2KDWA

Solution structure of rpph mutant e53a from escherichia coli
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
164
structure length
164
Chain Sequence
MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRALFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RNA pyrophosphohydrolase
publication title Solution structure of RppH mutant E53A from Escherichia coli
rcsb
source organism Escherichia coli
total genus 39
structure length 164
sequence length 164
ec nomenclature ec 3.6.1.-:
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2kdwA00
4ILQA 5GHQA 1V8YA 3X0QA 2QKMB 3BHOA 2VNPA 1PUSA 4V14A 3BAPA 4C9WA 3EXQA 3N77A 1PVFA 4ICKA 5DD4A 2YYHA 2JVBA 4KYXA 5FSOA 4S2XA 2I8UA 3E57A 3F13A 2AZWA 2YVNA 5GHIA 2VNQA 5GHMA 3X0LA 1F3YA 2A8PA 3SHDA 1PPWA 2B2KA 1V8VA 2QJOA 2DSBA 1HX3A 5ANVA 5ISYA 2R5WA 3Q1PA 4YOQA 4KG4A 1VK6A 1TUMA 2FKBA 1SZ3A 1Q33A 1KTGA 4JZTA 3FK9A 1K26A 1X84A 1I9AA 2Q9PA 2PNYA 5C7QA 3A6VA 1SOIA 2A8TA 2I8TA 3COUA 2KDWA 4NFWA 1VHZA 5ANUA 3RH7A 5ANWA 5FSMA 5IW5A 3EF5A 1NFSA 2I6KA 4JZSA 4C9XA 2CL3A 2A8QA 1OW2A 3A6TA 5ANTA 2G73A 3U53A 2PQVA 3H95A 1V8RA 2W4EA 3L85A 5FSNA 5C7TA 1PPVA 5GHPA 2B0VA 5FSLA 4K6EA 2GT2A 3GWYA 3MGMA 5FSIA 5BS6A 4JZUA 2FVVA 2DUKA 5GHJA 3F6AA 1SU2A 1G9QA 1NFZA 4HFQA 1MP2A 2GB5A 3Q2SA 3FSPA 4ZG0A 1XSBA 2ICJA 3X0IA 3X0RA 5DDGA 1V8IA 1QVJA 1U20A 3O61A 1K2EA 3EEUA 3I7UA 4MPOA 5DEQA 3P6YA 2O1CA 3O52A 1V8NA 5GHOA 1JRKA 4YPRA 3G0QA 2QJTA 5HZXA 1VC9A 3ACAA 1X83A 1JKNA 2RRKA 2DHOA 3ZR1A 2FMLA 5ANSA 1IRYA 1VRLA 1PPXA 1MK1A 1X51A 5FSKA 3I9XA 1GA7A 2B06A 4KG3A 5GHNA 1V8WA 2XSQA 1V8UA 3FCMA 2YVMA 3GRNA 1KT9A 3CNGA 4DYWA 1HZTA 1VIQA 3Q2TA 2O5FA 3A6UA 5I8UA 1R67A 1VIUA 4N1UA 3BM4A 1RRQA 3MDGA 4S2YA 3X0JA 3AC9A 3KVHA 4IJXA 1PUQA 2A8RA 3X0MA 5BONA 1V8TA 3O8SA 3FJYA 3Q93A 1G0SA 2YVPA 3GG6A 1Q54A 2A6TA 1MQWA 4S2WA 3QSJA 1XSAA 3HYQA 4JZVA 1NQZA 1VCDA 3GZ8A 3X0SA 3J7Ye 3N9UA 3P5TA 3X0PA 1RYAA 2DSDA 1VHGA 2KDVA 3X0NA 3ZR0A 3SONA 1XSCA 3O69A 3O6ZA 5CFJA 4S2VA 