2CL3A

Crystal structure of human cleavage and polyadenylation specificity factor 5 (cpsf5)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
207
structure length
202
Chain Sequence
GNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLEAVAGE AND POLYADENYLATION SPECIFICITY FACTOR 5
publication title The Crystal Structure of Human Cleavage and Polyadenylation Specific Factor-5 Reveals a Dimeric Nudix Protein with a Conserved Catalytic Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 52
structure length 202
sequence length 207
ec nomenclature
pdb deposition date 2006-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13869 NUDIX_2 Nucleotide hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2cl3A01
1V8YA 3SMDA 3U53A 1XSAA 2A8QA 2DHOA 3X0JA 2KDVA 2AZWA 5GHNA 1TUMA 1HX3A 2XSQA 3I7UA 3CNGA 5DEQA 5I8UA 3X0PA 2DSDA 5C8LA 1RYAA 1KT9A 5IW5A 5GHIA 3RH7A 4ICKA 4KG4A 5FSMA 1V8NA 4HFQA 5GHJA 2FKBA 3O8SA 4K6EA 3EXQA 3I9XA 3N9UA 3ZR1A 3SHDA 4YPHA 2GT2A 2DUKA 2B0VA 2I8UA 3O61A 3GRNA 3BHOA 3Q1PA 1VRLA 4JZUA 1PUSA 2B2KA 2YVMA 1VCDA 4NFXA 1V8LA 1HZTA 1VHZA 3O52A 1V8UA 1V8VA 2DSCA 1Q27A 2A8PA 2O5WA 2QKMB 3F6AA 3N77A 5FSOA 4ZG0A 4N1TA 3MDIA 4C9XA 2GT4A 1SJYA 2I6KA 5CFIA 1NQYA 1RRSA 3A6TA 2B06A 1I9AA 5C7TA 1MR2A 2FMLA 3GG6A 1VC8A 3DUPA 1F3YA 5HZXA 1NFZA 3EESA 3FSPA 1RRQA 3O6ZA 5FSLA 1MP2A 1PPWA 3DKUA 1X51A 3X0QA 1MK1A 4MPOA 5IW4A 1IRYA 2QJTA 3GZ6A 3H95A 2RRKA 1JRKA 1PPVA 1V8IA 3E57A 2DSBA 4NFWA 5ANTA 2Q9PA 4S2XA 3GWYA 3O69A 1U20A 1VHGA 2A8RA 2G74A 3A6SA 3BM4A 1QVJA 2R5WA 5CFJA 5FSKA 3MCFA 5ANWA 3X0OA 3I7VA 2FVVA 3P6YA 2YVNA 3SONA 3EF5A 3FCMA 3X0RA 4IJXA 5BS6A 3Q2SA 1XSCA 1GA7A 2GB5A 3G0QA 3ZR0A 2W4EA 4HVYA 5ANVA 1V8RA 4JZVA 4C9WA 2YVOA 1XSBA 3X0NA 3MGMA 5ANSA 1NQZA 3X0KA 1PUQA 2O5FA 4N1UA 3EEUA 1V8WA 2KDWA 5GHMA 3Q2TA 1MUTA 1NFSA 3KVHA 3Q4IA 2CL3A 2QJOA 5GHOA 2ICJA 1VC9A 3X0IA 2ICKA 3Q93A 5GHPA 1PUNA 2I8TA 3GZ8A 4S2YA 3L85A 3BAPA 4YPRA 5DDGA 2VNPA 1JKNA 3A6VA 4V14A 5ISYA 2YVPA 5DPKA 5FSNA 4KG3A 5DD4A 