3BAPA

Crystal structure of the 25 kda subunit of human cleavage factor im
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
207
structure length
203
Chain Sequence
GNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Cleavage and polyadenylation specificity factor subunit 5
publication title Crystal structure of the 25 kDa subunit of human cleavage factor Im.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 203
sequence length 207
ec nomenclature
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13869 NUDIX_2 Nucleotide hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3bapA01
3Q2SA 4ICKA 5ANSA 2VNQA 3FFUA 4S2XA 1I9AA 2B0VA 1F3YA 5GHJA 1X84A 2DUKA 2GT2A 2DSBA 2DSDA 3X0LA 3X0NA 3Q2TA 4N1TA 5GHMA 2YVOA 3X0PA 5C7QA 3BM4A 3Q93A 1R67A 2KDVA 4HFQA 5C8LA 3COUA 1V8IA 1V8RA 2CL3A 3O69A 2O5WA 1VHGA 3GZ5A 1PUQA 2A8SA 2I6KA 3F13A 3ID9A 4JZTA 4NFWA 5I8UA 5ANTA 5BONA 1KTGA 5FSOA 2GT4A 3GRNA 2QJTA 4YOQA 3MDGA 2AZWA 1SU2A 5GHIA 1KT9A 1SZ3A 1VHZA 2JVBA 1X83A 2PQVA 2R5WA 2YVNA 3KVHA 3I7UA 3O8SA 4MPOA 1MQWA 1MK1A 1K26A 1RRQA 1Q54A 1NFZA 4C9XA 1VIUA 4HVYA 1IRYA 2B06A 5C7TA 3EEUA 3DKUA 5GHPA 5FSMA 2FMLA 3HHJA 5FSKA 2O5FA 5FSIA 3FSPA 5CFJA 3MDIA 2QKMB 4N1UA 3G0QA 2G73A 1V8LA 4JZUA 2DSCA 1VK6A 2VNPA 2A8RA 2J8QA 3A6UA 3GG6A 1SJYA 4ILQA 3ZR0A 3MGMA 1K2EA 5GHQA 5DDGA 2DHOA 3BHOA 2ICJA 2A8PA 2GB5A 3DUPA 3A6VA 3E57A 4KYXA 5ANVA 5GHOA 3H95A 3HYQA 4KG3A 4C9WA 3L85A 1Q33A 3CNGA 4KTBA 3GWYA 3A6TA 1XSBA 2RRKA 3EESA 3ACAA 2ICKA 2I8TA 4YPHA 4S2VA 4JZVA 3BAPA 1JRKA 1RYAA 3O6ZA 2B2KA 1MUTA 5FSNA 3OGAA 3X0MA 5BS6A 3SMDA 3X0QA 1HX3A 3Q4IA 1MQEA 2KDWA 2I8UA 1RRSA 4S2WA 2XSQA 1PVFA 1V8UA 5GHNA 2PNYA 1NFSA 1U20A 1VRLA 1VCDA 1PPWA 3X0KA 1PPVA 5IW4A 5IW5A 3FK9A 3GZ8A 2A8QA 3FCMA 3O52A 3SHDA 2Q9PA 3Q91A 3X0OA 5FSLA 3R03A 1VC9A 2YYHA 2QJOA 3I9XA 3X0IA 3SONA 4IJXA 3U53A 5ANUA 5DD4A 1V8VA 1G0SA 1V8TA 3N77A 3WHWA 3FJYA 3J7Ye 1V8NA 4K6EA 3A6SA 1PPXA 1GA7A 3EXQA 4JZSA 1NQZA 1QVJA 1XSAA 1HZTA 2FVVA 3X0JA 1NQYA 