3X0KA 4YPHA 2DSCA 1V8LA 3GZ5A 2A8SA 3SMDA 3EESA 5CFIA 1RRSA 3Q91A 1V8MA 3Q4IA 5C8LA 3MCFA 3WHWA 2J8QA 3HHJA 5DPKA 2G74A 4NFXA 1MQEA 2GT4A 2YVOA 5IW4A 3GZ6A 1MR2A 3OGAA 1Q27A 1KHZA 1NQYA 3FFUA 1V8SA 4KTBA 3R03A 1MUTA 1PUNA 5LPGA 3MDIA 2ICKA 3DKUA 3I7VA 2O5WA 3ID9A 4N1TA 3A6SA 4HVYA 1VC8A 3X0OA 1SJYA 3DUPA
chains in the Genus database with same CATH superfamily
4ILQA 5GHQA 1V8YA 3RH7A 3X0QA 2QKMB 3BHOA 2VNPA 1PUSA 4V14A 3BAPA 4C9WA 3EXQA 3N77A 1PVFA 4ICKA 5DD4A 2YYHA 2JVBA 4KYXA 5FSOA 4S2XA 2I8UA 3E57A 3F13A 2AZWA 2YVNA 5GHIA 2VNQA 5GHMA 3X0LA 1F3YA 2A8PA 3SHDA 1PPWA 2B2KA 1V8VA 2QJOA 2DSBA 1HX3A 5ANVA 5ISYA 2R5WA 3Q1PA 4YOQA 4KG4A 1VK6A 1TUMA 2FKBA 1SZ3A 1Q33A 1KTGA 4JZTA 3FK9A 1K26A 1X84A 1I9AA 2Q9PA 2PNYA 5C7QA 3A6VA 1SOIA 2A8TA 2I8TA 3COUA 2KDWA 4NFWA 1VHZA 4J7HA 5ANUA 5ANWA 5FSMA 5IW5A 3EF5A 1NFSA 2I6KA 4JZSA 4C9XA 2CL3A 2A8QA 1OW2A 3A6TA 5ANTA 2G73A 3U53A 2PQVA 3H95A 1V8RA 2W4EA 3L85A 5FSNA 5C7TA 1PPVA 5GHPA 2B0VA 5FSLA 4K6EA 2GT2A 3GWYA 3MGMA 5FSIA 5BS6A 4JZUA 2FVVA 2DUKA 5GHJA 3F6AA 1SU2A 1G9QA 1NFZA 4HFQA 1MP2A 2GB5A 3Q2SA 4J7GA 3FSPA 4ZG0A 1XSBA 2ICJA 3X0IA 3X0RA 5DDGA 1V8IA 1QVJA 1U20A 3O61A 1K2EA 3EEUA 3I7UA 4MPOA 5DEQA 3P6YA 2O1CA 3O52A 1V8NA 5GHOA 1JRKA 4YPRA 3G0QA 2QJTA 5HZXA 1VC9A 3ACAA 1X83A 1JKNA 2RRKA 2DHOA 3ZR1A 2FMLA 5ANSA 1IRYA 1VRLA 1PPXA 1MK1A 1X51A 5FSKA 3I9XA 1GA7A 2B06A 4KG3A 5GHNA 1V8WA 2XSQA 1V8UA 3FCMA 2YVMA 3GRNA 1KT9A 3CNGA 4DYWA 1HZTA 1VIQA 3Q2TA 2O5FA 3A6UA 5I8UA 1R67A 1VIUA 4N1UA 3BM4A 1RRQA 3MDGA 4S2YA 3X0JA 3AC9A 3KVHA 4IJXA 1PUQA 2A8RA 3X0MA 5BONA 1V8TA 3O8SA 3FJYA 3Q93A 1G0SA 2YVPA 3GG6A 1Q54A 2A6TA 1MQWA 4S2WA 3QSJA 1XSAA 3HYQA 4JZVA 1NQZA 1VCDA 3GZ8A 3X0SA 3J7Ye 3N9UA 3P5TA 3X0PA 1RYAA 2DSDA 1VHGA 2KDVA 3X0NA 3ZR0A 3SONA 1XSCA 3O69A 3O6ZA 5CFJA 4S2VA 3X0KA 4YPHA 2CZRA 2DSCA 1V8LA 3GZ5A 2A8SA 3SMDA 3EESA 5CFIA 1RRSA 3Q91A 1V8MA 3Q4IA 5C8LA 3MCFA 3WHWA 2J8QA 3HHJA 5DPKA 2G74A 4NFXA 1MQEA 2GT4A 2YVOA 5IW4A 3GZ6A 1MR2A 3OGAA 1Q27A 1KHZA 1NQYA 3FFUA 1V8SA 4KTBA 3R03A 1MUTA 1PUNA 5LPGA 3MDIA 2ICKA 3DKUA 3I7VA 2O5WA 3ID9A 4N1TA 3A6SA 4HVYA 1VC8A 3X0OA 1SJYA 3DUPA
