3O69A

Structure of the e100a e.coli gdp-mannose hydrolase (yffh) in complex with mg++
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
190
structure length
176
Chain Sequence
TQQITLIKDKILSDNYFTLHNITYDLTRKDEVIRHKREVYDRGNGATILLYNTKKKTVVLIRQFRVATWVNGNESGQLIESCAGLLNDEPEVCIRKAAIEETGYEVGEVRKLFELYMSPGGVTELIHFFIAEYSDEDIEVLELPFSQALEMIKTGEIRDGKTVLLLNYLQTSHLMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GDP-mannose pyrophosphatase nudK
publication title Structural studies of the Nudix GDP-mannose hydrolase from E. coli reveals a new motif for mannose recognition.
pubmed doi rcsb
source organism Escherichia coli
total genus 47
structure length 176
sequence length 190
chains with identical sequence B
ec nomenclature ec 3.6.1.-:
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3o69A00
4S2XA 1RRSA 5ANWA 5FSNA 2G74A 5IW5A 1VC8A 3P6YA 1GA7A 3X0NA 2YVMA 2YVNA 2KDWA 3MGMA 4N1UA 3I7UA 2ICJA 3CNGA 1SZ3A 2AZWA 2YVOA 3ACAA 4JZUA 1R67A 1PUSA 1QVJA 2FKBA 1MK1A 3GG6A 2YVPA 3EEUA 3GZ6A 3OGAA 1V8TA 3FFUA 3P5TA 3L85A 4V14A 2I8UA 4S2YA 5GHIA 3SMDA 1VHZA 1Q33A 2O1CA 3GWYA 4JZTA 1V8NA 3X0LA 5BONA 3ZR1A 4ICKA 3A6TA 3F13A 4DYWA 4HVYA 1VK6A 3I7VA 1SOIA 1V8VA 5GHJA 1JRKA 1K2EA 1MQWA 1X51A 2KDVA 3BAPA 3HYQA 3ID9A 4NFXA 3U53A 5FSKA 1HZTA 2GB5A 1MUTA 2ICKA 3N9UA 2A8PA 2A8SA 5FSOA 5GHOA 5I8UA 4C9XA 4KG4A 3MDIA 1NFZA 1PUQA 5GHPA 2DHOA 1SJYA 5GHNA 3O6ZA 2GT4A 4YPRA 2PNYA 4YPHA 4YOQA 5GHQA 1OW2A 1MQEA 5C8LA 1IRYA 3MCFA 3COUA 3O69A 1HX3A 1K26A 3EF5A 5ANUA 1V8UA 2I6KA 3Q1PA 3Q93A 4KYXA 4JZSA 2GT2A 1NQYA 1V8WA 3O61A 1PVFA 3Q2SA 1XSCA 1MR2A 4K6EA 1SU2A 3F6AA 3EXQA 1V8YA 1VC9A 2QKMB 1G9QA 1VHGA 4N1TA 5FSIA 3AC9A 1X84A 5FSLA 3Q2TA 5DPKA 3HHJA 4JZVA 4HFQA 5IW4A 1Q27A 2QJOA 4NFWA 5ISYA 2QJTA 5ANTA 3R03A 3FSPA 3O8SA 4KG3A 3RH7A 2DUKA 2B2KA 3GZ8A 3GZ5A 1NFSA 5ANSA 2Q9PA 3Q91A 1KT9A 3FCMA 1KTGA 3DKUA 2A8QA 4S2VA 5DEQA 3X0KA 2VNPA 2FMLA 5HZXA 1TUMA 2A8TA 1RRQA 1VRLA 1JKNA 1X83A 2W4EA 3G0QA 3E57A 2RRKA 2A6TA 3QSJA 3X0RA 3X0IA 1PUNA 2XSQA 2O5WA 