2O1CA

Structure of the e. coli dihydroneopterin triphosphate pyrophosphohydrolase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
147
structure length
147
Chain Sequence
KDKVYKRPVSILVVIYAQDTKRVLMLQRRDDPDFWQSVTGSVEEGETAPQAAMREVKEEVTIDVVAEQLTLIDCQRTVEFEIFSHLRHRYAPGVTRNTESWFCLALPHERQIVFTEHLAYKWLDAPAAAALTKSWSNRQAIEQFVIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords dATP pyrophosphohydrolase
publication title Structure and function of the E. coli dihydroneopterin triphosphate pyrophosphatase: a Nudix enzyme involved in folate biosynthesis.
pubmed doi rcsb
source organism Escherichia coli
total genus 44
structure length 147
sequence length 147
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.67: Dihydroneopterin triphosphate diphosphatase.
pdb deposition date 2006-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2o1cA00
3E57A 2A6TA 2I6KA 3BHOA 3X0IA 5BS6A 3FCMA 2VNPA 5C7TA 1V8LA 3SHDA 2YVOA 3Q93A 3DUPA 4JZUA 1PUQA 3ZR1A 1X51A 5ISYA 4ZG0A 4MPOA 5ANVA 3ID9A 4KYXA 4KTBA 1VC9A 3GZ8A 3I7VA 1MP2A 3G0QA 2CL3A 3GG6A 3O8SA 4KG3A 5BONA 1VRLA 1PUSA 2YYHA 5FSKA 1F3YA 4C9XA 1VHGA 2FKBA 1NFZA 4S2WA 5FSOA 1GA7A 3A6VA 3O69A 4NFWA 5IW5A 1RRSA 1VIQA 2A8SA 2YVMA 3R03A 3X0LA 1G0SA 3F6AA 3FFUA 5GHQA 4JZVA 3FK9A 1PUNA 3X0QA 2GB5A 2QKMB 1PPWA 1V8MA 2PNYA 3X0OA 2FMLA 3N9UA 2R5WA 1NQYA 3I7UA 3P6YA 1V8RA 3BM4A 1KTGA 5LPGA 3SONA 1RRQA 3KVHA 4K6EA 2GT2A 1HZTA 1Q54A 3I9XA 3EEUA 3MGMA 3EESA 4YOQA 3L85A 3MDIA 3HHJA 3OGAA 5FSLA 1IRYA 1NFSA 4JZSA 5GHPA 3P5TA 5C7QA 1VC8A 2VNQA 3Q2SA 1SOIA 5GHNA 5I8UA 3X0NA 3X0JA 5FSNA 4HVYA 3EF5A 5DD4A 1Q33A 5CFIA 5DPKA 2DHOA 1V8TA 1X84A 1Q27A 3N77A 2G74A 2Q9PA 2B0VA 1R67A 1K26A 2DSDA 2O1CA 1TUMA 2QJOA 5CFJA 3X0PA 1SJYA 2QJTA 3Q4IA 3WHWA 5FSMA 3U53A 1SU2A 5HZXA 1V8SA 2O5WA 5GHMA 1MUTA 3AC9A 3FJYA 3HYQA 3BAPA 1I9AA 1OW2A 1PPVA 2XSQA 4IJXA 3X0KA 3ACAA 2O5FA 3COUA 4S2VA 2GT4A 4YPRA 2J8QA 3X0SA 2DSCA 4JZTA 3MDGA 1V8IA 1PPXA 2I8TA 1RYAA 1NQZA 2FVVA 3DKUA 4ILQA 3X0MA 5ANSA 4C9WA 1MK1A 1JRKA 5GHIA 2DSBA 