2J8QA 4S2VA 3J7Ye 5ANUA 3FK9A 1SU2A 3P5TA 2VNQA 3FFUA 1Q33A 5C7QA 2A8TA 3WHWA 1V8SA 1VK6A 1PVFA 2PQVA 1OW2A 1VIQA 3AC9A 4S2WA 5LPGA 3F13A 4KYXA 5FSIA 1X84A 3ACAA 4YOQA 3X0MA 3MDGA 4JZSA 5BONA 1K2EA 1R67A 1KTGA 3Q91A 5GHQA 4DYWA 3HYQA 3R03A 3GZ5A 3QSJA 1X83A 2G73A 1V8MA 2JVBA 1MQWA 1KHZA 3FJYA 4ILQA 1VIUA 1SOIA 1G0SA 1K26A 2PNYA 3COUA 3ID9A 2YYHA 3HHJA 3X0LA 1SZ3A 2A6TA 2O1CA 4JZTA 1PPXA 1Q54A 1V8TA 3X0SA 2A8SA 3A6UA 1G9QA 1MQEA 3OGAA 4KTBA
chains in the Genus database with same CATH superfamily
1V8YA 3SMDA 3U53A 4J7HA 1XSAA 2A8QA 2DHOA 3X0JA 2KDVA 2AZWA 5GHNA 1TUMA 1HX3A 2XSQA 3I7UA 3CNGA 5DEQA 5I8UA 3X0PA 2DSDA 5C8LA 1RYAA 1KT9A 5IW5A 5GHIA 3RH7A 4ICKA 4KG4A 5FSMA 1V8NA 4HFQA 5GHJA 2FKBA 3O8SA 4K6EA 3EXQA 3I9XA 3N9UA 2CZRA 3SHDA 3ZR1A 4YPHA 2GT2A 2DUKA 2B0VA 2I8UA 3O61A 3GRNA 3BHOA 3Q1PA 1VRLA 4JZUA 1PUSA 2B2KA 2YVMA 1VCDA 4NFXA 1V8LA 1HZTA 1VHZA 3O52A 1V8UA 1V8VA 2DSCA 1Q27A 2A8PA 2O5WA 2QKMB 3F6AA 3N77A 5FSOA 4ZG0A 4N1TA 3MDIA 4C9XA 2GT4A 1SJYA 2I6KA 5CFIA 1NQYA 1RRSA 3A6TA 2B06A 1I9AA 5C7TA 1MR2A 2FMLA 3GG6A 1VC8A 3DUPA 1F3YA 5HZXA 1NFZA 3EESA 3FSPA 1RRQA 3O6ZA 5FSLA 1MP2A 1PPWA 3DKUA 1X51A 3X0QA 1MK1A 4MPOA 5IW4A 1IRYA 2QJTA 3GZ6A 3H95A 2RRKA 1JRKA 1PPVA 1V8IA 3E57A 2DSBA 4NFWA 5ANTA 2Q9PA 4S2XA 3GWYA 3O69A 1U20A 1VHGA 2A8RA 2G74A 3A6SA 3BM4A 1QVJA 2R5WA 5CFJA 5FSKA 3MCFA 5ANWA 3X0OA 3I7VA 2FVVA 3P6YA 2YVNA 3SONA 3EF5A 3FCMA 3X0RA 4IJXA 5BS6A 3Q2SA 1XSCA 1GA7A 2GB5A 3G0QA 3ZR0A 2W4EA 4HVYA 5ANVA 1V8RA 4JZVA 4C9WA 2YVOA 1XSBA 3X0NA 3MGMA 5ANSA 1NQZA 3X0KA 1PUQA 2O5FA 4N1UA 3EEUA 1V8WA 2KDWA 5GHMA 3Q2TA 1MUTA 1NFSA 3KVHA 3Q4IA 2CL3A 2QJOA 5GHOA 2ICJA 1VC9A 3X0IA 2ICKA 3Q93A 5GHPA 1PUNA 2I8TA 3GZ8A 4S2YA 3L85A 3BAPA 4YPRA 5DDGA 2VNPA 1JKNA 3A6VA 4V14A 5ISYA 2YVPA 5DPKA 5FSNA 4KG3A 5DD4A 2J8QA 4S2VA 3J7Ye 5ANUA 3FK9A 1SU2A 3P5TA 2VNQA 3FFUA 1Q33A 5C7QA 2A8TA 3WHWA 1V8SA 1VK6A 1PVFA 2PQVA 1OW2A 1VIQA 3AC9A 4S2WA 5LPGA 3F13A 4KYXA 5FSIA 1X84A 3ACAA 4YOQA 3X0MA 3MDGA 4JZSA 5BONA 1K2EA 1R67A 1KTGA 3Q91A 5GHQA 4DYWA 3HYQA 3R03A 3GZ5A 3QSJA 1X83A 2G73A 1V8MA 2JVBA 1MQWA 1KHZA 3FJYA 4ILQA 1VIUA 1SOIA 1G0SA 1K26A 2PNYA 3COUA 3ID9A 2YYHA 3HHJA 3X0LA 1SZ3A 2A6TA 2O1CA 4JZTA 1PPXA 1Q54A 4J7GA 1V8TA 3X0SA 2A8SA 3A6UA 1G9QA 1MQEA 3OGAA 4KTBA