chains in the Genus database with same CATH topology
4ILQA 5GHQA 1V8YA 3RH7A 3X0QA 2QKMB 3BHOA 2VNPA 1PUSA 4V14A 3BAPA 4C9WA 3EXQA 3N77A 1PVFA 4ICKA 5DD4A 2YYHA 2JVBA 4KYXA 5FSOA 4S2XA 2I8UA 3E57A 3F13A 2AZWA 2YVNA 5GHIA 2VNQA 5GHMA 3X0LA 1F3YA 2A8PA 3SHDA 1PPWA 2B2KA 1V8VA 2QJOA 2DSBA 1HX3A 5ANVA 5ISYA 2R5WA 3Q1PA 4YOQA 4KG4A 1VK6A 1TUMA 2FKBA 1SZ3A 1Q33A 1KTGA 4JZTA 3FK9A 1K26A 1X84A 1I9AA 2Q9PA 2PNYA 5C7QA 3A6VA 1SOIA 2A8TA 2I8TA 3COUA 2KDWA 4NFWA 1VHZA 4J7HA 5ANUA 5ANWA 5FSMA 5IW5A 3EF5A 1NFSA 2I6KA 4JZSA 4C9XA 2CL3A 2A8QA 1OW2A 3A6TA 5ANTA 2G73A 3U53A 2PQVA 3H95A 1V8RA 2W4EA 3L85A 5FSNA 5C7TA 1PPVA 5GHPA 2B0VA 5FSLA 4K6EA 2GT2A 3GWYA 3MGMA 5FSIA 5BS6A 4JZUA 2FVVA 2DUKA 5GHJA 3F6AA 1SU2A 1G9QA 1NFZA 4HFQA 1MP2A 2GB5A 3Q2SA 4J7GA 3FSPA 4ZG0A 1XSBA 2ICJA 3X0IA 3X0RA 5DDGA 1V8IA 1QVJA 1U20A 3O61A 1K2EA 3EEUA 3I7UA 4MPOA 5DEQA 3P6YA 2O1CA 3O52A 1V8NA 5GHOA 1JRKA 4YPRA 3G0QA 2QJTA 5HZXA 1VC9A 3ACAA 1X83A 1JKNA 2RRKA 2DHOA 3ZR1A 2FMLA 5ANSA 1IRYA 1VRLA 1PPXA 1MK1A 1X51A 5FSKA 3I9XA 1GA7A 2B06A 4KG3A 5GHNA 1V8WA 2XSQA 1V8UA 3FCMA 2YVMA 3GRNA 1KT9A 3CNGA 4DYWA 1HZTA 1VIQA 3Q2TA 2O5FA 3A6UA 5I8UA 1R67A 1VIUA 4N1UA 3BM4A 1RRQA 3MDGA 4S2YA 3X0JA 3AC9A 3KVHA 4IJXA 1PUQA 2A8RA 3X0MA 5BONA 1V8TA 3O8SA 3FJYA 3Q93A 1G0SA 2YVPA 3GG6A 1Q54A 2A6TA 1MQWA 4S2WA 3QSJA 1XSAA 3HYQA 4JZVA 1NQZA 1VCDA 3GZ8A 3X0SA 3J7Ye 3N9UA 3P5TA 3X0PA 1RYAA 2DSDA 1VHGA 2KDVA 3X0NA 3ZR0A 3SONA 1XSCA 3O69A 3O6ZA 5CFJA 4S2VA 3X0KA 4YPHA 2CZRA 2DSCA 1V8LA 3GZ5A 2A8SA 3SMDA 3EESA 5CFIA 1RRSA 3Q91A 1V8MA 3Q4IA 5C8LA 3MCFA 3WHWA 2J8QA 3HHJA 5DPKA 2G74A 4NFXA 1MQEA 2GT4A 2YVOA 5IW4A 3GZ6A 1MR2A 3OGAA 1Q27A 1KHZA 1NQYA 3FFUA 1V8SA 4KTBA 3R03A 1MUTA 1PUNA 5LPGA 3MDIA 2ICKA 3DKUA 3I7VA 2O5WA 3ID9A 4N1TA 3A6SA 4HVYA 1VC8A 3X0OA 1SJYA 3DUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILQ A;  5GHQ A;  1V8Y A;  3X0Q A;  2QKM B;  3BHO A;  2VNP A;  1PUS A;  4V14 A;  3BAP A;  4C9W A;  3EXQ A;  3N77 A;  1PVF A;  4ICK A;  5DD4 A;  2YYH A;  2JVB A;  4KYX A;  5FSO A;  4S2X A;  2I8U A;  3E57 A;  3F13 A;  2AZW A;  2YVN A;  5GHI A;  2VNQ A;  5GHM A;  3X0L A;  1F3Y A;  2A8P A;  3SHD A;  1PPW A;  2B2K A;  1V8V A;  2QJO A;  2DSB A;  1HX3 A;  5ANV A;  5ISY A;  2R5W A;  3Q1P A;  4YOQ A;  4KG4 A;  1VK6 A;  1TUM A;  2FKB A;  1SZ3 A;  1Q33 A;  1KTG A;  4JZT A;  3FK9 A;  1K26 A;  1X84 A;  1I9A A;  2Q9P A;  2PNY A;  5C7Q A;  3A6V A;  1SOI A;  2A8T A;  2I8T A;  3COU A;  2KDW A;  4NFW A;  1VHZ A;  5ANU A;  3RH7 A;  5ANW A;  5FSM A;  5IW5 A;  3EF5 A;  1NFS A;  2I6K A;  4JZS A;  4C9X A;  2CL3 A;  2A8Q A;  1OW2 A;  3A6T A;  5ANT A;  2G73 A;  3U53 A;  2PQV A;  3H95 A;  1V8R A;  2W4E A;  3L85 A;  5FSN A;  5C7T A;  1PPV A;  5GHP A;  2B0V A;  5FSL A;  4K6E A;  2GT2 A;  3GWY A;  3MGM A;  5FSI A;  5BS6 A;  4JZU A;  2FVV A;  2DUK A;  5GHJ A;  3F6A A;  1SU2 A;  1G9Q A;  1NFZ A;  4HFQ A;  1MP2 A;  2GB5 A;  3Q2S A;  3FSP A;  4ZG0 A;  1XSB A;  2ICJ A;  3X0I A;  3X0R A;  5DDG A;  1V8I A;  1QVJ A;  1U20 A;  3O61 A;  1K2E A;  3EEU A;  3I7U A;  4MPO A;  5DEQ A;  3P6Y A;  2O1C A;  3O52 A;  1V8N A;  5GHO A;  1JRK A;  4YPR A;  3G0Q A;  2QJT A;  5HZX A;  1VC9 A;  3ACA A;  1X83 A;  1JKN A;  2RRK A;  2DHO A;  3ZR1 A;  2FML A;  5ANS A;  1IRY A;  1VRL A;  1PPX A;  1MK1 A;  1X51 A;  5FSK A;  3I9X A;  1GA7 A;  2B06 A;  4KG3 A;  5GHN A;  1V8W A;  2XSQ A;  1V8U A;  3FCM A;  2YVM A;  3GRN A;  1KT9 A;  3CNG A;  4DYW A;  1HZT A;  1VIQ A;  3Q2T A;  2O5F A;  3A6U A;  5I8U A;  1R67 A;  1VIU A;  4N1U A;  3BM4 A;  1RRQ A;  3MDG A;  4S2Y A;  3X0J A;  3AC9 A;  3KVH A;  4IJX A;  1PUQ A;  2A8R A;  3X0M A;  5BON A;  1V8T A;  3O8S A;  3FJY A;  3Q93 A;  1G0S A;  2YVP A;  3GG6 A;  1Q54 A;  2A6T A;  1MQW A;  4S2W A;  3QSJ A;  1XSA A;  3HYQ A;  4JZV A;  1NQZ A;  1VCD A;  3GZ8 A;  3X0S A;  3J7Y e;  3N9U A;  3P5T A;  3X0P A;  1RYA A;  2DSD