1MR2A 3AC9A 4KG4A 3P6YA 4NFXA 2A8TA 3ZR1A 5ISYA 3O61A 3RH7A 1V8YA 2YVMA 1V8SA 3F6AA 5CFIA 1KHZA 1PUNA 2O1CA 4V14A 4ZG0A 3P5TA 3GZ6A 1X51A 1TUMA 1JKNA 5DEQA 1V8MA 2W4EA 3Q1PA 2A6TA 3MCFA 2YVPA 3X0RA 1OW2A 1VC8A 1G9QA 2G74A 5ANWA 1VIQA 5LPGA 2FKBA 3QSJA 1Q27A 3X0SA 5HZXA 1PUSA 4S2YA 1V8WA 3N9UA 3EF5A 3I7VA 1MP2A 4DYWA 1XSCA 5DPKA 1SOIA 4YPRA
chains in the Genus database with same CATH superfamily
3Q2SA 4ICKA 5ANSA 2VNQA 3FFUA 4S2XA 1I9AA 2B0VA 1F3YA 5GHJA 1X84A 2DUKA 2GT2A 2DSBA 2DSDA 3X0LA 3X0NA 3Q2TA 4N1TA 5GHMA 2YVOA 3X0PA 5C7QA 3BM4A 3Q93A 1R67A 2KDVA 4HFQA 5C8LA 3COUA 1V8IA 1V8RA 2CL3A 3O69A 2O5WA 1VHGA 3GZ5A 1PUQA 2A8SA 2I6KA 3F13A 3ID9A 4JZTA 4NFWA 5I8UA 5ANTA 2CZRA 5BONA 1KTGA 5FSOA 2GT4A 3GRNA 2QJTA 4YOQA 3MDGA 2AZWA 1SU2A 5GHIA 1KT9A 1SZ3A 1VHZA 2JVBA 1X83A 2PQVA 2R5WA 2YVNA 3KVHA 3I7UA 3O8SA 4MPOA 1MQWA 1MK1A 1K26A 1RRQA 1Q54A 1NFZA 4C9XA 1VIUA 4HVYA 1IRYA 2B06A 5C7TA 3EEUA 3DKUA 5GHPA 5FSMA 2FMLA 3HHJA 5FSKA 2O5FA 5FSIA 3FSPA 5CFJA 3MDIA 2QKMB 4N1UA 3G0QA 2G73A 4J7HA 1V8LA 4JZUA 2DSCA 1VK6A 2VNPA 2A8RA 2J8QA 3A6UA 3GG6A 1SJYA 4ILQA 3ZR0A 3MGMA 1K2EA 5GHQA 5DDGA 2DHOA 3BHOA 2ICJA 2A8PA 2GB5A 3DUPA 3A6VA 3E57A 4KYXA 5ANVA 5GHOA 3H95A 3HYQA 4KG3A 4C9WA 3L85A 1Q33A 3CNGA 4KTBA 3GWYA 3A6TA 1XSBA 2RRKA 3EESA 3ACAA 2ICKA 2I8TA 4YPHA 4S2VA 4JZVA 3BAPA 1JRKA 1RYAA 3O6ZA 2B2KA 1MUTA 5FSNA 3OGAA 3X0MA 5BS6A 3SMDA 3X0QA 1HX3A 3Q4IA 1MQEA 2KDWA 2I8UA 1RRSA 4S2WA 2XSQA 1PVFA 1V8UA 5GHNA 2PNYA 1NFSA 1U20A 1VRLA 1VCDA 1PPWA 3X0KA 1PPVA 5IW4A 5IW5A 3FK9A 3GZ8A 2A8QA 3FCMA 3O52A 3SHDA 2Q9PA 3Q91A 3X0OA 5FSLA 3R03A 1VC9A 2YYHA 2QJOA 3I9XA 3X0IA 3SONA 4IJXA 3U53A 5ANUA 5DD4A 1V8VA 1G0SA 1V8TA 3N77A 3WHWA 3FJYA 3J7Ye 1V8NA 4K6EA 3A6SA 1PPXA 1GA7A 3EXQA 4JZSA 1NQZA 1QVJA 1XSAA 1HZTA 2FVVA 3X0JA 4J7GA 1NQYA 1MR2A 3AC9A 4KG4A 3P6YA 4NFXA 2A8TA 3ZR1A 5ISYA 3O61A 3RH7A 1V8YA 2YVMA 1V8SA 3F6AA 5CFIA 1KHZA 1PUNA 2O1CA 4V14A 4ZG0A 3P5TA 3GZ6A 1X51A 1TUMA 1JKNA 5DEQA 1V8MA 2W4EA 3Q1PA 2A6TA 3MCFA 2YVPA 3X0RA 1OW2A 1VC8A 1G9QA 2G74A 5ANWA 1VIQA 5LPGA 2FKBA 3QSJA 1Q27A 3X0SA 5HZXA 1PUSA 4S2YA 1V8WA 3N9UA 3EF5A 3I7VA 1MP2A 4DYWA 1XSCA 5DPKA 1SOIA 4YPRA