chains in the Genus database with same CATH topology
1V8YA 3SMDA 3U53A 4J7HA 1XSAA 2A8QA 2DHOA 3X0JA 2KDVA 2AZWA 5GHNA 1TUMA 1HX3A 2XSQA 3I7UA 3CNGA 5DEQA 5I8UA 3X0PA 2DSDA 5C8LA 1RYAA 1KT9A 5IW5A 5GHIA 3RH7A 4ICKA 4KG4A 5FSMA 1V8NA 4HFQA 5GHJA 2FKBA 3O8SA 4K6EA 3EXQA 3I9XA 3N9UA 2CZRA 3SHDA 3ZR1A 4YPHA 2GT2A 2DUKA 2B0VA 2I8UA 3O61A 3GRNA 3BHOA 3Q1PA 1VRLA 4JZUA 1PUSA 2B2KA 2YVMA 1VCDA 4NFXA 1V8LA 1HZTA 1VHZA 3O52A 1V8UA 1V8VA 2DSCA 1Q27A 2A8PA 2O5WA 2QKMB 3F6AA 3N77A 5FSOA 4ZG0A 4N1TA 3MDIA 4C9XA 2GT4A 1SJYA 2I6KA 5CFIA 1NQYA 1RRSA 3A6TA 2B06A 1I9AA 5C7TA 1MR2A 2FMLA 3GG6A 1VC8A 3DUPA 1F3YA 5HZXA 1NFZA 3EESA 3FSPA 1RRQA 3O6ZA 5FSLA 1MP2A 1PPWA 3DKUA 1X51A 3X0QA 1MK1A 4MPOA 5IW4A 1IRYA 2QJTA 3GZ6A 3H95A 2RRKA 1JRKA 1PPVA 1V8IA 3E57A 2DSBA 4NFWA 5ANTA 2Q9PA 4S2XA 3GWYA 3O69A 1U20A 1VHGA 2A8RA 2G74A 3A6SA 3BM4A 1QVJA 2R5WA 5CFJA 5FSKA 3MCFA 5ANWA 3X0OA 3I7VA 2FVVA 3P6YA 2YVNA 3SONA 3EF5A 3FCMA 3X0RA 4IJXA 5BS6A 3Q2SA 1XSCA 1GA7A 2GB5A 3G0QA 3ZR0A 2W4EA 4HVYA 5ANVA 1V8RA 4JZVA 4C9WA 2YVOA 1XSBA 3X0NA 3MGMA 5ANSA 1NQZA 3X0KA 1PUQA 2O5FA 4N1UA 3EEUA 1V8WA 2KDWA 5GHMA 3Q2TA 1MUTA 1NFSA 3KVHA 3Q4IA 2CL3A 2QJOA 5GHOA 2ICJA 1VC9A 3X0IA 2ICKA 3Q93A 5GHPA 1PUNA 2I8TA 3GZ8A 4S2YA 3L85A 3BAPA 4YPRA 5DDGA 2VNPA 1JKNA 3A6VA 4V14A 5ISYA 2YVPA 5DPKA 5FSNA 4KG3A 5DD4A 2J8QA 4S2VA 3J7Ye 5ANUA 3FK9A 1SU2A 3P5TA 2VNQA 3FFUA 1Q33A 5C7QA 2A8TA 3WHWA 1V8SA 1VK6A 1PVFA 2PQVA 1OW2A 1VIQA 3AC9A 4S2WA 5LPGA 3F13A 4KYXA 5FSIA 1X84A 3ACAA 4YOQA 3X0MA 3MDGA 4JZSA 5BONA 1K2EA 1R67A 1KTGA 3Q91A 5GHQA 4DYWA 3HYQA 3R03A 3GZ5A 3QSJA 1X83A 2G73A 1V8MA 2JVBA 1MQWA 1KHZA 3FJYA 4ILQA 1VIUA 1SOIA 1G0SA 1K26A 2PNYA 3COUA 3ID9A 2YYHA 3HHJA 3X0LA 1SZ3A 2A6TA 2O1CA 4JZTA 1PPXA 1Q54A 4J7GA 1V8TA 3X0SA 2A8SA 3A6UA 1G9QA 1MQEA 3OGAA 4KTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V8Y A;  3SMD A;  3U53 A;  1XSA A;  2A8Q A;  2DHO A;  3X0J A;  2KDV A;  2AZW A;  5GHN A;  1TUM A;  1HX3 A;  2XSQ A;  3I7U A;  3CNG A;  5DEQ A;  5I8U A;  3X0P A;  2DSD A;  5C8L A;  1RYA A;  1KT9 A;  5IW5 A;  5GHI A;  3RH7 A;  4ICK A;  4KG4 A;  5FSM A;  1V8N A;  4HFQ A;  5GHJ A;  2FKB A;  3O8S A;  4K6E A;  3EXQ A;  3I9X A;  3N9U A;  3ZR1 A;  3SHD A;  4YPH A;  2GT2 A;  2DUK A;  2B0V A;  2I8U A;  3O61 A;  3GRN A;  3BHO A;  3Q1P A;  1VRL A;  4JZU A;  1PUS A;  2B2K A;  2YVM A;  1VCD A;  4NFX A;  1V8L A;  1HZT A;  1VHZ A;  3O52 A;  1V8U A;  1V8V A;  2DSC A;  1Q27 A;  2A8P A;  2O5W A;  2QKM B;  3F6A A;  3N77 A;  5FSO A;  4ZG0 A;  4N1T A;  3MDI A;  4C9X A;  2GT4 A;  1SJY A;  2I6K A;  5CFI A;  1NQY A;  1RRS A;  3A6T A;  2B06 A;  1I9A A;  5C7T A;  1MR2 A;  2FML A;  3GG6 A;  1VC8 A;  3DUP A;  1F3Y A;  5HZX A;  1NFZ A;  3EES A;  3FSP A;  1RRQ A;  3O6Z A;  5FSL A;  1MP2 A;  1PPW A;  3DKU A;  1X51 A;  3X0Q A;  1MK1 A;  4MPO A;  5IW4 A;  1IRY A;  2QJT A;  3GZ6 A;  3H95 A;  2RRK A;  1JRK A;  1PPV A;  1V8I A;  3E57 A;  2DSB A;  4NFW A;  5ANT A;  2Q9P A;  4S2X A;  3GWY A;  3O69 A;  1U20 A;  1VHG A;  2A8R A;  2G74 A;  3A6S A;  3BM4 A;  1QVJ A;  2R5W A;  5CFJ A;  5FSK A;  3MCF A;  5ANW A;  3X0O A;  3I7V A;  2FVV A;  3P6Y A;  2YVN A;  3SON A;  3EF5 A;  3FCM A;  3X0R A;  4IJX A;  5BS6 A;  3Q2S A;  1XSC A;  1GA7 A;  2GB5 A;  3G0Q A;  3ZR0 A;  2W4E A;  4HVY A;  5ANV A;  1V8R A;  4JZV A;  4C9W A;  2YVO A;  1XSB A;  3X0N A;  3MGM A;  5ANS A;  1NQZ A;  3X0K A;  1PUQ A;  2O5F A;  4N1U A;  3EEU A;  1V8W A;  2KDW A;  5GHM A;  3Q2T A;  1MUT A;  1NFS A;  3KVH A;  3Q4I A;  2CL3 A;  2QJO A;  5GHO A;  2ICJ A;  1VC9 A;  3X0I A;  2ICK A;  3Q93 A;  5GHP A;  1PUN A;  2I8T A;  3GZ8 A;  4S2Y A;  3L85 A;  3BAP A;  4YPR A;  5DDG A;  2VNP A;  1JKN A;  3A6V A;  4V14 A;  5ISY A;  2YVP A;  5DPK A;  5FSN A;  4KG3 A;  5DD4 A;  2J8Q A;  4S2V A;  3J7Y e;  5ANU A;  3FK9 