A;  1VHG A;  2KDV A;  3X0N A;  3ZR0 A;  3SON A;  1XSC A;  3O69 A;  3O6Z A;  5CFJ A;  4S2V A;  3X0K A;  4YPH A;  2DSC A;  1V8L A;  3GZ5 A;  2A8S A;  3SMD A;  3EES A;  5CFI A;  1RRS A;  3Q91 A;  1V8M A;  3Q4I A;  5C8L A;  3MCF A;  3WHW A;  2J8Q A;  3HHJ A;  5DPK A;  2G74 A;  4NFX A;  1MQE A;  2GT4 A;  2YVO A;  5IW4 A;  3GZ6 A;  1MR2 A;  3OGA A;  1Q27 A;  1KHZ A;  1NQY A;  3FFU A;  1V8S A;  4KTB A;  3R03 A;  1MUT A;  1PUN A;  5LPG A;  3MDI A;  2ICK A;  3DKU A;  3I7V A;  2O5W A;  3ID9 A;  4N1T A;  3A6S A;  4HVY A;  1VC8 A;  3X0O A;  1SJY A;  3DUP A; 
#chains in the Genus database with same CATH topology
 4ILQ A;  5GHQ A;  1V8Y A;  3RH7 A;  3X0Q A;  2QKM B;  3BHO A;  2VNP A;  1PUS A;  4V14 A;  3BAP A;  4C9W A;  3EXQ A;  3N77 A;  1PVF A;  4ICK A;  5DD4 A;  2YYH A;  2JVB A;  4KYX A;  5FSO A;  4S2X A;  2I8U A;  3E57 A;  3F13 A;  2AZW A;  2YVN A;  5GHI A;  2VNQ A;  5GHM A;  3X0L A;  1F3Y A;  2A8P A;  3SHD A;  1PPW A;  2B2K A;  1V8V A;  2QJO A;  2DSB A;  1HX3 A;  5ANV A;  5ISY A;  2R5W A;  3Q1P A;  4YOQ A;  4KG4 A;  1VK6 A;  1TUM A;  2FKB A;  1SZ3 A;  1Q33 A;  1KTG A;  4JZT A;  3FK9 A;  1K26 A;  1X84 A;  1I9A A;  2Q9P A;  2PNY A;  5C7Q A;  3A6V A;  1SOI A;  2A8T A;  2I8T A;  3COU A;  2KDW A;  4NFW A;  1VHZ A;  4J7H A;  5ANU A;  5ANW A;  5FSM A;  5IW5 A;  3EF5 A;  1NFS A;  2I6K A;  4JZS A;  4C9X A;  2CL3 A;  2A8Q A;  1OW2 A;  3A6T A;  5ANT A;  2G73 A;  3U53 A;  2PQV A;  3H95 A;  1V8R A;  2W4E A;  3L85 A;  5FSN A;  5C7T A;  1PPV A;  5GHP A;  2B0V A;  5FSL A;  4K6E A;  2GT2 A;  3GWY A;  3MGM A;  5FSI A;  5BS6 A;  4JZU A;  2FVV A;  2DUK A;  5GHJ A;  3F6A A;  1SU2 A;  1G9Q A;  1NFZ A;  4HFQ A;  1MP2 A;  2GB5 A;  3Q2S A;  4J7G A;  3FSP A;  4ZG0 A;  1XSB A;  2ICJ A;  3X0I A;  3X0R A;  5DDG A;  1V8I A;  1QVJ A;  1U20 A;  3O61 A;  1K2E A;  3EEU A;  3I7U A;  4MPO A;  5DEQ A;  3P6Y A;  2O1C A;  3O52 A;  1V8N A;  5GHO A;  1JRK A;  4YPR A;  3G0Q A;  2QJT A;  5HZX A;  1VC9 A;  3ACA A;  1X83 A;  