2I8UA 4S2YA 1MR2A 1QVJA 2A8TA 3F13A 2A8RA 3A6UA 1VK6A 4NFXA 3CNGA 5DEQA 2ICKA 3FSPA 3ZR0A 1VHZA 3RH7A 1XSAA 1G9QA 3MCFA 2G73A 1MQWA 1V8WA 2W4EA 2PQVA 1V8UA 2A8QA 4KG4A 3J7Ye 2KDVA 5GHOA 1V8YA 2RRKA 3SMDA 3GZ6A 5FSIA 1V8NA 1X83A 3GZ5A 5DDGA 5C8LA 4YPHA 3Q2TA 1VIUA 3GRNA 5GHJA 1JKNA 2B2KA 4DYWA 4N1UA 1K2EA 2B06A 2ICJA 3Q91A 4ICKA 5ANTA 1PVFA 4HFQA 1HX3A 2JVBA 4S2XA 3O61A 4N1TA 1KHZA 2YVPA 2A8PA 2YVNA 1MQEA 3EXQA 2AZWA 1XSBA 4V14A 3X0RA 1U20A 3Q1PA 1KT9A 3A6TA 2DUKA 3GWYA 5IW4A 3QSJA 1SZ3A 2KDWA 1XSCA 5ANWA 3O6ZA 3H95A 1V8VA 5ANUA 3A6SA 1VCDA 3O52A
chains in the Genus database with same CATH superfamily
3E57A 2A6TA 2I6KA 3BHOA 3X0IA 5BS6A 3FCMA 2VNPA 5C7TA 1V8LA 3SHDA 2YVOA 3Q93A 3DUPA 4JZUA 1PUQA 3ZR1A 1X51A 5ISYA 4ZG0A 4MPOA 5ANVA 3ID9A 4KYXA 4KTBA 1VC9A 3GZ8A 3I7VA 1MP2A 3G0QA 2CL3A 3GG6A 3O8SA 4KG3A 5BONA 1VRLA 1PUSA 2YYHA 5FSKA 1F3YA 4C9XA 1VHGA 2FKBA 1NFZA 4S2WA 5FSOA 1GA7A 3A6VA 3O69A 4NFWA 5IW5A 1RRSA 1VIQA 2A8SA 2YVMA 3R03A 3X0LA 1G0SA 3F6AA 3FFUA 5GHQA 4JZVA 3FK9A 1PUNA 3X0QA 2GB5A 2QKMB 1PPWA 1V8MA 2PNYA 3X0OA 2FMLA 3N9UA 2R5WA 1NQYA 3I7UA 3P6YA 1V8RA 3BM4A 1KTGA 5LPGA 3SONA 1RRQA 3KVHA 4K6EA 2GT2A 1HZTA 1Q54A 3I9XA 3EEUA 3MGMA 3EESA 4YOQA 3L85A 3MDIA 3HHJA 3OGAA 5FSLA 1IRYA 1NFSA 4JZSA 5GHPA 3P5TA 5C7QA 1VC8A 2VNQA 3Q2SA 1SOIA 5GHNA 5I8UA 3X0NA 3X0JA 5FSNA 4HVYA 3EF5A 5DD4A 4J7HA 1Q33A 5CFIA 5DPKA 2DHOA 1V8TA 1X84A 1Q27A 3N77A 2G74A 2Q9PA 2B0VA 1R67A 1K26A 2DSDA 2O1CA 1TUMA 2QJOA 5CFJA 3X0PA 1SJYA 2QJTA 3Q4IA 3WHWA 5FSMA 3U53A 1SU2A 5HZXA 1V8SA 2O5WA 5GHMA 1MUTA 3AC9A 3FJYA 3HYQA 3BAPA 1I9AA 1OW2A 1PPVA 2XSQA 4IJXA 3X0KA 3ACAA 4J7GA 2O5FA 3COUA 4S2VA 2GT4A 4YPRA 2J8QA 3X0SA 2DSCA 4JZTA 3MDGA 1V8IA 1PPXA 2I8TA 1RYAA 1NQZA 2FVVA 3DKUA 4ILQA 3X0MA 5ANSA 4C9WA 1MK1A 1JRKA 5GHIA 2DSBA 2I8UA 4S2YA 1MR2A 1QVJA 2A8TA 3F13A 2A8RA 3A6UA 1VK6A 4NFXA 3CNGA 5DEQA 2ICKA 3FSPA 3ZR0A 1VHZA 3RH7A 1XSAA 1G9QA 3MCFA 2G73A 1MQWA 1V8WA 2W4EA 2PQVA 1V8UA 2A8QA 4KG4A 3J7Ye 2KDVA 5GHOA 1V8YA 2RRKA 3SMDA 3GZ6A 5FSIA 1V8NA 1X83A 