chains in the Genus database with same CATH topology
3Q2SA 4ICKA 5ANSA 2VNQA 3FFUA 4S2XA 1I9AA 2B0VA 1F3YA 5GHJA 1X84A 2DUKA 2GT2A 2DSBA 2DSDA 3X0LA 3X0NA 3Q2TA 4N1TA 5GHMA 2YVOA 3X0PA 5C7QA 3BM4A 3Q93A 1R67A 2KDVA 4HFQA 5C8LA 3COUA 1V8IA 1V8RA 2CL3A 3O69A 2O5WA 1VHGA 3GZ5A 1PUQA 2A8SA 2I6KA 3F13A 3ID9A 4JZTA 4NFWA 5I8UA 5ANTA 2CZRA 5BONA 1KTGA 5FSOA 2GT4A 3GRNA 2QJTA 4YOQA 3MDGA 2AZWA 1SU2A 5GHIA 1KT9A 1SZ3A 1VHZA 2JVBA 1X83A 2PQVA 2R5WA 2YVNA 3KVHA 3I7UA 3O8SA 4MPOA 1MQWA 1MK1A 1K26A 1RRQA 1Q54A 1NFZA 4C9XA 1VIUA 4HVYA 1IRYA 2B06A 5C7TA 3EEUA 3DKUA 5GHPA 5FSMA 2FMLA 3HHJA 5FSKA 2O5FA 5FSIA 3FSPA 5CFJA 3MDIA 2QKMB 4N1UA 3G0QA 2G73A 4J7HA 1V8LA 4JZUA 2DSCA 1VK6A 2VNPA 2A8RA 2J8QA 3A6UA 3GG6A 1SJYA 4ILQA 3ZR0A 3MGMA 1K2EA 5GHQA 5DDGA 2DHOA 3BHOA 2ICJA 2A8PA 2GB5A 3DUPA 3A6VA 3E57A 4KYXA 5ANVA 5GHOA 3H95A 3HYQA 4KG3A 4C9WA 3L85A 1Q33A 3CNGA 4KTBA 3GWYA 3A6TA 1XSBA 2RRKA 3EESA 3ACAA 2ICKA 2I8TA 4YPHA 4S2VA 4JZVA 3BAPA 1JRKA 1RYAA 3O6ZA 2B2KA 1MUTA 5FSNA 3OGAA 3X0MA 5BS6A 3SMDA 3X0QA 1HX3A 3Q4IA 1MQEA 2KDWA 2I8UA 1RRSA 4S2WA 2XSQA 1PVFA 1V8UA 5GHNA 2PNYA 1NFSA 1U20A 1VRLA 1VCDA 1PPWA 3X0KA 1PPVA 5IW4A 5IW5A 3FK9A 3GZ8A 2A8QA 3FCMA 3O52A 3SHDA 2Q9PA 3Q91A 3X0OA 5FSLA 3R03A 1VC9A 2YYHA 2QJOA 3I9XA 3X0IA 3SONA 4IJXA 3U53A 5ANUA 5DD4A 1V8VA 1G0SA 1V8TA 3N77A 3WHWA 3FJYA 3J7Ye 1V8NA 4K6EA 3A6SA 1PPXA 1GA7A 3EXQA 4JZSA 1NQZA 1QVJA 1XSAA 1HZTA 2FVVA 3X0JA 4J7GA 1NQYA 1MR2A 3AC9A 4KG4A 3P6YA 4NFXA 2A8TA 3ZR1A 5ISYA 3O61A 3RH7A 1V8YA 2YVMA 1V8SA 3F6AA 5CFIA 1KHZA 1PUNA 2O1CA 4V14A 4ZG0A 3P5TA 3GZ6A 1X51A 1TUMA 1JKNA 5DEQA 1V8MA 2W4EA 3Q1PA 2A6TA 3MCFA 2YVPA 3X0RA 1OW2A 1VC8A 1G9QA 2G74A 5ANWA 1VIQA 5LPGA 2FKBA 3QSJA 1Q27A 3X0SA 5HZXA 1PUSA 4S2YA 1V8WA 3N9UA 3EF5A 3I7VA 1MP2A 4DYWA 1XSCA 5DPKA 1SOIA 4YPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q2S