1JKN A;  2RRK A;  2DHO A;  3ZR1 A;  2FML A;  5ANS A;  1IRY A;  1VRL A;  1PPX A;  1MK1 A;  1X51 A;  5FSK A;  3I9X A;  1GA7 A;  2B06 A;  4KG3 A;  5GHN A;  1V8W A;  2XSQ A;  1V8U A;  3FCM A;  2YVM A;  3GRN A;  1KT9 A;  3CNG A;  4DYW A;  1HZT A;  1VIQ A;  3Q2T A;  2O5F A;  3A6U A;  5I8U A;  1R67 A;  1VIU A;  4N1U A;  3BM4 A;  1RRQ A;  3MDG A;  4S2Y A;  3X0J A;  3AC9 A;  3KVH A;  4IJX A;  1PUQ A;  2A8R A;  3X0M A;  5BON A;  1V8T A;  3O8S A;  3FJY A;  3Q93 A;  1G0S A;  2YVP A;  3GG6 A;  1Q54 A;  2A6T A;  1MQW A;  4S2W A;  3QSJ A;  1XSA A;  3HYQ A;  4JZV A;  1NQZ A;  1VCD A;  3GZ8 A;  3X0S A;  3J7Y e;  3N9U A;  3P5T A;  3X0P A;  1RYA A;  2DSD A;  1VHG A;  2KDV A;  3X0N A;  3ZR0 A;  3SON A;  1XSC A;  3O69 A;  3O6Z A;  5CFJ A;  4S2V A;  3X0K A;  4YPH A;  2CZR A;  2DSC A;  1V8L A;  3GZ5 A;  2A8S A;  3SMD A;  3EES A;  5CFI A;  1RRS A;  3Q91 A;  1V8M A;  3Q4I A;  5C8L A;  3MCF A;  3WHW A;  2J8Q A;  3HHJ A;  5DPK A;  2G74 A;  4NFX A;  1MQE A;  2GT4 A;  2YVO A;  5IW4 A;  3GZ6 A;  1MR2 A;  3OGA A;  1Q27 A;  1KHZ A;  1NQY A;  3FFU A;  1V8S A;  4KTB A;  3R03 A;  1MUT A;  1PUN A;  5LPG A;  3MDI A;  2ICK A;  3DKU A;  3I7V A;  2O5W A;  3ID9 A;  4N1T A;  3A6S A;  4HVY A;  1VC8 A;  3X0O A;  1SJY A;  3DUP A; 
#chains in the Genus database with same CATH homology
 4ILQ A;  5GHQ A;  1V8Y A;  3RH7 A;  3X0Q A;  2QKM B;  3BHO A;  2VNP A;  1PUS A;  4V14 A;  3BAP A;  4C9W A;  3EXQ A;  3N77 A;  1PVF A;  4ICK A;  5DD4 A;  2YYH A;  2JVB A;  4KYX A;  5FSO A;  4S2X A;  2I8U A;  3E57 A;  3F13 A;  2AZW A;  2YVN A;  5GHI A;  2VNQ A;  5GHM A;  3X0L A;  1F3Y A;  2A8P A;  3SHD A;  1PPW A;  2B2K A;  1V8V A;  2QJO A;  2DSB A;  1HX3 A;  5ANV A;  5ISY A;  2R5W A;  3Q1P A;  4YOQ A;  4KG4 A;  1VK6 A;  1TUM A;  2FKB A;  1SZ3 A;  1Q33 A;  1KTG A;  4JZT A;  3FK9 A;  1K26 A;  1X84 A;  1I9A A;  2Q9P A;  2PNY A;  5C7Q A;  3A6V A;  1SOI A;  2A8T A;  2I8T A;  3COU A;  2KDW A;  4NFW A;  1VHZ A;  4J7H A;  5ANU A;  5ANW A;  5FSM