3GZ5A 5DDGA 5C8LA 4YPHA 3Q2TA 1VIUA 3GRNA 5GHJA 1JKNA 2B2KA 4DYWA 2CZRA 1K2EA 2B06A 4N1UA 2ICJA 3Q91A 4ICKA 5ANTA 1PVFA 4HFQA 1HX3A 2JVBA 4S2XA 3O61A 4N1TA 1KHZA 2YVPA 2A8PA 2YVNA 1MQEA 3EXQA 2AZWA 1XSBA 4V14A 3X0RA 1U20A 3Q1PA 1KT9A 3A6TA 2DUKA 3GWYA 5IW4A 3QSJA 1SZ3A 2KDWA 1XSCA 5ANWA 3O6ZA 3H95A 1V8VA 5ANUA 3A6SA 1VCDA 3O52A
chains in the Genus database with same CATH topology
3E57A 2A6TA 2I6KA 3BHOA 3X0IA 5BS6A 3FCMA 2VNPA 5C7TA 1V8LA 3SHDA 2YVOA 3Q93A 3DUPA 4JZUA 1PUQA 3ZR1A 1X51A 5ISYA 4ZG0A 4MPOA 5ANVA 3ID9A 4KYXA 4KTBA 1VC9A 3GZ8A 3I7VA 1MP2A 3G0QA 2CL3A 3GG6A 3O8SA 4KG3A 5BONA 1VRLA 1PUSA 2YYHA 5FSKA 1F3YA 4C9XA 1VHGA 2FKBA 1NFZA 4S2WA 5FSOA 1GA7A 3A6VA 3O69A 4NFWA 5IW5A 1RRSA 1VIQA 2A8SA 2YVMA 3R03A 3X0LA 1G0SA 3F6AA 3FFUA 5GHQA 4JZVA 3FK9A 1PUNA 3X0QA 2GB5A 2QKMB 1PPWA 1V8MA 2PNYA 3X0OA 2FMLA 3N9UA 2R5WA 1NQYA 3I7UA 3P6YA 1V8RA 3BM4A 1KTGA 5LPGA 3SONA 1RRQA 3KVHA 4K6EA 2GT2A 1HZTA 1Q54A 3I9XA 3EEUA 3MGMA 3EESA 4YOQA 3L85A 3MDIA 3HHJA 3OGAA 5FSLA 1IRYA 1NFSA 4JZSA 5GHPA 3P5TA 5C7QA 1VC8A 2VNQA 3Q2SA 1SOIA 5GHNA 5I8UA 3X0NA 3X0JA 5FSNA 4HVYA 3EF5A 5DD4A 4J7HA 1Q33A 5CFIA 5DPKA 2DHOA 1V8TA 1X84A 1Q27A 3N77A 2G74A 2Q9PA 2B0VA 1R67A 1K26A 2DSDA 2O1CA 1TUMA 2QJOA 5CFJA 3X0PA 1SJYA 2QJTA 3Q4IA 3WHWA 5FSMA 3U53A 1SU2A 5HZXA 1V8SA 2O5WA 5GHMA 1MUTA 3AC9A 3FJYA 3HYQA 3BAPA 1I9AA 1OW2A 1PPVA 2XSQA 4IJXA 3X0KA 3ACAA 4J7GA 2O5FA 3COUA 4S2VA 2GT4A 4YPRA 2J8QA 3X0SA 2DSCA 4JZTA 3MDGA 1V8IA 1PPXA 2I8TA 1RYAA 1NQZA 2FVVA 3DKUA 4ILQA 3X0MA 5ANSA 4C9WA 1MK1A 1JRKA 5GHIA 2DSBA 2I8UA 4S2YA 1MR2A 1QVJA 2A8TA 3F13A 2A8RA 3A6UA 1VK6A 4NFXA 3CNGA 5DEQA 2ICKA 3FSPA 3ZR0A 1VHZA 3RH7A 1XSAA 1G9QA 3MCFA 2G73A 1MQWA 1V8WA 2W4EA 2PQVA 1V8UA 2A8QA 4KG4A 3J7Ye 2KDVA 5GHOA 1V8YA 2RRKA 3SMDA 3GZ6A 5FSIA 1V8NA 1X83A 3GZ5A 5DDGA 5C8LA 4YPHA 3Q2TA 1VIUA 3GRNA 5GHJA 1JKNA 2B2KA 4DYWA 2CZRA 1K2EA 2B06A 4N1UA 2ICJA 3Q91A 4ICKA 5ANTA 1PVFA 4HFQA 1HX3A 2JVBA 4S2XA 3O61A 4N1TA 1KHZA 2YVPA 2A8PA 2YVNA 1MQEA 3EXQA 2AZWA 1XSBA 4V14A 3X0RA 1U20A 3Q1PA 