3X0SA 3MDGA 5FSMA 3X0OA 2CL3A 3DUPA 4IJXA 5DDGA 2DSCA 3FJYA 2PQVA 1PPWA 1VIQA 3WHWA 3SHDA 4ILQA 5GHMA 3ZR0A 2VNQA 5LPGA 3A6UA 4KTBA 5C7TA 1MP2A 3KVHA 3J7Ye 2G73A 2DSDA 2B06A 3EESA 4C9WA 5ANVA 2A8RA 3N77A 3O52A 3A6SA 1V8MA 1XSAA 1F3YA 1RYAA 1G0SA 3BM4A 2I8TA 3BHOA 2FVVA 5BS6A 5DD4A 1PPVA 3FK9A 1VIUA 2O5FA 1PPXA 3X0MA 1U20A 1V8RA 1XSBA 2B0VA 2R5WA 1KHZA 5C7QA 2J8QA 1NQZA 1V8LA 2YYHA 5CFIA 3GRNA 3X0JA 4S2WA 3Q4IA 3SONA 1I9AA 2DSBA 3I9XA 1V8IA 3A6VA 4MPOA 2JVBA 1Q54A 3X0PA 1V8SA 3H95A 1VCDA 4ZG0A 3X0QA 5CFJA
chains in the Genus database with same CATH superfamily
4S2XA 1RRSA 5ANWA 5FSNA 2G74A 5IW5A 1VC8A 3P6YA 1GA7A 3X0NA 2YVMA 2YVNA 2KDWA 3MGMA 4N1UA 3I7UA 2ICJA 3CNGA 1SZ3A 2AZWA 2YVOA 3ACAA 4JZUA 1R67A 1PUSA 1QVJA 2FKBA 1MK1A 3GG6A 2YVPA 3EEUA 3GZ6A 3OGAA 1V8TA 3FFUA 3P5TA 3L85A 4V14A 2I8UA 4S2YA 5GHIA 3SMDA 1VHZA 1Q33A 2O1CA 3GWYA 4JZTA 1V8NA 3X0LA 5BONA 3ZR1A 4ICKA 3A6TA 3F13A 4DYWA 4HVYA 1VK6A 3I7VA 1SOIA 1V8VA 5GHJA 1JRKA 1K2EA 1MQWA 1X51A 2KDVA 3BAPA 3HYQA 3ID9A 4NFXA 3U53A 5FSKA 1HZTA 2GB5A 1MUTA 2ICKA 3N9UA 2A8PA 2A8SA 5FSOA 5GHOA 5I8UA 4C9XA 4KG4A 3MDIA 1NFZA 1PUQA 5GHPA 2DHOA 1SJYA 5GHNA 3O6ZA 2GT4A 4YPRA 2PNYA 4YPHA 4YOQA 5GHQA 1OW2A 1MQEA 5C8LA 1IRYA 3MCFA 3COUA 3O69A 1HX3A 1K26A 3EF5A 5ANUA 1V8UA 2I6KA 3Q1PA 3Q93A 4KYXA 4JZSA 2GT2A 1NQYA 1V8WA 3O61A 1PVFA 3Q2SA 1XSCA 1MR2A 4K6EA 1SU2A 3F6AA 3EXQA 1V8YA 1VC9A 2QKMB 1G9QA 1VHGA 4N1TA 5FSIA 3AC9A 1X84A 5FSLA 3Q2TA 5DPKA 3HHJA 4JZVA 4HFQA 5IW4A 1Q27A 2QJOA 4NFWA 5ISYA 2QJTA 5ANTA 3R03A 3FSPA 3O8SA 4KG3A 3RH7A 2DUKA 2B2KA 3GZ8A 3GZ5A 1NFSA 5ANSA 2Q9PA 3Q91A 2CZRA 1KT9A 3FCMA 1KTGA 3DKUA 2A8QA 4S2VA 5DEQA 3X0KA 2VNPA 2FMLA 5HZXA 1TUMA 2A8TA 1RRQA 1VRLA 1JKNA 1X83A 2W4EA 3G0QA 3E57A 2RRKA 2A6TA 3QSJA 3X0RA 3X0IA 1PUNA 2XSQA 2O5WA 3X0SA 3MDGA 5FSMA 3X0OA 2CL3A 3DUPA 4IJXA 4J7GA 5DDGA 2DSCA 3FJYA 2PQVA 1PPWA 1VIQA 3WHWA 3SHDA 4ILQA 5GHMA 3ZR0A 2VNQA 5LPGA 3A6UA 4KTBA 5C7TA 1MP2A 3KVHA 3J7Ye 2G73A 2DSDA 2B06A 3EESA 4C9WA 5ANVA 2A8RA 3N77A 3O52A 3A6SA 1V8MA 