ANWA 1R67A 2CL3A 2QJOA 1Q54A 3X0LA 5CFIA 2I6KA 3X0QA 5LPGA 2J8QA 5GHMA 1VC9A 2PQVA 3BM4A 5ANVA 2GT2A 1MR2A 3O69A 3I7VA 3GG6A 4NFWA 3FFUA 3I9XA 5GHNA 2A8RA 1NFZA 1RRQA 2A6TA 5ANUA 1NQZA 1K2EA 3FSPA 1MP2A 2B06A 1MQWA 1PUSA 1TUMA 4S2WA 3EESA 5I8UA 3G0QA 2YVOA 3MCFA 4KG4A 3RH7A 3P5TA 1IRYA 3F13A 1VIQA 3FJYA 3U53A 1SJYA 2DSDA 1PUNA 1HX3A 4K6EA 2PNYA 5DDGA 1GA7A 4JZUA 1VCDA 3A6TA 3A6SA 4DYWA 2O5FA 5FSMA 3O8SA 2ICJA 5FSIA 3X0RA 3BHOA 3DKUA 1VHGA 3ZR0A 5DPKA 2XSQA 1SU2A 5ANSA 4ZG0A 3HYQA 1XSAA 1NQYA 1MQEA 5CFJA 1V8SA 2ICKA 1V8UA 2I8TA 1SOIA 4YPRA 3COUA 3Q2TA 3N77A 3O6ZA 3ID9A 5BS6A 5FSKA 3P6YA 3E57A 3A6VA 4V14A 5C7TA 1PPWA 1Q33A 1V8RA 1VK6A 2Q9PA 1V8TA 3Q1PA 5DEQA 1SZ3A 5GHOA 4JZVA 1V8MA 1G0SA 1MUTA 3GZ8A 3J7Ye 2DHOA 4JZTA 3OGAA 3L85A 1PVFA 2A8SA 1Q27A 1V8NA 2AZWA 1XSBA 3AC9A 3DUPA 4HFQA 1OW2A 2B2KA 2O5WA 3GZ5A 4JZSA 3Q2SA 3R03A 1HZTA 4C9WA 5GHQA 1V8IA 3MDGA 4ILQA 3BAPA 5FSLA 5IW4A 3QSJA 1PPXA 2A8TA 3EF5A 1VIUA 2QJTA 3N9UA 3Q4IA 3SMDA 4YPHA 5GHIA 4ICKA 4S2YA 4C9XA 3GZ6A 1JKNA 5DD4A 5IW5A 1V8VA 2DSBA 2DUKA 3CNGA 3O52A 2YVNA 3HHJA 1V8YA 2GT4A 3WHWA 5ANTA 1VRLA 4S2XA 3X0NA 1JRKA 1K26A 2O1CA 3MDIA 5C7QA 3ACAA 4YOQA 1MK1A 2GB5A 5C8LA 2VNPA 2A8PA 3GWYA 3X0MA 2A8QA 2FKBA 3Q93A 1X83A 4KG3A 2I8UA 3I7UA 4IJXA 1RRSA 2JVBA 1PUQA 1X84A 1QVJA 3GRNA 3KVHA 2QKMB 3ZR1A 2FMLA 1F3YA 2VNQA 4KTBA 2KDWA 2YVMA 4HVYA 3X0JA 2KDVA 2B0VA 1G9QA 3MGMA 3EEUA 4KYXA 4MPOA 3EXQA 3FK9A 4N1TA 3X0IA 5FSNA 1PPVA 2R5WA 5FSOA 1I9AA 3Q91A 1KTGA 2G74A 2YVPA 3H95A 4S2VA 3F6AA 1XSCA 3X0PA 5HZXA 1V8LA 2FVVA 4NFXA 3X0OA 1NFSA 2G73A 1RYAA 2DSCA 5GHPA 2YYHA 1U20A
chains in the Genus database with same CATH superfamily