A;  4ICK A;  5ANS A;  2VNQ A;  3FFU A;  4S2X A;  1I9A A;  2B0V A;  1F3Y A;  5GHJ A;  1X84 A;  2DUK A;  2GT2 A;  2DSB A;  2DSD A;  3X0L A;  3X0N A;  3Q2T A;  4N1T A;  5GHM A;  2YVO A;  3X0P A;  5C7Q A;  3BM4 A;  3Q93 A;  1R67 A;  2KDV A;  4HFQ A;  5C8L A;  3COU A;  1V8I A;  1V8R A;  2CL3 A;  3O69 A;  2O5W A;  1VHG A;  3GZ5 A;  1PUQ A;  2A8S A;  2I6K A;  3F13 A;  3ID9 A;  4JZT A;  4NFW A;  5I8U A;  5ANT A;  5BON A;  1KTG A;  5FSO A;  2GT4 A;  3GRN A;  2QJT A;  4YOQ A;  3MDG A;  2AZW A;  1SU2 A;  5GHI A;  1KT9 A;  1SZ3 A;  1VHZ A;  2JVB A;  1X83 A;  2PQV A;  2R5W A;  2YVN A;  3KVH A;  3I7U A;  3O8S A;  4MPO A;  1MQW A;  1MK1 A;  1K26 A;  1RRQ A;  1Q54 A;  1NFZ A;  4C9X A;  1VIU A;  4HVY A;  1IRY A;  2B06 A;  5C7T A;  3EEU A;  3DKU A;  5GHP A;  5FSM A;  2FML A;  3HHJ A;  5FSK A;  2O5F A;  5FSI A;  3FSP A;  5CFJ A;  3MDI A;  2QKM B;  4N1U A;  3G0Q A;  2G73 A;  1V8L A;  4JZU A;  2DSC A;  1VK6 A;  2VNP A;  2A8R A;  2J8Q A;  3A6U A;  3GG6 A;  1SJY A;  4ILQ A;  3ZR0 A;  3MGM A;  1K2E A;  5GHQ A;  5DDG A;  2DHO A;  3BHO A;  2ICJ A;  2A8P A;  2GB5 A;  3DUP A;  3A6V A;  3E57 A;  4KYX A;  5ANV A;  5GHO A;  3H95 A;  3HYQ A;  4KG3 A;  4C9W A;  3L85 A;  1Q33 A;  3CNG A;  4KTB A;  3GWY A;  3A6T A;  1XSB A;  2RRK A;  3EES A;  3ACA A;  2ICK A;  2I8T A;  4YPH A;  4S2V A;  4JZV A;  3BAP A;  1JRK A;  1RYA A;  3O6Z A;  2B2K A;  1MUT A;  5FSN A;  3OGA A;  3X0M A;  5BS6 A;  3SMD A;  3X0Q A;  1HX3 A;  3Q4I A;  1MQE A;  2KDW A;  2I8U A;  1RRS A;  4S2W A;  2XSQ A;  1PVF A;  1V8U A;  5GHN A;  2PNY A;  1NFS A;  1U20 A;  1VRL A;  1VCD A;  1PPW A;  3X0K A;  1PPV A;  5IW4 A;  5IW5 A;  3FK9 A;  3GZ8 A;  2A8Q A;  3FCM A;  3O52 A;  3SHD A;  2Q9P A;  3Q91 A;  3X0O A;  5FSL A;  3R03 A;  1VC9 A;  2YYH A;  2QJO A;  3I9X A;  3X0I A;  3SON A;  4IJX A;  3U53 A;  5ANU A;  5DD4 A;  1V8V A;  1G0S A;  1V8T A;  3N77 A;  3WHW A;  3FJY A;  3J7Y e;  1V8N A;  4K6E A;  3A6S A;  1PPX A;  1GA7 A;  3EXQ A;  4JZS A;  1NQZ A;  1QVJ A;  1XSA A;  1HZT A;  2FVV A;  3X0J A;  1NQY A;  1MR2 A;  3AC9 A;  4KG4 A;  3P6Y A;  4NFX A;  2A8T A;  3ZR1 A;  5ISY A;  3O61 A;  3RH7 A;  1V8Y A;  2YVM A;  1V8S A;  3F6A A;  5CFI A;  1KHZ A;  1PUN A;  2O1C A;  4V14 A;  4ZG0 A;  3P5T A;  3GZ6 A;  1X51 A;  1TUM A;  1JKN A;  5DEQ A;  1V8M A;  2W4E A;  3Q1P A;  2A6T A;  3MCF A;  2YVP A;  3X0R A;  1OW2 A;  1VC8 A;  1G9Q A;  2G74 A;  5ANW A;  1VIQ A;  5LPG A;  2FKB A;  3QSJ A;  1Q27 A;  3X0S A;  5HZX A;  1PUS A;  4S2Y A;  1V8W A;  3N9U A;  3EF5 A;  3I7V A;  1MP2 A;  4DYW A;  1XSC A;  5DPK A;  1SOI A;  4YPR A; 
#chains in the Genus database with same CATH topology
 3Q2S A;  4ICK A;  5ANS A;  2VNQ A;  3FFU A;  4S2X A;  1I9A A;  2B0V A;  1F3Y A;  5GHJ A;  1X84 A;  2DUK A;  2GT2 A;  2DSB A;  2DSD A;  3X0L A;  3X0N A;  3Q2T A;  4N1T A;  5GHM A;  2YVO A;  3X0P A;  5C7Q A;  3BM4 A;  3Q93 A;  1R67 A;  2KDV A;  4HFQ A;  5C8L A;  3COU A;  1V8I A;  1V8R A;  2CL3 A;  3O69 A;  2O5W A;  1VHG A;  3GZ5 A;  1PUQ A;  2A8S A;  2I6K A;  3F13 A;  3ID9 A;  4JZT A;  4NFW A;  5I8U A;  5ANT A;  2CZR A;  5BON A;  1KTG A;  5FSO A;  2GT4 A;  3GRN A;  2QJT A;  4YOQ A;  3MDG A;  2AZW A;  1SU2 A;  5GHI A;  1KT9 A;  1SZ3 A;  1VHZ A;  2JVB A;  1X83 A;  2PQV A;  2R5W A;  2YVN A;  3KVH A;  3I7U A;  3O8S A;  4MPO A;  1MQW A;  1MK1 A;  1K26 A;  1RRQ A;  1Q54 A;  1NFZ A;  4C9X A;  1VIU A;  4HVY A;  1IRY A;  2B06 A;  5C7T A;  3EEU A;  3DKU A;  5GHP A;  5FSM A;  2FML A;  3HHJ A;  5FSK A;  2O5F A;  5FSI A;  3FSP A;  5CFJ A;  3MDI A;  2QKM B;  4N1U A;  3G0Q A;  2G73 A;  4J7H A;  1V8L A;  4JZU A;  2DSC A;  1VK6 A;  2VNP A;  2A8R A;  2J8Q A;  3A6U A;  3GG6 A;  1SJY A;  4ILQ A;  3ZR0 A;  3MGM A;  1K2E A;  5GHQ A;  5DDG A;  2DHO A;  3BHO A;  2ICJ A;  2A8P A;  2GB5 A;  3DUP A;  3A6V A;  3E57 A;  4KYX A;  5ANV A;  5GHO A;  3H95 A;  3HYQ A;  4KG3 A;  4C9W A;  3L85 A;  1Q33 A;  3CNG A;  4KTB A;  3GWY A;  3A6T A;  1XSB A;  2RRK A;  3EES A;  3ACA A;  2ICK A;  2I8T A;  4YPH