A;  5IW5 A;  3EF5 A;  1NFS A;  2I6K A;  4JZS A;  4C9X A;  2CL3 A;  2A8Q A;  1OW2 A;  3A6T A;  5ANT A;  2G73 A;  3U53 A;  2PQV A;  3H95 A;  1V8R A;  2W4E A;  3L85 A;  5FSN A;  5C7T A;  1PPV A;  5GHP A;  2B0V A;  5FSL A;  4K6E A;  2GT2 A;  3GWY A;  3MGM A;  5FSI A;  5BS6 A;  4JZU A;  2FVV A;  2DUK A;  5GHJ A;  3F6A A;  1SU2 A;  1G9Q A;  1NFZ A;  4HFQ A;  1MP2 A;  2GB5 A;  3Q2S A;  4J7G A;  3FSP A;  4ZG0 A;  1XSB A;  2ICJ A;  3X0I A;  3X0R A;  5DDG A;  1V8I A;  1QVJ A;  1U20 A;  3O61 A;  1K2E A;  3EEU A;  3I7U A;  4MPO A;  5DEQ A;  3P6Y A;  2O1C A;  3O52 A;  1V8N A;  5GHO A;  1JRK A;  4YPR A;  3G0Q A;  2QJT A;  5HZX A;  1VC9 A;  3ACA A;  1X83 A;  1JKN A;  2RRK A;  2DHO A;  3ZR1 A;  2FML A;  5ANS A;  1IRY A;  1VRL A;  1PPX A;  1MK1 A;  1X51 A;  5FSK A;  3I9X A;  1GA7 A;  2B06 A;  4KG3 A;  5GHN A;  1V8W A;  2XSQ A;  1V8U A;  3FCM A;  2YVM A;  3GRN A;  1KT9 A;  3CNG A;  4DYW A;  1HZT A;  1VIQ A;  3Q2T A;  2O5F A;  3A6U A;  5I8U A;  1R67 A;  1VIU A;  4N1U A;  3BM4 A;  1RRQ A;  3MDG A;  4S2Y A;  3X0J A;  3AC9 A;  3KVH A;  4IJX A;  1PUQ A;  2A8R A;  3X0M A;  5BON A;  1V8T A;  3O8S A;  3FJY A;  3Q93 A;  1G0S A;  2YVP A;  3GG6 A;  1Q54 A;  2A6T A;  1MQW A;  4S2W A;  3QSJ A;  1XSA A;  3HYQ A;  4JZV A;  1NQZ A;  1VCD A;  3GZ8 A;  3X0S A;  3J7Y e;  3N9U A;  3P5T A;  3X0P A;  1RYA A;  2DSD A;  1VHG A;  2KDV A;  3X0N A;  3ZR0 A;  3SON A;  1XSC A;  3O69 A;  3O6Z A;  5CFJ A;  4S2V A;  3X0K A;  4YPH A;  2CZR A;  2DSC A;  1V8L A;  3GZ5 A;  2A8S A;  3SMD A;  3EES A;  5CFI A;  1RRS A;  3Q91 A;  1V8M A;  3Q4I A;  5C8L A;  3MCF A;  3WHW A;  2J8Q A;  3HHJ A;  5DPK A;  2G74 A;  4NFX A;  1MQE A;  2GT4 A;  2YVO A;  5IW4 A;  3GZ6 A;  1MR2 A;  3OGA A;  1Q27 A;  1KHZ A;  1NQY A;  3FFU A;  1V8S A;  4KTB A;  3R03 A;  1MUT A;  1PUN A;  5LPG A;  3MDI A;  2ICK A;  3DKU A;  3I7V A;  2O5W A;  3ID9 A;  4N1T A;  3A6S A;  4HVY A;  1VC8 A;  3X0O A;  1SJY A;  3DUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...