1KT9A 1V8WA 2RRKA 3A6UA 4N1UA 3X0KA 3O61A 3X0SA 5GHJA 2W4EA 5ISYA 3SONA 1KHZA 3FCMA 1VC8A 1X51A 3SHDA 5BONA 1VHZA 5ANWA 1R67A 2CL3A 2QJOA 1Q54A 3X0LA 5CFIA 2I6KA 3X0QA 5LPGA 2J8QA 5GHMA 1VC9A 2PQVA 3BM4A 5ANVA 2GT2A 1MR2A 3O69A 3I7VA 3GG6A 4NFWA 3FFUA 3I9XA 5GHNA 2A8RA 1NFZA 1RRQA 2A6TA 5ANUA 1NQZA 1K2EA 3FSPA 1MP2A 2B06A 1MQWA 1PUSA 1TUMA 4S2WA 3EESA 4J7HA 5I8UA 2YVOA 2CZRA 3MCFA 4KG4A 3P5TA 3RH7A 3G0QA 3F13A 1VIQA 3FJYA 3U53A 1SJYA 2DSDA 1PUNA 1HX3A 4K6EA 2PNYA 5DDGA 1GA7A 4JZUA 1VCDA 3A6TA 3A6SA 4DYWA 2O5FA 5FSMA 3O8SA 2ICJA 5FSIA 3X0RA 3BHOA 3DKUA 1VHGA 3ZR0A 5DPKA 2XSQA 1SU2A 5ANSA 4ZG0A 3HYQA 1XSAA 1NQYA 1MQEA 5CFJA 1V8SA 2ICKA 1V8UA 2I8TA 1SOIA 4YPRA 4J7GA 3COUA 3Q2TA 3N77A 3O6ZA 3ID9A 5BS6A 5FSKA 3P6YA 3E57A 3A6VA 4V14A 5C7TA 1PPWA 1Q33A 1V8RA 1VK6A 2Q9PA 1V8TA 3Q1PA 5DEQA 1SZ3A 5GHOA 4JZVA 1V8MA 1G0SA 1MUTA 3GZ8A 3J7Ye 2DHOA 4JZTA 3OGAA 3L85A 1PVFA 2A8SA 1Q27A 1V8NA 2AZWA 1XSBA 3AC9A 3DUPA 4HFQA 1OW2A 2B2KA 2O5WA 3GZ5A 4JZSA 3Q2SA 3R03A 1HZTA 4C9WA 5GHQA 1V8IA 3MDGA 4ILQA 3BAPA 5FSLA 5IW4A 3QSJA 1PPXA 2A8TA 3EF5A 1VIUA 2QJTA 3N9UA 3Q4IA 3SMDA 4YPHA 5GHIA 4ICKA 4S2YA 4C9XA 3GZ6A 1JKNA 5DD4A 5IW5A 1V8VA 2DSBA 2DUKA 3CNGA 3O52A 2YVNA 3HHJA 1V8YA 2GT4A 3WHWA 5ANTA 1VRLA 4S2XA 3X0NA 1JRKA 1K26A 2O1CA 3MDIA 5C7QA 3ACAA 4YOQA 1MK1A 2GB5A 5C8LA 2VNPA 2A8PA 3GWYA 3X0MA 2A8QA 2FKBA 3Q93A 1X83A 4KG3A 2I8UA 3I7UA 4IJXA 1RRSA 2JVBA 1IRYA 1PUQA 1X84A 1QVJA 3GRNA 3KVHA 2QKMB 3ZR1A 2FMLA 1F3YA 2VNQA 4KTBA 2KDWA 2YVMA 4HVYA 3X0JA 2KDVA 2B0VA 1G9QA 3MGMA 3EEUA 4KYXA 4MPOA 3EXQA 3FK9A 4N1TA 3X0IA 5FSNA 1PPVA 2R5WA 5FSOA 1I9AA 3Q91A 1KTGA 2G74A 2YVPA 3H95A 4S2VA 3F6AA 1XSCA 3X0PA 5HZXA 1V8LA 2FVVA 4NFXA 3X0OA 1NFSA 2G73A 1RYAA 2DSCA 5GHPA 2YYHA 1U20A
chains in the Genus database with same CATH topology
1KT9A 1V8WA 2RRKA 3A6UA 4N1UA 3X0KA 3O61A 3X0SA 5GHJA 2W4EA 5ISYA 3SONA 1KHZA 3FCMA 1VC8A 1X51A 3SHDA 5BONA 1VHZA 5ANWA 1R67A 2CL3A 2QJOA 1Q54A 3X0LA 5CFIA 2I6KA 3X0QA 5LPGA 2J8QA 5GHMA 1VC9A 2PQVA 3BM4A 5ANVA 2GT2A 1MR2A 3O69A 3I7VA 3GG6A 4NFWA 3FFUA 3I9XA 5GHNA 2A8RA 1NFZA 1RRQA 2A6TA 5ANUA 1NQZA 1K2EA 