1XSAA 1F3YA 1RYAA 1G0SA 3BM4A 2I8TA 3BHOA 2FVVA 4J7HA 5BS6A 5DD4A 1PPVA 3FK9A 1VIUA 2O5FA 1PPXA 3X0MA 1U20A 1V8RA 1XSBA 2B0VA 2R5WA 1KHZA 5C7QA 2J8QA 1NQZA 1V8LA 2YYHA 5CFIA 3GRNA 3X0JA 4S2WA 3Q4IA 3SONA 1I9AA 2DSBA 3I9XA 1V8IA 3A6VA 4MPOA 2JVBA 1Q54A 3X0PA 1V8SA 3H95A 1VCDA 4ZG0A 3X0QA 5CFJA
chains in the Genus database with same CATH topology
4S2XA 1RRSA 5ANWA 5FSNA 2G74A 5IW5A 1VC8A 3P6YA 1GA7A 3X0NA 2YVMA 2YVNA 2KDWA 3MGMA 4N1UA 3I7UA 2ICJA 3CNGA 1SZ3A 2AZWA 2YVOA 3ACAA 4JZUA 1R67A 1PUSA 1QVJA 2FKBA 1MK1A 3GG6A 2YVPA 3EEUA 3GZ6A 3OGAA 1V8TA 3FFUA 3P5TA 3L85A 4V14A 2I8UA 4S2YA 5GHIA 3SMDA 1VHZA 1Q33A 2O1CA 3GWYA 4JZTA 1V8NA 3X0LA 5BONA 3ZR1A 4ICKA 3A6TA 3F13A 4DYWA 4HVYA 1VK6A 3I7VA 1SOIA 1V8VA 5GHJA 1JRKA 1K2EA 1MQWA 1X51A 2KDVA 3BAPA 3HYQA 3ID9A 4NFXA 3U53A 5FSKA 1HZTA 2GB5A 1MUTA 2ICKA 3N9UA 2A8PA 2A8SA 5FSOA 5GHOA 5I8UA 4C9XA 4KG4A 3MDIA 1NFZA 1PUQA 5GHPA 2DHOA 1SJYA 5GHNA 3O6ZA 2GT4A 4YPRA 2PNYA 4YPHA 4YOQA 5GHQA 1OW2A 1MQEA 5C8LA 1IRYA 3MCFA 3COUA 3O69A 1HX3A 1K26A 3EF5A 5ANUA 1V8UA 2I6KA 3Q1PA 3Q93A 4KYXA 4JZSA 2GT2A 1NQYA 1V8WA 3O61A 1PVFA 3Q2SA 1XSCA 1MR2A 4K6EA 1SU2A 3F6AA 3EXQA 1V8YA 1VC9A 2QKMB 1G9QA 1VHGA 4N1TA 5FSIA 3AC9A 1X84A 5FSLA 3Q2TA 5DPKA 3HHJA 4JZVA 4HFQA 5IW4A 1Q27A 2QJOA 4NFWA 5ISYA 2QJTA 5ANTA 3R03A 3FSPA 3O8SA 4KG3A 3RH7A 2DUKA 2B2KA 3GZ8A 3GZ5A 1NFSA 5ANSA 2Q9PA 3Q91A 2CZRA 1KT9A 3FCMA 1KTGA 3DKUA 2A8QA 4S2VA 5DEQA 3X0KA 2VNPA 2FMLA 5HZXA 1TUMA 2A8TA 1RRQA 1VRLA 1JKNA 1X83A 2W4EA 3G0QA 3E57A 2RRKA 2A6TA 3QSJA 3X0RA 3X0IA 1PUNA 2XSQA 2O5WA 3X0SA 3MDGA 5FSMA 3X0OA 2CL3A 3DUPA 4IJXA 4J7GA 5DDGA 2DSCA 3FJYA 2PQVA 1PPWA 1VIQA 3WHWA 3SHDA 4ILQA 5GHMA 3ZR0A 2VNQA 5LPGA 3A6UA 4KTBA 5C7TA 1MP2A 3KVHA 3J7Ye 2G73A 2DSDA 2B06A 3EESA 4C9WA 5ANVA 2A8RA 3N77A 3O52A 3A6SA 1V8MA 1XSAA 1F3YA 1RYAA 1G0SA 3BM4A 2I8TA 3BHOA 2FVVA 4J7HA 5BS6A 5DD4A 1PPVA 3FK9A 1VIUA 2O5FA 1PPXA 3X0MA 1U20A 1V8RA 1XSBA 2B0VA 2R5WA 1KHZA 5C7QA 2J8QA 1NQZA 1V8LA 2YYHA 5CFIA 3GRNA 3X0JA 4S2WA 3Q4IA 3SONA 1I9AA 2DSBA 3I9XA 