1KT9A 3A6TA 2DUKA 3GWYA 5IW4A 3QSJA 1SZ3A 2KDWA 1XSCA 5ANWA 3O6ZA 3H95A 1V8VA 5ANUA 3A6SA 1VCDA 3O52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E57 A;  2A6T A;  2I6K A;  3BHO A;  3X0I A;  5BS6 A;  3FCM A;  2VNP A;  5C7T A;  1V8L A;  3SHD A;  2YVO A;  3Q93 A;  3DUP A;  4JZU A;  1PUQ A;  3ZR1 A;  1X51 A;  5ISY A;  4ZG0 A;  4MPO A;  5ANV A;  3ID9 A;  4KYX A;  4KTB A;  1VC9 A;  3GZ8 A;  3I7V A;  1MP2 A;  3G0Q A;  2CL3 A;  3GG6 A;  3O8S A;  4KG3 A;  5BON A;  1VRL A;  1PUS A;  2YYH A;  5FSK A;  1F3Y A;  4C9X A;  1VHG A;  2FKB A;  1NFZ A;  4S2W A;  5FSO A;  1GA7 A;  3A6V A;  3O69 A;  4NFW A;  5IW5 A;  1RRS A;  1VIQ A;  2A8S A;  2YVM A;  3R03 A;  3X0L A;  1G0S A;  3F6A A;  3FFU A;  5GHQ A;  4JZV A;  3FK9 A;  1PUN A;  3X0Q A;  2GB5 A;  2QKM B;  1PPW A;  1V8M A;  2PNY A;  3X0O A;  2FML A;  3N9U A;  2R5W A;  1NQY A;  3I7U A;  3P6Y A;  1V8R A;  3BM4 A;  1KTG A;  5LPG A;  3SON A;  1RRQ A;  3KVH A;  4K6E A;  2GT2 A;  1HZT A;  1Q54 A;  3I9X A;  3EEU A;  3MGM A;  3EES A;  4YOQ A;  3L85 A;  3MDI A;  3HHJ A;  3OGA A;  5FSL A;  1IRY A;  1NFS A;  4JZS A;  5GHP A;  3P5T A;  5C7Q A;  1VC8 A;  2VNQ A;  3Q2S A;  1SOI A;  5GHN A;  5I8U A;  3X0N A;  3X0J A;  5FSN A;  4HVY A;  3EF5 A;  5DD4 A;  1Q33 A;  5CFI A;  5DPK A;  2DHO A;  1V8T A;  1X84 A;  1Q27 A;  3N77 A;  2G74 A;  2Q9P A;  2B0V A;  1R67 A;  1K26 A;  2DSD A;  2O1C A;  1TUM A;  2QJO A;  5CFJ A;  3X0P A;  1SJY A;  2QJT A;  3Q4I A;  3WHW A;  5FSM A;  3U53 A;  1SU2 A;  5HZX A;  1V8S A;  2O5W A;  5GHM A;  1MUT A;  3AC9 A;  3FJY A;  3HYQ A;  3BAP A;  1I9A A;  1OW2 A;  1PPV A;  2XSQ A;  4IJX A;  3X0K A;  3ACA A;  2O5F A;  3COU A;  4S2V A;  2GT4 A;  4YPR A;  2J8Q A;  3X0S A;  2DSC A;  4JZT A;  3MDG A;  1V8I A;  1PPX A;  2I8T A;  1RYA A;  1NQZ A;  2FVV A;  3DKU A;  4ILQ A;  3X0M A;  5ANS A;  4C9W A;  1MK1 A;  1JRK A;  5GHI A;  2DSB A;  2I8U A;  4S2Y A;  1MR2 A;  1QVJ A;  2A8T A;  3F13 A;  2A8R A;  3A6U A;  1VK6 A;  4NFX A;  3CNG A;  5DEQ A;  2ICK A;  3FSP A;  3ZR0 A;  1VHZ A;  3RH7 A;  1XSA A;  1G9Q A;  3MCF A;  2G73 A;  1MQW A;  1V8W A;  2W4E A;  2PQV A;  1V8U A;  2A8Q A;  4KG4 A;  3J7Y e;  2KDV A;  5GHO A;  1V8Y A;  2RRK A;  3SMD A;  3GZ6 A;  5FSI A;  1V8N A;  1X83 A;  3GZ5 A;  5DDG A;  5C8L A;  4YPH A;  3Q2T A;  1VIU A;  3GRN A;  5GHJ A;  1JKN A;  2B2K A;  4DYW A;  4N1U A;  1K2E A;  2B06 A;  2ICJ A;  3Q91 A;  4ICK A;  5ANT A;  1PVF A;  4HFQ A;  1HX3 A;  2JVB A;  4S2X A;  3O61 A;  4N1T A;  1KHZ A;  2YVP A;  2A8P A;  2YVN A;  1MQE A;  3EXQ A;  2AZW A;  1XSB A;  4V14 A;  3X0R A;  1U20 A;  3Q1P A;  1KT9 A;  3A6T A;  2DUK A;  3GWY A;  5IW4 A;  3QSJ A;  1SZ3 A;  2KDW A;  1XSC A;  5ANW A;  3O6Z A;  3H95 A;  1V8V A;  5ANU A;  3A6S A;  1VCD A;  3O52 A; 
#chains in the Genus database with same CATH topology
 3E57 A;  2A6T A;  2I6K A;  3BHO A;  3X0I A;  5BS6 A;  3FCM A;  2VNP A;  5C7T A;  1V8L A;  3SHD A;  2YVO A;  3Q93 A;  3DUP A;  4JZU A;  1PUQ A;  3ZR1 A;  1X51 A;  5ISY A;  4ZG0 A;  4MPO A;  5ANV A;  3ID9 A;  4KYX A;  4KTB A;  1VC9 A;  3GZ8 A;  3I7V A;  1MP2 A;  3G0Q A;  2CL3 A;  3GG6 A;  3O8S A;  4KG3 A;  5BON A;  1VRL A;  1PUS A;  2YYH A;  5FSK A;  1F3Y A;  4C9X A;  1VHG A;  2FKB A;  1NFZ A;  4S2W A;  5FSO A;  1GA7 A;  3A6V A;  3O69 A;  4NFW A;  5IW5 A;  1RRS A;  1VIQ A;  2A8S A;  2YVM A;  3R03 A;  3X0L A;  1G0S A;  3F6A A;  3FFU A;  5GHQ A;  4JZV A;  3FK9 A;  1PUN A;  3X0Q A;  2GB5 A;  2QKM B;  1PPW A;  1V8M A;  2PNY A;  3X0O A;  2FML A;  3N9U A;  2R5W A;  1NQY A;  3I7U A;  3P6Y A;  1V8R A;  3BM4 A;  1KTG A;  5LPG A;  3SON A;  1RRQ A;  3KVH A;  4K6E A;  2GT2 A;  1HZT A;  1Q54 A;  3I9X A;  3EEU A;  3MGM A;  3EES A;  4YOQ A;  3L85 A;  3MDI A;  3HHJ A;  3OGA A;  5FSL A;  1IRY A;  1NFS A;  4JZS A;  5GHP A;  3P5T A;  5C7Q A;  1VC8 A;  2VNQ A;  3Q2S A;  1SOI A;  5GHN A;  5I8U A;  3X0N A;  3X0J A;  5FSN A;  4HVY A;  3EF5 A;  5DD4 A;  4J7H A;  1Q33 A;  5CFI A;  5DPK A;  2DHO A;  1V8T A;  1X84 A;  1Q27 A;  3N77 A;  2G74 A;  2Q9P A;  2B0V A;  1R67 A;  1K26 A;  2DSD A;  2O1C A;  1TUM A;  2QJO A;  5CFJ A;  