A;  4S2V A;  4JZV A;  3BAP A;  1JRK A;  1RYA A;  3O6Z A;  2B2K A;  1MUT A;  5FSN A;  3OGA A;  3X0M A;  5BS6 A;  3SMD A;  3X0Q A;  1HX3 A;  3Q4I A;  1MQE A;  2KDW A;  2I8U A;  1RRS A;  4S2W A;  2XSQ A;  1PVF A;  1V8U A;  5GHN A;  2PNY A;  1NFS A;  1U20 A;  1VRL A;  1VCD A;  1PPW A;  3X0K A;  1PPV A;  5IW4 A;  5IW5 A;  3FK9 A;  3GZ8 A;  2A8Q A;  3FCM A;  3O52 A;  3SHD A;  2Q9P A;  3Q91 A;  3X0O A;  5FSL A;  3R03 A;  1VC9 A;  2YYH A;  2QJO A;  3I9X A;  3X0I A;  3SON A;  4IJX A;  3U53 A;  5ANU A;  5DD4 A;  1V8V A;  1G0S A;  1V8T A;  3N77 A;  3WHW A;  3FJY A;  3J7Y e;  1V8N A;  4K6E A;  3A6S A;  1PPX A;  1GA7 A;  3EXQ A;  4JZS A;  1NQZ A;  1QVJ A;  1XSA A;  1HZT A;  2FVV A;  3X0J A;  4J7G A;  1NQY A;  1MR2 A;  3AC9 A;  4KG4 A;  3P6Y A;  4NFX A;  2A8T A;  3ZR1 A;  5ISY A;  3O61 A;  3RH7 A;  1V8Y A;  2YVM A;  1V8S A;  3F6A A;  5CFI A;  1KHZ A;  1PUN A;  2O1C A;  4V14 A;  4ZG0 A;  3P5T A;  3GZ6 A;  1X51 A;  1TUM A;  1JKN A;  5DEQ A;  1V8M A;  2W4E A;  3Q1P A;  2A6T A;  3MCF A;  2YVP A;  3X0R A;  1OW2 A;  1VC8 A;  1G9Q A;  2G74 A;  5ANW A;  1VIQ A;  5LPG A;  2FKB A;  3QSJ A;  1Q27 A;  3X0S A;  5HZX A;  1PUS A;  4S2Y A;  1V8W A;  3N9U A;  3EF5 A;  3I7V A;  1MP2 A;  4DYW A;  1XSC A;  5DPK A;  1SOI A;  4YPR A; 
#chains in the Genus database with same CATH homology
 3Q2S A;  4ICK A;  5ANS A;  2VNQ A;  3FFU A;  4S2X A;  1I9A A;  2B0V A;  1F3Y A;  5GHJ A;  1X84 A;  2DUK A;  2GT2 A;  2DSB A;  2DSD A;  3X0L A;  3X0N A;  3Q2T A;  4N1T A;  5GHM A;  2YVO A;  3X0P A;  5C7Q A;  3BM4 A;  3Q93 A;  1R67 A;  2KDV A;  4HFQ A;  5C8L A;  3COU A;  1V8I A;  1V8R A;  2CL3 A;  3O69 A;  2O5W A;  1VHG A;  3GZ5 A;  1PUQ A;  2A8S A;  2I6K A;  3F13 A;  3ID9 A;  4JZT A;  4NFW A;  5I8U A;  5ANT A;  2CZR A;  5BON A;  1KTG A;  5FSO A;  2GT4 A;  3GRN A;  2QJT A;  4YOQ A;  3MDG A;  2AZW A;  1SU2 A;  5GHI A;  1KT9 A;  1SZ3 A;  1VHZ A;  2JVB A;  1X83 A;  2PQV A;  2R5W A;  2YVN A;  3KVH A;  3I7U A;  3O8S A;  4MPO A;  1MQW A;  