A;  1SU2 A;  3P5T A;  2VNQ A;  3FFU A;  1Q33 A;  5C7Q A;  2A8T A;  3WHW A;  1V8S A;  1VK6 A;  1PVF A;  2PQV A;  1OW2 A;  1VIQ A;  3AC9 A;  4S2W A;  5LPG A;  3F13 A;  4KYX A;  5FSI A;  1X84 A;  3ACA A;  4YOQ A;  3X0M A;  3MDG A;  4JZS A;  5BON A;  1K2E A;  1R67 A;  1KTG A;  3Q91 A;  5GHQ A;  4DYW A;  3HYQ A;  3R03 A;  3GZ5 A;  3QSJ A;  1X83 A;  2G73 A;  1V8M A;  2JVB A;  1MQW A;  1KHZ A;  3FJY A;  4ILQ A;  1VIU A;  1SOI A;  1G0S A;  1K26 A;  2PNY A;  3COU A;  3ID9 A;  2YYH A;  3HHJ A;  3X0L A;  1SZ3 A;  2A6T A;  2O1C A;  4JZT A;  1PPX A;  1Q54 A;  1V8T A;  3X0S A;  2A8S A;  3A6U A;  1G9Q A;  1MQE A;  3OGA A;  4KTB A; 
#chains in the Genus database with same CATH topology
 1V8Y A;  3SMD A;  3U53 A;  4J7H A;  1XSA A;  2A8Q A;  2DHO A;  3X0J A;  2KDV A;  2AZW A;  5GHN A;  1TUM A;  1HX3 A;  2XSQ A;  3I7U A;  3CNG A;  5DEQ A;  5I8U A;  3X0P A;  2DSD A;  5C8L A;  1RYA A;  1KT9 A;  5IW5 A;  5GHI A;  3RH7 A;  4ICK A;  4KG4 A;  5FSM A;  1V8N A;  4HFQ A;  5GHJ A;  2FKB A;  3O8S A;  4K6E A;  3EXQ A;  3I9X A;  3N9U A;  2CZR A;  3SHD A;  3ZR1 A;  4YPH A;  2GT2 A;  2DUK A;  2B0V A;  2I8U A;  3O61 A;  3GRN A;  3BHO A;  3Q1P A;  1VRL A;  4JZU A;  1PUS A;  2B2K A;  2YVM A;  1VCD A;  4NFX A;  1V8L A;  1HZT A;  1VHZ A;  3O52 A;  1V8U A;  1V8V A;  2DSC A;  1Q27 A;  2A8P A;  2O5W A;  2QKM B;  3F6A A;  3N77 A;  5FSO A;  4ZG0 A;  4N1T A;  3MDI A;  4C9X A;  2GT4 A;  1SJY A;  2I6K A;  5CFI A;  1NQY A;  1RRS A;  3A6T A;  2B06 A;  1I9A A;  5C7T A;  1MR2 A;  2FML A;  3GG6 A;  1VC8 A;  3DUP A;  1F3Y A;  5HZX A;  1NFZ A;  3EES A;  3FSP A;  1RRQ A;  3O6Z A;  5FSL A;  1MP2 A;  1PPW A;  3DKU A;  1X51 A;  3X0Q A;  1MK1 A;  4MPO A;  5IW4 A;  1IRY A;  2QJT A;  3GZ6 A;  3H95 A;  2RRK A;  1JRK A;  1PPV A;  1V8I A;  3E57 A;  2DSB A;  4NFW A;  5ANT A;  2Q9P A;  4S2X A;  3GWY A;  3O69 A;  1U20 A;  1VHG A;  2A8R A;  2G74 A;  3A6S A;  3BM4 A;  1QVJ A;  2R5W A;  5CFJ A;  5FSK A;  3MCF A;  5ANW A;  3X0O A;  3I7V A;  2FVV A;  3P6Y A;  2YVN A;  