3FSPA 1MP2A 2B06A 1MQWA 1PUSA 1TUMA 4S2WA 3EESA 4J7HA 5I8UA 2YVOA 2CZRA 3MCFA 4KG4A 3P5TA 3RH7A 3G0QA 3F13A 1VIQA 3FJYA 3U53A 1SJYA 2DSDA 1PUNA 1HX3A 4K6EA 2PNYA 5DDGA 1GA7A 4JZUA 1VCDA 3A6TA 3A6SA 4DYWA 2O5FA 5FSMA 3O8SA 2ICJA 5FSIA 3X0RA 3BHOA 3DKUA 1VHGA 3ZR0A 5DPKA 2XSQA 1SU2A 5ANSA 4ZG0A 3HYQA 1XSAA 1NQYA 1MQEA 5CFJA 1V8SA 2ICKA 1V8UA 2I8TA 1SOIA 4YPRA 4J7GA 3COUA 3Q2TA 3N77A 3O6ZA 3ID9A 5BS6A 5FSKA 3P6YA 3E57A 3A6VA 4V14A 5C7TA 1PPWA 1Q33A 1V8RA 1VK6A 2Q9PA 1V8TA 3Q1PA 5DEQA 1SZ3A 5GHOA 4JZVA 1V8MA 1G0SA 1MUTA 3GZ8A 3J7Ye 2DHOA 4JZTA 3OGAA 3L85A 1PVFA 2A8SA 1Q27A 1V8NA 2AZWA 1XSBA 3AC9A 3DUPA 4HFQA 1OW2A 2B2KA 2O5WA 3GZ5A 4JZSA 3Q2SA 3R03A 1HZTA 4C9WA 5GHQA 1V8IA 3MDGA 4ILQA 3BAPA 5FSLA 5IW4A 3QSJA 1PPXA 2A8TA 3EF5A 1VIUA 2QJTA 3N9UA 3Q4IA 3SMDA 4YPHA 5GHIA 4ICKA 4S2YA 4C9XA 3GZ6A 1JKNA 5DD4A 5IW5A 1V8VA 2DSBA 2DUKA 3CNGA 3O52A 2YVNA 3HHJA 1V8YA 2GT4A 3WHWA 5ANTA 1VRLA 4S2XA 3X0NA 1JRKA 1K26A 2O1CA 3MDIA 5C7QA 3ACAA 4YOQA 1MK1A 2GB5A 5C8LA 2VNPA 2A8PA 3GWYA 3X0MA 2A8QA 2FKBA 3Q93A 1X83A 4KG3A 2I8UA 3I7UA 4IJXA 1RRSA 2JVBA 1IRYA 1PUQA 1X84A 1QVJA 3GRNA 3KVHA 2QKMB 3ZR1A 2FMLA 1F3YA 2VNQA 4KTBA 2KDWA 2YVMA 4HVYA 3X0JA 2KDVA 2B0VA 1G9QA 3MGMA 3EEUA 4KYXA 4MPOA 3EXQA 3FK9A 4N1TA 3X0IA 5FSNA 1PPVA 2R5WA 5FSOA 1I9AA 3Q91A 1KTGA 2G74A 2YVPA 3H95A 4S2VA 3F6AA 1XSCA 3X0PA 5HZXA 1V8LA 2FVVA 4NFXA 3X0OA 1NFSA 2G73A 1RYAA 2DSCA 5GHPA 2YYHA 1U20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KT9 A;  1V8W A;  2RRK A;  3A6U A;  4N1U A;  3X0K A;  3O61 A;  3X0S A;  5GHJ A;  2W4E A;  5ISY A;  3SON A;  1KHZ A;  3FCM A;  1VC8 A;  1X51 A;  3SHD A;  5BON A;  1VHZ A;  5ANW A;  1R67 A;  2CL3 A;  2QJO A;  1Q54 A;  3X0L A;  5CFI A;  2I6K A;  3X0Q A;  5LPG A;  2J8Q A;  5GHM A;  1VC9 A;  2PQV A;  3BM4 A;  5ANV A;  2GT2 A;  1MR2 A;  3O69 A;  3I7V A;  3GG6 A;  4NFW A;  3FFU A;  3I9X A;  5GHN A;  2A8R