1MK1 A;  1K26 A;  1RRQ A;  1Q54 A;  1NFZ A;  4C9X A;  1VIU A;  4HVY A;  1IRY A;  2B06 A;  5C7T A;  3EEU A;  3DKU A;  5GHP A;  5FSM A;  2FML A;  3HHJ A;  5FSK A;  2O5F A;  5FSI A;  3FSP A;  5CFJ A;  3MDI A;  2QKM B;  4N1U A;  3G0Q A;  2G73 A;  4J7H A;  1V8L A;  4JZU A;  2DSC A;  1VK6 A;  2VNP A;  2A8R A;  2J8Q A;  3A6U A;  3GG6 A;  1SJY A;  4ILQ A;  3ZR0 A;  3MGM A;  1K2E A;  5GHQ A;  5DDG A;  2DHO A;  3BHO A;  2ICJ A;  2A8P A;  2GB5 A;  3DUP A;  3A6V A;  3E57 A;  4KYX A;  5ANV A;  5GHO A;  3H95 A;  3HYQ A;  4KG3 A;  4C9W A;  3L85 A;  1Q33 A;  3CNG A;  4KTB A;  3GWY A;  3A6T A;  1XSB A;  2RRK A;  3EES A;  3ACA A;  2ICK A;  2I8T A;  4YPH A;  4S2V A;  4JZV A;  3BAP A;  1JRK A;  1RYA A;  3O6Z A;  2B2K A;  1MUT A;  5FSN A;  3OGA A;  3X0M A;  5BS6 A;  3SMD A;  3X0Q A;  1HX3 A;  3Q4I A;  1MQE A;  2KDW A;  2I8U A;  1RRS A;  4S2W A;  2XSQ A;  1PVF A;  1V8U A;  5GHN A;  2PNY A;  1NFS A;  1U20 A;  1VRL A;  1VCD A;  1PPW A;  3X0K A;  1PPV A;  5IW4 A;  5IW5 A;  3FK9 A;  3GZ8 A;  2A8Q A;  3FCM A;  3O52 A;  3SHD A;  2Q9P A;  3Q91 A;  3X0O A;  5FSL A;  3R03 A;  1VC9 A;  2YYH A;  2QJO A;  3I9X A;  3X0I A;  3SON A;  4IJX A;  3U53 A;  5ANU A;  5DD4 A;  1V8V A;  1G0S A;  1V8T A;  3N77 A;  3WHW A;  3FJY A;  3J7Y e;  1V8N A;  4K6E A;  3A6S A;  1PPX A;  1GA7 A;  3EXQ A;  4JZS A;  1NQZ A;  1QVJ A;  1XSA A;  1HZT A;  2FVV A;  3X0J A;  4J7G A;  1NQY A;  1MR2 A;  3AC9 A;  4KG4 A;  3P6Y A;  4NFX A;  2A8T A;  3ZR1 A;  5ISY A;  3O61 A;  3RH7 A;  1V8Y A;  2YVM A;  1V8S A;  3F6A A;  5CFI A;  1KHZ A;  1PUN A;  2O1C A;  4V14 A;  4ZG0 A;  3P5T A;  3GZ6 A;  1X51 A;  1TUM A;  1JKN A;  5DEQ A;  1V8M A;  2W4E A;  3Q1P A;  2A6T A;  3MCF A;  2YVP A;  3X0R A;  1OW2 A;  1VC8 A;  1G9Q A;  2G74 A;  5ANW A;  1VIQ A;  5LPG A;  2FKB A;  3QSJ A;  1Q27 A;  3X0S A;  5HZX A;  1PUS A;  4S2Y A;  1V8W A;  3N9U A;  3EF5 A;  3I7V A;  1MP2 A;  4DYW A;  1XSC A;  5DPK A;  1SOI A;  4YPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...