1V8IA 3A6VA 4MPOA 2JVBA 1Q54A 3X0PA 1V8SA 3H95A 1VCDA 4ZG0A 3X0QA 5CFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S2X A;  1RRS A;  5ANW A;  5FSN A;  2G74 A;  5IW5 A;  1VC8 A;  3P6Y A;  1GA7 A;  3X0N A;  2YVM A;  2YVN A;  2KDW A;  3MGM A;  4N1U A;  3I7U A;  2ICJ A;  3CNG A;  1SZ3 A;  2AZW A;  2YVO A;  3ACA A;  4JZU A;  1R67 A;  1PUS A;  1QVJ A;  2FKB A;  1MK1 A;  3GG6 A;  2YVP A;  3EEU A;  3GZ6 A;  3OGA A;  1V8T A;  3FFU A;  3P5T A;  3L85 A;  4V14 A;  2I8U A;  4S2Y A;  5GHI A;  3SMD A;  1VHZ A;  1Q33 A;  2O1C A;  3GWY A;  4JZT A;  1V8N A;  3X0L A;  5BON A;  3ZR1 A;  4ICK A;  3A6T A;  3F13 A;  4DYW A;  4HVY A;  1VK6 A;  3I7V A;  1SOI A;  1V8V A;  5GHJ A;  1JRK A;  1K2E A;  1MQW A;  1X51 A;  2KDV A;  3BAP A;  3HYQ A;  3ID9 A;  4NFX A;  3U53 A;  5FSK A;  1HZT A;  2GB5 A;  1MUT A;  2ICK A;  3N9U A;  2A8P A;  2A8S A;  5FSO A;  5GHO A;  5I8U A;  4C9X A;  4KG4 A;  3MDI A;  1NFZ A;  1PUQ A;  5GHP A;  2DHO A;  1SJY A;  5GHN A;  3O6Z A;  2GT4 A;  4YPR A;  2PNY A;  4YPH A;  4YOQ A;  5GHQ A;  1OW2 A;  1MQE A;  5C8L A;  1IRY A;  3MCF A;  3COU A;  3O69 A;  1HX3 A;  1K26 A;  3EF5 A;  5ANU A;  1V8U A;  2I6K A;  3Q1P A;  3Q93 A;  4KYX A;  4JZS A;  2GT2 A;  1NQY A;  1V8W A;  3O61 A;  1PVF A;  3Q2S A;  1XSC A;  1MR2 A;  4K6E A;  1SU2 A;  3F6A A;  3EXQ A;  1V8Y A;  1VC9 A;  2QKM B;  1G9Q A;  1VHG A;  4N1T A;  5FSI A;  3AC9 A;  1X84 A;  5FSL A;  3Q2T A;  5DPK A;  3HHJ A;  4JZV A;  4HFQ A;  5IW4 A;  1Q27 A;  2QJO A;  4NFW A;  5ISY A;  2QJT A;  5ANT A;  3R03 A;  3FSP A;  3O8S A;  4KG3 A;  3RH7 A;  2DUK A;  2B2K A;  3GZ8 A;  3GZ5 A;  1NFS A;  5ANS A;  2Q9P A;  3Q91 A;  1KT9 A;  3FCM A;  1KTG A;  3DKU A;  2A8Q A;  4S2V A;  5DEQ A;  3X0K A;  2VNP A;  2FML A;  5HZX A;  1TUM A;  2A8T A;  1RRQ A;  1VRL A;  1JKN A;  1X83 A;  2W4E A;  3G0Q A;  3E57 A;  2RRK A;  2A6T A;  3QSJ A;  3X0R A;  3X0I A;  1PUN A;  2XSQ A;  2O5W A;  3X0S A;  3MDG A;  5FSM A;  3X0O A;  2CL3 A;  3DUP A;  4IJX A;  5DDG A;  2DSC A;  3FJY A;  2PQV A;  1PPW A;  1VIQ A;  3WHW A;  3SHD A;  4ILQ A;  5GHM A;  3ZR0 A;  2VNQ A;  5LPG A;  3A6U A;  4KTB A;  5C7T A;  1MP2 A;  3KVH A;  3J7Y e;  2G73 A;  2DSD A;  2B06 A;  3EES A;  4C9W A;  5ANV A;  2A8R A;  3N77 A;  3O52 A;  3A6S A;  1V8M A;  1XSA A;  1F3Y A;  1RYA A;  1G0S A;  3BM4 A;  2I8T A;  3BHO A;  2FVV A;  5BS6 A;  5DD4 A;  1PPV A;  3FK9 A;  1VIU A;  2O5F A;  1PPX A;  3X0M A;  1U20 A;  1V8R A;  1XSB A;  2B0V A;  2R5W A;  1KHZ A;  5C7Q A;  2J8Q A;  1NQZ A;  1V8L A;  2YYH A;  5CFI A;  3GRN A;  3X0J A;  4S2W A;  3Q4I A;  3SON A;  1I9A A;  2DSB A;  3I9X A;  1V8I A;  3A6V A;  4MPO A;  2JVB A;  1Q54 A;  3X0P A;  1V8S A;  3H95 A;  1VCD A;  4ZG0 A;  3X0Q A;  5CFJ A; 
#chains in the Genus database with same CATH topology
 4S2X A;  1RRS A;  5ANW A;  5FSN A;  2G74 A;  5IW5 A;  1VC8 A;  3P6Y A;  1GA7 A;  3X0N A;  2YVM A;  2YVN A;  2KDW A;  3MGM A;  4N1U A;  3I7U A;  2ICJ A;  3CNG A;  1SZ3 A;  2AZW A;  2YVO A;  3ACA A;  4JZU A;  1R67 A;  1PUS A;  1QVJ A;  2FKB A;  1MK1 A;  3GG6 A;  2YVP A;  3EEU A;  3GZ6 A;  3OGA A;  1V8T A;  3FFU A;  3P5T A;  3L85 A;  4V14 A;  2I8U A;  4S2Y A;  5GHI A;  3SMD A;  1VHZ A;  1Q33 A;  2O1C A;  3GWY A;  4JZT A;  1V8N A;  3X0L A;  5BON A;  3ZR1 A;  4ICK A;  3A6T A;  3F13 A;  4DYW A;  4HVY A;  1VK6 A;  3I7V A;  1SOI A;  1V8V A;  5GHJ A;  1JRK A;  1K2E A;  1MQW A;  1X51 A;  2KDV A;  3BAP A;  3HYQ A;  3ID9 A;  4NFX A;  3U53 A;  5FSK A;  1HZT A;  2GB5 A;  1MUT A;  2ICK A;  3N9U A;  2A8P A;  2A8S A;  5FSO A;  5GHO A;  5I8U A;  4C9X A;  4KG4 A;  3MDI A;  1NFZ A;  1PUQ A;  5GHP A;  2DHO A;  1SJY A;  5GHN A;  3O6Z A;  2GT4 A;  4YPR A;  2PNY A;  4YPH A;  4YOQ A;  5GHQ A;  1OW2 A;  1MQE A;  5C8L A;  1IRY A;  3MCF A;  3COU A;  3O69 A;  1HX3 A;  1K26 A;  3EF5 A;  5ANU A;  1V8U A;  2I6K A;  3Q1P A;  3Q93 A;  4KYX A;  4JZS A;  2GT2 A;  1NQY A;  1V8W A;  3O61 A;  1PVF A;  3Q2S A;  1XSC A;  1MR2 A;  4K6E A;  1SU2 A;  3F6A A;  3EXQ A;  1V8Y A;  1VC9 A;  2QKM B;  1G9Q A;  1VHG A;  4N1T A;  5FSI A;  3AC9 A;  1X84 A;  5FSL