A;  1NFZ A;  1RRQ A;  2A6T A;  5ANU A;  1NQZ A;  1K2E A;  3FSP A;  1MP2 A;  2B06 A;  1MQW A;  1PUS A;  1TUM A;  4S2W A;  3EES A;  5I8U A;  3G0Q A;  2YVO A;  3MCF A;  4KG4 A;  3RH7 A;  3P5T A;  1IRY A;  3F13 A;  1VIQ A;  3FJY A;  3U53 A;  1SJY A;  2DSD A;  1PUN A;  1HX3 A;  4K6E A;  2PNY A;  5DDG A;  1GA7 A;  4JZU A;  1VCD A;  3A6T A;  3A6S A;  4DYW A;  2O5F A;  5FSM A;  3O8S A;  2ICJ A;  5FSI A;  3X0R A;  3BHO A;  3DKU A;  1VHG A;  3ZR0 A;  5DPK A;  2XSQ A;  1SU2 A;  5ANS A;  4ZG0 A;  3HYQ A;  1XSA A;  1NQY A;  1MQE A;  5CFJ A;  1V8S A;  2ICK A;  1V8U A;  2I8T A;  1SOI A;  4YPR A;  3COU A;  3Q2T A;  3N77 A;  3O6Z A;  3ID9 A;  5BS6 A;  5FSK A;  3P6Y A;  3E57 A;  3A6V A;  4V14 A;  5C7T A;  1PPW A;  1Q33 A;  1V8R A;  1VK6 A;  2Q9P A;  1V8T A;  3Q1P A;  5DEQ A;  1SZ3 A;  5GHO A;  4JZV A;  1V8M A;  1G0S A;  1MUT A;  3GZ8 A;  3J7Y e;  2DHO A;  4JZT A;  3OGA A;  3L85 A;  1PVF A;  2A8S A;  1Q27 A;  1V8N A;  2AZW A;  1XSB A;  3AC9 A;  3DUP A;  4HFQ A;  1OW2 A;  2B2K A;  2O5W A;  3GZ5 A;  4JZS A;  3Q2S A;  3R03 A;  1HZT A;  4C9W A;  5GHQ A;  1V8I A;  3MDG A;  4ILQ A;  3BAP A;  5FSL A;  5IW4 A;  3QSJ A;  1PPX A;  2A8T A;  3EF5 A;  1VIU A;  2QJT A;  3N9U A;  3Q4I A;  3SMD A;  4YPH A;  5GHI A;  4ICK A;  4S2Y A;  4C9X A;  3GZ6 A;  1JKN A;  5DD4 A;  5IW5 A;  1V8V A;  2DSB A;  2DUK A;  3CNG A;  3O52 A;  2YVN A;  3HHJ A;  1V8Y A;  2GT4 A;  3WHW A;  5ANT A;  1VRL A;  4S2X A;  3X0N A;  1JRK A;  1K26 A;  2O1C A;  3MDI A;  5C7Q A;  3ACA A;  4YOQ A;  1MK1 A;  2GB5 A;  5C8L A;  2VNP A;  2A8P A;  3GWY A;  3X0M A;  2A8Q A;  2FKB A;  3Q93 A;  1X83 A;  4KG3 A;  2I8U A;  3I7U A;  4IJX A;  1RRS A;  2JVB A;  1PUQ A;  1X84 A;  1QVJ A;  3GRN A;  3KVH A;  2QKM B;  3ZR1 A;  2FML A;  1F3Y A;  2VNQ A;  4KTB A;  2KDW A;  2YVM A;  4HVY A;  3X0J A;  2KDV A;  2B0V A;  1G9Q A;  3MGM A;  3EEU A;  4KYX A;  4MPO A;  3EXQ A;  3FK9 A;  4N1T A;  3X0I A;  5FSN A;  1PPV A;  2R5W A;  5FSO A;  1I9A A;  3Q91 A;  1KTG A;  2G74 A;  2YVP A;  3H95 A;  4S2V A;  3F6A A;  1XSC A;  3X0P A;  5HZX A;  1V8L A;  2FVV A;  4NFX A;  3X0O A;  1NFS A;  2G73 A;  1RYA A;  2DSC A;  5GHP A;  2YYH A;  1U20 A; 