3X0P A;  1SJY A;  2QJT A;  3Q4I A;  3WHW A;  5FSM A;  3U53 A;  1SU2 A;  5HZX A;  1V8S A;  2O5W A;  5GHM A;  1MUT A;  3AC9 A;  3FJY A;  3HYQ A;  3BAP A;  1I9A A;  1OW2 A;  1PPV A;  2XSQ A;  4IJX A;  3X0K A;  3ACA A;  4J7G A;  2O5F A;  3COU A;  4S2V A;  2GT4 A;  4YPR A;  2J8Q A;  3X0S A;  2DSC A;  4JZT A;  3MDG A;  1V8I A;  1PPX A;  2I8T A;  1RYA A;  1NQZ A;  2FVV A;  3DKU A;  4ILQ A;  3X0M A;  5ANS A;  4C9W A;  1MK1 A;  1JRK A;  5GHI A;  2DSB A;  2I8U A;  4S2Y A;  1MR2 A;  1QVJ A;  2A8T A;  3F13 A;  2A8R A;  3A6U A;  1VK6 A;  4NFX A;  3CNG A;  5DEQ A;  2ICK A;  3FSP A;  3ZR0 A;  1VHZ A;  3RH7 A;  1XSA A;  1G9Q A;  3MCF A;  2G73 A;  1MQW A;  1V8W A;  2W4E A;  2PQV A;  1V8U A;  2A8Q A;  4KG4 A;  3J7Y e;  2KDV A;  5GHO A;  1V8Y A;  2RRK A;  3SMD A;  3GZ6 A;  5FSI A;  1V8N A;  1X83 A;  3GZ5 A;  5DDG A;  5C8L A;  4YPH A;  3Q2T A;  1VIU A;  3GRN A;  5GHJ A;  1JKN A;  2B2K A;  4DYW A;  2CZR A;  1K2E A;  2B06 A;  4N1U A;  2ICJ A;  3Q91 A;  4ICK A;  5ANT A;  1PVF A;  4HFQ A;  1HX3 A;  2JVB A;  4S2X A;  3O61 A;  4N1T A;  1KHZ A;  2YVP A;  2A8P A;  2YVN A;  1MQE A;  3EXQ A;  2AZW A;  1XSB A;  4V14 A;  3X0R A;  1U20 A;  3Q1P A;  1KT9 A;  3A6T A;  2DUK A;  3GWY A;  5IW4 A;  3QSJ A;  1SZ3 A;  2KDW A;  1XSC A;  5ANW A;  3O6Z A;  3H95 A;  1V8V A;  5ANU A;  3A6S A;  1VCD A;  3O52 A; 
#chains in the Genus database with same CATH homology
 3E57 A;  2A6T A;  2I6K A;  3BHO A;  3X0I A;  5BS6 A;  3FCM A;  2VNP A;  5C7T A;  1V8L A;  3SHD A;  2YVO A;  3Q93 A;  3DUP A;  4JZU A;  1PUQ A;  3ZR1 A;  1X51 A;  5ISY A;  4ZG0 A;  4MPO A;  5ANV A;  3ID9 A;  4KYX A;  4KTB A;  1VC9 A;  3GZ8 A;  3I7V A;  1MP2 A;  3G0Q A;  2CL3 A;  3GG6 A;  3O8S A;  4KG3 A;  5BON A;  1VRL A;  1PUS A;  2YYH A;  5FSK A;  1F3Y A;  4C9X A;  1VHG A;  2FKB A;  1NFZ A;  4S2W A;  5FSO A;  1GA7 A;  3A6V A;  3O69 A;  4NFW A;  5IW5 A;  1RRS A;  1VIQ A;  2A8S A;  2YVM A;  3R03 A;  3X0L A;  1G0S A;  3F6A A;  3FFU A;  5GHQ A;  4JZV A;  3FK9 A;  1PUN A;  3X0Q A;  2GB5 A;  2QKM B;  