3SON A;  3EF5 A;  3FCM A;  3X0R A;  4IJX A;  5BS6 A;  3Q2S A;  1XSC A;  1GA7 A;  2GB5 A;  3G0Q A;  3ZR0 A;  2W4E A;  4HVY A;  5ANV A;  1V8R A;  4JZV A;  4C9W A;  2YVO A;  1XSB A;  3X0N A;  3MGM A;  5ANS A;  1NQZ A;  3X0K A;  1PUQ A;  2O5F A;  4N1U A;  3EEU A;  1V8W A;  2KDW A;  5GHM A;  3Q2T A;  1MUT A;  1NFS A;  3KVH A;  3Q4I A;  2CL3 A;  2QJO A;  5GHO A;  2ICJ A;  1VC9 A;  3X0I A;  2ICK A;  3Q93 A;  5GHP A;  1PUN A;  2I8T A;  3GZ8 A;  4S2Y A;  3L85 A;  3BAP A;  4YPR A;  5DDG A;  2VNP A;  1JKN A;  3A6V A;  4V14 A;  5ISY A;  2YVP A;  5DPK A;  5FSN A;  4KG3 A;  5DD4 A;  2J8Q A;  4S2V A;  3J7Y e;  5ANU A;  3FK9 A;  1SU2 A;  3P5T A;  2VNQ A;  3FFU A;  1Q33 A;  5C7Q A;  2A8T A;  3WHW A;  1V8S A;  1VK6 A;  1PVF A;  2PQV A;  1OW2 A;  1VIQ A;  3AC9 A;  4S2W A;  5LPG A;  3F13 A;  4KYX A;  5FSI A;  1X84 A;  3ACA A;  4YOQ A;  3X0M A;  3MDG A;  4JZS A;  5BON A;  1K2E A;  1R67 A;  1KTG A;  3Q91 A;  5GHQ A;  4DYW A;  3HYQ A;  3R03 A;  3GZ5 A;  3QSJ A;  1X83 A;  2G73 A;  1V8M A;  2JVB A;  1MQW A;  1KHZ A;  3FJY A;  4ILQ A;  1VIU A;  1SOI A;  1G0S A;  1K26 A;  2PNY A;  3COU A;  3ID9 A;  2YYH A;  3HHJ A;  3X0L A;  1SZ3 A;  2A6T A;  2O1C A;  4JZT A;  1PPX A;  1Q54 A;  4J7G A;  1V8T A;  3X0S A;  2A8S A;  3A6U A;  1G9Q A;  1MQE A;  3OGA A;  4KTB A; 
#chains in the Genus database with same CATH homology
 1V8Y A;  3SMD A;  3U53 A;  4J7H A;  1XSA A;  2A8Q A;  2DHO A;  3X0J A;  2KDV A;  2AZW A;  5GHN A;  1TUM A;  1HX3 A;  2XSQ A;  3I7U A;  3CNG A;  5DEQ A;  5I8U A;  3X0P A;  2DSD A;  5C8L A;  1RYA A;  1KT9 A;  5IW5 A;  5GHI A;  3RH7 A;  4ICK A;  4KG4 A;  5FSM A;  1V8N A;  4HFQ A;  5GHJ A;  2FKB A;  3O8S A;  4K6E A;  3EXQ A;  3I9X A;  3N9U A;  2CZR A;  3SHD A;  3ZR1 A;  4YPH A;  2GT2 A;  2DUK A;  2B0V A;  2I8U A;  3O61 A;  3GRN A;  3BHO A;  3Q1P A;  1VRL A;  4JZU A;  1PUS A;  2B2K A;  2YVM A;  1VCD A;  4NFX A;  1V8L A;  1HZT A;  1VHZ A;  3O52 A;  1V8U A;  1V8V A;  2DSC A;  1Q27 A;  2A8P A;  2O5W A;  2QKM B;  3F6A A;  