#chains in the Genus database with same CATH topology
 1KT9 A;  1V8W A;  2RRK A;  3A6U A;  4N1U A;  3X0K A;  3O61 A;  3X0S A;  5GHJ A;  2W4E A;  5ISY A;  3SON A;  1KHZ A;  3FCM A;  1VC8 A;  1X51 A;  3SHD A;  5BON A;  1VHZ A;  5ANW A;  1R67 A;  2CL3 A;  2QJO A;  1Q54 A;  3X0L A;  5CFI A;  2I6K A;  3X0Q A;  5LPG A;  2J8Q A;  5GHM A;  1VC9 A;  2PQV A;  3BM4 A;  5ANV A;  2GT2 A;  1MR2 A;  3O69 A;  3I7V A;  3GG6 A;  4NFW A;  3FFU A;  3I9X A;  5GHN A;  2A8R A;  1NFZ A;  1RRQ A;  2A6T A;  5ANU A;  1NQZ A;  1K2E A;  3FSP A;  1MP2 A;  2B06 A;  1MQW A;  1PUS A;  1TUM A;  4S2W A;  3EES A;  4J7H A;  5I8U A;  2YVO A;  2CZR A;  3MCF A;  4KG4 A;  3P5T A;  3RH7 A;  3G0Q A;  3F13 A;  1VIQ A;  3FJY A;  3U53 A;  1SJY A;  2DSD A;  1PUN A;  1HX3 A;  4K6E A;  2PNY A;  5DDG A;  1GA7 A;  4JZU A;  1VCD A;  3A6T A;  3A6S A;  4DYW A;  2O5F A;  5FSM A;  3O8S A;  2ICJ A;  5FSI A;  3X0R A;  3BHO A;  3DKU A;  1VHG A;  3ZR0 A;  5DPK A;  2XSQ A;  1SU2 A;  5ANS A;  4ZG0 A;  3HYQ A;  1XSA A;  1NQY A;  1MQE A;  5CFJ A;  1V8S A;  2ICK A;  1V8U A;  2I8T A;  1SOI A;  4YPR A;  4J7G A;  3COU A;  3Q2T A;  3N77 A;  3O6Z A;  3ID9 A;  5BS6 A;  5FSK A;  3P6Y A;  3E57 A;  3A6V A;  4V14 A;  5C7T A;  1PPW A;  1Q33 A;  1V8R A;  1VK6 A;  2Q9P A;  1V8T A;  3Q1P A;  5DEQ A;  1SZ3 A;  5GHO A;  4JZV A;  1V8M A;  1G0S A;  1MUT A;  3GZ8 A;  3J7Y e;  2DHO A;  4JZT A;  3OGA A;  3L85 A;  1PVF A;  2A8S A;  1Q27 A;  1V8N A;  2AZW A;  1XSB A;  3AC9 A;  3DUP A;  4HFQ A;  1OW2 A;  2B2K A;  2O5W A;  3GZ5 A;  4JZS A;  3Q2S A;  3R03 A;  1HZT A;  4C9W A;  5GHQ A;  1V8I A;  3MDG A;  4ILQ A;  3BAP A;  5FSL A;  5IW4 A;  3QSJ A;  1PPX A;  2A8T A;  3EF5 A;  1VIU A;  2QJT A;  3N9U A;  3Q4I A;  3SMD A;  4YPH A;  5GHI A;  4ICK A;  4S2Y A;  4C9X A;  3GZ6 A;  1JKN A;  5DD4 A;  5IW5 A;  1V8V A;  2DSB A;  2DUK A;  3CNG A;  3O52 A;  2YVN A;  3HHJ A;  1V8Y A;  2GT4 A;  3WHW A;  5ANT A;  1VRL A;  4S2X A;  3X0N A;  1JRK A;  1K26 A;  2O1C A;  3MDI A;  5C7Q A;  3ACA A;  4YOQ A;  1MK1 A;  2GB5 A;  5C8L A;  2VNP A;  2A8P A;  3GWY A;  3X0M A;  2A8Q A;  2FKB A;  3Q93 A;  1X83 A;  4KG3 A;  2I8U A;  3I7U A;  4IJX A;  1RRS A;  2JVB A;  1IRY A;  1PUQ A;  1X84 A;  1QVJ A;  3GRN A;  3KVH A;  2QKM B;  3ZR1 A;  2FML A;  1F3Y A;  2VNQ A;  4KTB A;  2KDW A;  2YVM A;  4HVY A;  3X0J A;  2KDV A;  2B0V A;  1G9Q A;  3MGM A;  3EEU A;  4KYX A;  4MPO A;  3EXQ A;  3FK9 A;  4N1T A;  3X0I A;  5FSN A;  1PPV A;  2R5W A;  5FSO A;  1I9A A;  3Q91 A;  1KTG A;  2G74 A;  2YVP A;  3H95 A;  4S2V A;  3F6A A;  1XSC A;  3X0P A;  5HZX A;  1V8L A;  2FVV A;  4NFX A;  3X0O A;  1NFS A;  2G73 A;  1RYA A;  2DSC A;  5GHP A;  2YYH A;  1U20 A; 
#chains in the Genus database with same CATH homology
 1KT9 A;  1V8W A;  2RRK A;  3A6U A;  4N1U A;  3X0K A;  3O61 A;  3X0S A;  5GHJ A;  2W4E A;  5ISY A;  3SON A;  1KHZ A;  3FCM A;  1VC8 A;  1X51 A;  3SHD A;  5BON A;  1VHZ A;  5ANW A;  1R67 A;  2CL3 A;  2QJO A;  1Q54 A;  3X0L A;  5CFI A;  2I6K A;  3X0Q A;  5LPG A;  2J8Q A;  5GHM A;  1VC9 A;  2PQV A;  3BM4 A;  5ANV A;  2GT2 A;  1MR2 A;  3O69 A;  3I7V A;  3GG6 A;  4NFW A;  3FFU A;  3I9X A;  5GHN A;  2A8R A;  1NFZ A;  1RRQ A;  2A6T A;  5ANU A;  1NQZ A;  1K2E A;  3FSP A;  1MP2 A;  2B06 A;  1MQW A;  1PUS A;  1TUM A;  4S2W A;  3EES A;  4J7H A;  5I8U A;  2YVO A;  2CZR A;  3MCF A;  4KG4 A;  3P5T A;  3RH7 A;  3G0Q A;  3F13 A;  1VIQ A;  3FJY A;  3U53 A;  1SJY A;  2DSD A;  1PUN A;  1HX3 A;  4K6E A;  2PNY A;  5DDG A;  1GA7 A;  4JZU A;  1VCD A;  3A6T