A;  3Q2T A;  5DPK A;  3HHJ A;  4JZV A;  4HFQ A;  5IW4 A;  1Q27 A;  2QJO A;  4NFW A;  5ISY A;  2QJT A;  5ANT A;  3R03 A;  3FSP A;  3O8S A;  4KG3 A;  3RH7 A;  2DUK A;  2B2K A;  3GZ8 A;  3GZ5 A;  1NFS A;  5ANS A;  2Q9P A;  3Q91 A;  2CZR A;  1KT9 A;  3FCM A;  1KTG A;  3DKU A;  2A8Q A;  4S2V A;  5DEQ A;  3X0K A;  2VNP A;  2FML A;  5HZX A;  1TUM A;  2A8T A;  1RRQ A;  1VRL A;  1JKN A;  1X83 A;  2W4E A;  3G0Q A;  3E57 A;  2RRK A;  2A6T A;  3QSJ A;  3X0R A;  3X0I A;  1PUN A;  2XSQ A;  2O5W A;  3X0S A;  3MDG A;  5FSM A;  3X0O A;  2CL3 A;  3DUP A;  4IJX A;  4J7G A;  5DDG A;  2DSC A;  3FJY A;  2PQV A;  1PPW A;  1VIQ A;  3WHW A;  3SHD A;  4ILQ A;  5GHM A;  3ZR0 A;  2VNQ A;  5LPG A;  3A6U A;  4KTB A;  5C7T A;  1MP2 A;  3KVH A;  3J7Y e;  2G73 A;  2DSD A;  2B06 A;  3EES A;  4C9W A;  5ANV A;  2A8R A;  3N77 A;  3O52 A;  3A6S A;  1V8M A;  1XSA A;  1F3Y A;  1RYA A;  1G0S A;  3BM4 A;  2I8T A;  3BHO A;  2FVV A;  4J7H A;  5BS6 A;  5DD4 A;  1PPV A;  3FK9 A;  1VIU A;  2O5F A;  1PPX A;  3X0M A;  1U20 A;  1V8R A;  1XSB A;  2B0V A;  2R5W A;  1KHZ A;  5C7Q A;  2J8Q A;  1NQZ A;  1V8L A;  2YYH A;  5CFI A;  3GRN A;  3X0J A;  4S2W A;  3Q4I A;  3SON A;  1I9A A;  2DSB A;  3I9X A;  1V8I A;  3A6V A;  4MPO A;  2JVB A;  1Q54 A;  3X0P A;  1V8S A;  3H95 A;  1VCD A;  4ZG0 A;  3X0Q A;  5CFJ A; 
#chains in the Genus database with same CATH homology
 4S2X A;  1RRS A;  5ANW A;  5FSN A;  2G74 A;  5IW5 A;  1VC8 A;  3P6Y A;  1GA7 A;  3X0N A;  2YVM A;  2YVN A;  2KDW A;  3MGM A;  4N1U A;  3I7U A;  2ICJ A;  3CNG A;  1SZ3 A;  2AZW A;  2YVO A;  3ACA A;  4JZU A;  1R67 A;  1PUS A;  1QVJ A;  2FKB A;  1MK1 A;  3GG6 A;  2YVP A;  3EEU A;  3GZ6 A;  3OGA A;  1V8T A;  3FFU A;  3P5T A;  3L85 A;  4V14 A;  2I8U A;  4S2Y A;  5GHI A;  3SMD A;  1VHZ A;  1Q33 A;  2O1C A;  3GWY A;  4JZT A;  1V8N A;  3X0L A;  5BON A;  3ZR1 A;  4ICK A;  3A6T A;  3F13 A;  4DYW A;  4HVY A;  1VK6 A;  3I7V A;  1SOI A;  1V8V A;  5GHJ A;  1JRK A;  1K2E A;  1MQW A;  1X51 A;  2KDV A;  3BAP A;  3HYQ A;  