3N77 A;  5FSO A;  4ZG0 A;  4N1T A;  3MDI A;  4C9X A;  2GT4 A;  1SJY A;  2I6K A;  5CFI A;  1NQY A;  1RRS A;  3A6T A;  2B06 A;  1I9A A;  5C7T A;  1MR2 A;  2FML A;  3GG6 A;  1VC8 A;  3DUP A;  1F3Y A;  5HZX A;  1NFZ A;  3EES A;  3FSP A;  1RRQ A;  3O6Z A;  5FSL A;  1MP2 A;  1PPW A;  3DKU A;  1X51 A;  3X0Q A;  1MK1 A;  4MPO A;  5IW4 A;  1IRY A;  2QJT A;  3GZ6 A;  3H95 A;  2RRK A;  1JRK A;  1PPV A;  1V8I A;  3E57 A;  2DSB A;  4NFW A;  5ANT A;  2Q9P A;  4S2X A;  3GWY A;  3O69 A;  1U20 A;  1VHG A;  2A8R A;  2G74 A;  3A6S A;  3BM4 A;  1QVJ A;  2R5W A;  5CFJ A;  5FSK A;  3MCF A;  5ANW A;  3X0O A;  3I7V A;  2FVV A;  3P6Y A;  2YVN A;  3SON A;  3EF5 A;  3FCM A;  3X0R A;  4IJX A;  5BS6 A;  3Q2S A;  1XSC A;  1GA7 A;  2GB5 A;  3G0Q A;  3ZR0 A;  2W4E A;  4HVY A;  5ANV A;  1V8R A;  4JZV A;  4C9W A;  2YVO A;  1XSB A;  3X0N A;  3MGM A;  5ANS A;  1NQZ A;  3X0K A;  1PUQ A;  2O5F A;  4N1U A;  3EEU A;  1V8W A;  2KDW A;  5GHM A;  3Q2T A;  1MUT A;  1NFS A;  3KVH A;  3Q4I A;  2CL3 A;  2QJO A;  5GHO A;  2ICJ A;  1VC9 A;  3X0I A;  2ICK A;  3Q93 A;  5GHP A;  1PUN A;  2I8T A;  3GZ8 A;  4S2Y A;  3L85 A;  3BAP A;  4YPR A;  5DDG A;  2VNP A;  1JKN A;  3A6V A;  4V14 A;  5ISY A;  2YVP A;  5DPK A;  5FSN A;  4KG3 A;  5DD4 A;  2J8Q A;  4S2V A;  3J7Y e;  5ANU A;  3FK9 A;  1SU2 A;  3P5T A;  2VNQ A;  3FFU A;  1Q33 A;  5C7Q A;  2A8T A;  3WHW A;  1V8S A;  1VK6 A;  1PVF A;  2PQV A;  1OW2 A;  1VIQ A;  3AC9 A;  4S2W A;  5LPG A;  3F13 A;  4KYX A;  5FSI A;  1X84 A;  3ACA A;  4YOQ A;  3X0M A;  3MDG A;  4JZS A;  5BON A;  1K2E A;  1R67 A;  1KTG A;  3Q91 A;  5GHQ A;  4DYW A;  3HYQ A;  3R03 A;  3GZ5 A;  3QSJ A;  1X83 A;  2G73 A;  1V8M A;  2JVB A;  1MQW A;  1KHZ A;  3FJY A;  4ILQ A;  1VIU A;  1SOI A;  1G0S A;  1K26 A;  2PNY A;  3COU A;  3ID9 A;  2YYH A;  3HHJ A;  3X0L A;  1SZ3 A;  2A6T A;  2O1C A;  4JZT A;  1PPX A;  1Q54 A;  4J7G A;  1V8T A;  3X0S A;  2A8S A;  3A6U A;  1G9Q A;  1MQE A;  3OGA A;  4KTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...