A;  3A6S A;  4DYW A;  2O5F A;  5FSM A;  3O8S A;  2ICJ A;  5FSI A;  3X0R A;  3BHO A;  3DKU A;  1VHG A;  3ZR0 A;  5DPK A;  2XSQ A;  1SU2 A;  5ANS A;  4ZG0 A;  3HYQ A;  1XSA A;  1NQY A;  1MQE A;  5CFJ A;  1V8S A;  2ICK A;  1V8U A;  2I8T A;  1SOI A;  4YPR A;  4J7G A;  3COU A;  3Q2T A;  3N77 A;  3O6Z A;  3ID9 A;  5BS6 A;  5FSK A;  3P6Y A;  3E57 A;  3A6V A;  4V14 A;  5C7T A;  1PPW A;  1Q33 A;  1V8R A;  1VK6 A;  2Q9P A;  1V8T A;  3Q1P A;  5DEQ A;  1SZ3 A;  5GHO A;  4JZV A;  1V8M A;  1G0S A;  1MUT A;  3GZ8 A;  3J7Y e;  2DHO A;  4JZT A;  3OGA A;  3L85 A;  1PVF A;  2A8S A;  1Q27 A;  1V8N A;  2AZW A;  1XSB A;  3AC9 A;  3DUP A;  4HFQ A;  1OW2 A;  2B2K A;  2O5W A;  3GZ5 A;  4JZS A;  3Q2S A;  3R03 A;  1HZT A;  4C9W A;  5GHQ A;  1V8I A;  3MDG A;  4ILQ A;  3BAP A;  5FSL A;  5IW4 A;  3QSJ A;  1PPX A;  2A8T A;  3EF5 A;  1VIU A;  2QJT A;  3N9U A;  3Q4I A;  3SMD A;  4YPH A;  5GHI A;  4ICK A;  4S2Y A;  4C9X A;  3GZ6 A;  1JKN A;  5DD4 A;  5IW5 A;  1V8V A;  2DSB A;  2DUK A;  3CNG A;  3O52 A;  2YVN A;  3HHJ A;  1V8Y A;  2GT4 A;  3WHW A;  5ANT A;  1VRL A;  4S2X A;  3X0N A;  1JRK A;  1K26 A;  2O1C A;  3MDI A;  5C7Q A;  3ACA A;  4YOQ A;  1MK1 A;  2GB5 A;  5C8L A;  2VNP A;  2A8P A;  3GWY A;  3X0M A;  2A8Q A;  2FKB A;  3Q93 A;  1X83 A;  4KG3 A;  2I8U A;  3I7U A;  4IJX A;  1RRS A;  2JVB A;  1IRY A;  1PUQ A;  1X84 A;  1QVJ A;  3GRN A;  3KVH A;  2QKM B;  3ZR1 A;  2FML A;  1F3Y A;  2VNQ A;  4KTB A;  2KDW A;  2YVM A;  4HVY A;  3X0J A;  2KDV A;  2B0V A;  1G9Q A;  3MGM A;  3EEU A;  4KYX A;  4MPO A;  3EXQ A;  3FK9 A;  4N1T A;  3X0I A;  5FSN A;  1PPV A;  2R5W A;  5FSO A;  1I9A A;  3Q91 A;  1KTG A;  2G74 A;  2YVP A;  3H95 A;  4S2V A;  3F6A A;  1XSC A;  3X0P A;  5HZX A;  1V8L A;  2FVV A;  4NFX A;  3X0O A;  1NFS A;  2G73 A;  1RYA A;  2DSC A;  5GHP A;  2YYH A;  1U20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...