3ID9 A;  4NFX A;  3U53 A;  5FSK A;  1HZT A;  2GB5 A;  1MUT A;  2ICK A;  3N9U A;  2A8P A;  2A8S A;  5FSO A;  5GHO A;  5I8U A;  4C9X A;  4KG4 A;  3MDI A;  1NFZ A;  1PUQ A;  5GHP A;  2DHO A;  1SJY A;  5GHN A;  3O6Z A;  2GT4 A;  4YPR A;  2PNY A;  4YPH A;  4YOQ A;  5GHQ A;  1OW2 A;  1MQE A;  5C8L A;  1IRY A;  3MCF A;  3COU A;  3O69 A;  1HX3 A;  1K26 A;  3EF5 A;  5ANU A;  1V8U A;  2I6K A;  3Q1P A;  3Q93 A;  4KYX A;  4JZS A;  2GT2 A;  1NQY A;  1V8W A;  3O61 A;  1PVF A;  3Q2S A;  1XSC A;  1MR2 A;  4K6E A;  1SU2 A;  3F6A A;  3EXQ A;  1V8Y A;  1VC9 A;  2QKM B;  1G9Q A;  1VHG A;  4N1T A;  5FSI A;  3AC9 A;  1X84 A;  5FSL A;  3Q2T A;  5DPK A;  3HHJ A;  4JZV A;  4HFQ A;  5IW4 A;  1Q27 A;  2QJO A;  4NFW A;  5ISY A;  2QJT A;  5ANT A;  3R03 A;  3FSP A;  3O8S A;  4KG3 A;  3RH7 A;  2DUK A;  2B2K A;  3GZ8 A;  3GZ5 A;  1NFS A;  5ANS A;  2Q9P A;  3Q91 A;  2CZR A;  1KT9 A;  3FCM A;  1KTG A;  3DKU A;  2A8Q A;  4S2V A;  5DEQ A;  3X0K A;  2VNP A;  2FML A;  5HZX A;  1TUM A;  2A8T A;  1RRQ A;  1VRL A;  1JKN A;  1X83 A;  2W4E A;  3G0Q A;  3E57 A;  2RRK A;  2A6T A;  3QSJ A;  3X0R A;  3X0I A;  1PUN A;  2XSQ A;  2O5W A;  3X0S A;  3MDG A;  5FSM A;  3X0O A;  2CL3 A;  3DUP A;  4IJX A;  4J7G A;  5DDG A;  2DSC A;  3FJY A;  2PQV A;  1PPW A;  1VIQ A;  3WHW A;  3SHD A;  4ILQ A;  5GHM A;  3ZR0 A;  2VNQ A;  5LPG A;  3A6U A;  4KTB A;  5C7T A;  1MP2 A;  3KVH A;  3J7Y e;  2G73 A;  2DSD A;  2B06 A;  3EES A;  4C9W A;  5ANV A;  2A8R A;  3N77 A;  3O52 A;  3A6S A;  1V8M A;  1XSA A;  1F3Y A;  1RYA A;  1G0S A;  3BM4 A;  2I8T A;  3BHO A;  2FVV A;  4J7H A;  5BS6 A;  5DD4 A;  1PPV A;  3FK9 A;  1VIU A;  2O5F A;  1PPX A;  3X0M A;  1U20 A;  1V8R A;  1XSB A;  2B0V A;  2R5W A;  1KHZ A;  5C7Q A;  2J8Q A;  1NQZ A;  1V8L A;  2YYH A;  5CFI A;  3GRN A;  3X0J A;  4S2W A;  3Q4I A;  3SON A;  1I9A A;  2DSB A;  3I9X A;  1V8I A;  3A6V A;  4MPO A;  2JVB A;  1Q54 A;  3X0P A;  1V8S A;  3H95 A;  1VCD A;  4ZG0 A;  3X0Q A;  5CFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...