1PPW A;  1V8M A;  2PNY A;  3X0O A;  2FML A;  3N9U A;  2R5W A;  1NQY A;  3I7U A;  3P6Y A;  1V8R A;  3BM4 A;  1KTG A;  5LPG A;  3SON A;  1RRQ A;  3KVH A;  4K6E A;  2GT2 A;  1HZT A;  1Q54 A;  3I9X A;  3EEU A;  3MGM A;  3EES A;  4YOQ A;  3L85 A;  3MDI A;  3HHJ A;  3OGA A;  5FSL A;  1IRY A;  1NFS A;  4JZS A;  5GHP A;  3P5T A;  5C7Q A;  1VC8 A;  2VNQ A;  3Q2S A;  1SOI A;  5GHN A;  5I8U A;  3X0N A;  3X0J A;  5FSN A;  4HVY A;  3EF5 A;  5DD4 A;  4J7H A;  1Q33 A;  5CFI A;  5DPK A;  2DHO A;  1V8T A;  1X84 A;  1Q27 A;  3N77 A;  2G74 A;  2Q9P A;  2B0V A;  1R67 A;  1K26 A;  2DSD A;  2O1C A;  1TUM A;  2QJO A;  5CFJ A;  3X0P A;  1SJY A;  2QJT A;  3Q4I A;  3WHW A;  5FSM A;  3U53 A;  1SU2 A;  5HZX A;  1V8S A;  2O5W A;  5GHM A;  1MUT A;  3AC9 A;  3FJY A;  3HYQ A;  3BAP A;  1I9A A;  1OW2 A;  1PPV A;  2XSQ A;  4IJX A;  3X0K A;  3ACA A;  4J7G A;  2O5F A;  3COU A;  4S2V A;  2GT4 A;  4YPR A;  2J8Q A;  3X0S A;  2DSC A;  4JZT A;  3MDG A;  1V8I A;  1PPX A;  2I8T A;  1RYA A;  1NQZ A;  2FVV A;  3DKU A;  4ILQ A;  3X0M A;  5ANS A;  4C9W A;  1MK1 A;  1JRK A;  5GHI A;  2DSB A;  2I8U A;  4S2Y A;  1MR2 A;  1QVJ A;  2A8T A;  3F13 A;  2A8R A;  3A6U A;  1VK6 A;  4NFX A;  3CNG A;  5DEQ A;  2ICK A;  3FSP A;  3ZR0 A;  1VHZ A;  3RH7 A;  1XSA A;  1G9Q A;  3MCF A;  2G73 A;  1MQW A;  1V8W A;  2W4E A;  2PQV A;  1V8U A;  2A8Q A;  4KG4 A;  3J7Y e;  2KDV A;  5GHO A;  1V8Y A;  2RRK A;  3SMD A;  3GZ6 A;  5FSI A;  1V8N A;  1X83 A;  3GZ5 A;  5DDG A;  5C8L A;  4YPH A;  3Q2T A;  1VIU A;  3GRN A;  5GHJ A;  1JKN A;  2B2K A;  4DYW A;  2CZR A;  1K2E A;  2B06 A;  4N1U A;  2ICJ A;  3Q91 A;  4ICK A;  5ANT A;  1PVF A;  4HFQ A;  1HX3 A;  2JVB A;  4S2X A;  3O61 A;  4N1T A;  1KHZ A;  2YVP A;  2A8P A;  2YVN A;  1MQE A;  3EXQ A;  2AZW A;  1XSB A;  4V14 A;  3X0R A;  1U20 A;  3Q1P A;  1KT9 A;  3A6T A;  2DUK A;  3GWY A;  5IW4 A;  3QSJ A;  1SZ3 A;  2KDW A;  1XSC A;  5ANW A;  3O6Z A;  3H95 A;  1V8V A;  5ANU A;  3A6S A;  1VCD A;  3O52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...